Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_13.4718.847ON58158130660.0
Smik_13.4958.847ON57658321950.0
Skud_13.4548.847ON58058321530.0
YMR282C (AEP2)8.847ON58058321510.0
Kpol_1068.38.847ON5665095032e-55
SAKL0D01298g8.847ON5514204925e-54
TDEL0B005108.847ON5503664812e-52
ZYRO0G14322g8.847ON5504534794e-52
Kwal_27.102248.847ON5464584495e-48
KLTH0C03718g8.847ON5514554452e-47
TPHA0I002908.847ON5694554285e-45
KLLA0D01408g8.847ON5184123163e-30
CAGL0M03069g8.847ON5484003067e-29
KAFR0B039708.847ON4744593002e-28
Ecym_46188.847ON5273723004e-28
NCAS0C003708.847ON4953892933e-27
NDAI0K003408.847ON6244412882e-26
KNAG0J002308.847ON4743732772e-25
TBLA0B033108.847ON6134942722e-24
ABL119C8.847ON5373401181e-05
Smik_2.1028.161ON526159830.20
TBLA0E035608.161ON524192810.29
KAFR0F042606.358ON12746730.83
YML025C (YML6)5.565ON28672732.4
ZYRO0G07832g4.15ON184944742.9
KLLA0F27599g7.226ON522193723.9
KLTH0G03718g5.525ON857129707.7
Skud_14.1332.48ON85892698.2
KLTH0B10318gsingletonON154840708.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_13.471
         (581 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {...  1185   0.0  
Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {...   850   0.0  
Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {...   833   0.0  
YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON} ...   833   0.0  
Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..599...   198   2e-55
SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly s...   194   5e-54
TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847...   189   2e-52
ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]...   189   4e-52
Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282...   177   5e-48
KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly...   176   2e-47
TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}...   169   5e-45
KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly...   126   3e-30
CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa] ...   122   7e-29
KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {O...   120   2e-28
Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {O...   120   4e-28
NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847...   117   3e-27
NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON...   115   2e-26
KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.84...   111   2e-25
TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {O...   109   2e-24
ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON} S...    50   1e-05
Smik_2.102 Chr2 (187680..189260) [1581 bp, 526 aa] {ON} YBL015W ...    37   0.20 
TBLA0E03560 Chr5 (890420..891994) [1575 bp, 524 aa] {ON} Anc_8.1...    36   0.29 
KAFR0F04260 Chr6 complement(833718..834101) [384 bp, 127 aa] {ON...    33   0.83 
YML025C Chr13 complement(224406..225239,225339..225365) [861 bp,...    33   2.4  
ZYRO0G07832g Chr7 (628580..634129) [5550 bp, 1849 aa] {ON} simil...    33   2.9  
KLLA0F27599g Chr6 (2558178..2559746) [1569 bp, 522 aa] {ON} high...    32   3.9  
KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} simila...    32   7.7  
Skud_14.133 Chr14 complement(249544..252120) [2577 bp, 858 aa] {...    31   8.2  
KLTH0B10318g Chr2 (869187..873833) [4647 bp, 1548 aa] {ON} no si...    32   8.4  

>Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {ON}
           YMR282C (REAL)
          Length = 581

 Score = 1185 bits (3066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/581 (98%), Positives = 575/581 (98%)

Query: 1   MWMNKLAKYPSPSILGLYTRRLCNESFRSLQEVDILPNIMIGNTVHSRRTCVTSRTLLTC 60
           MWMNKLAKYPSPSILGLYTRRLCNESFRSLQEVDILPNIMIGNTVHSRRTCVTSRTLLTC
Sbjct: 1   MWMNKLAKYPSPSILGLYTRRLCNESFRSLQEVDILPNIMIGNTVHSRRTCVTSRTLLTC 60

Query: 61  DIAAQKFYSTHKLNAIDQPTNGNAQRPHDMFKVKDIPIDMFTLRRIIDSSSMNELDFSKS 120
           DIAAQKFYSTHKLNAIDQPTNGNAQRPHDMFKVKDIPIDMFTLRRIIDSSSMNELDFSKS
Sbjct: 61  DIAAQKFYSTHKLNAIDQPTNGNAQRPHDMFKVKDIPIDMFTLRRIIDSSSMNELDFSKS 120

Query: 121 MTYLFVKAINSEARETLSLEDLSFLLNNLYSQRFEIKKICKDINVRYSEFWFKLFSLYAE 180
           MTYLFVKAINSEARETLSLEDLSFLLNNLYSQRFEIKKICKDINVRYSEFWFKLFSLYAE
Sbjct: 121 MTYLFVKAINSEARETLSLEDLSFLLNNLYSQRFEIKKICKDINVRYSEFWFKLFSLYAE 180

Query: 181 KVDVKRNQINLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKN 240
           KVDVKRNQINLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKN
Sbjct: 181 KVDVKRNQINLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKN 240

Query: 241 ADIGTIIHFLQLRCGALAAYWKMPDNSEQKYSRKMVRLGAKNTSIRITSSYKAMDHQTLL 300
           ADIGTIIHFLQLRCGALAAYWKMPDNSEQKYSRKMVRLGAKNTSIRITSSYKAMDHQTLL
Sbjct: 241 ADIGTIIHFLQLRCGALAAYWKMPDNSEQKYSRKMVRLGAKNTSIRITSSYKAMDHQTLL 300

Query: 301 KIADLVLQKERLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKT 360
           KIADLVLQKERLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKT
Sbjct: 301 KIADLVLQKERLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKT 360

Query: 361 RGCCPSSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFAWT 420
           RGCCPSSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFAWT
Sbjct: 361 RGCCPSSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFAWT 420

Query: 421 PTHDKRATSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQNFKP 480
           PTHDKRATSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQNFKP
Sbjct: 421 PTHDKRATSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQNFKP 480

Query: 481 GITRTSAMKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKELNVFCTN 540
           GITRTSAMKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKELNVFCTN
Sbjct: 481 GITRTSAMKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKELNVFCTN 540

Query: 541 RILLRSKKLKNKTENRKERNRSGQGNFXXXXXXGMVIGSLW 581
           RILLRSKKLKNKTENRKERNRSGQGNF      GMVIGSLW
Sbjct: 541 RILLRSKKLKNKTENRKERNRSGQGNFDDDDDDGMVIGSLW 581

>Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {ON}
           YMR282C (REAL)
          Length = 576

 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/583 (70%), Positives = 478/583 (81%), Gaps = 9/583 (1%)

Query: 1   MWMNKLAKYPSPSILGLYTRRLCNESFRSLQEVDILPNIMIGNTVHSRRTCVTSRTLLTC 60
           MWMNKL K PS SILGLY +R C ESF+SLQE+D+LPN  I +  HSRRTCVT       
Sbjct: 1   MWMNKLTKCPSCSILGLYMKRFCTESFKSLQEIDVLPNRAIFHYTHSRRTCVTIN----- 55

Query: 61  DIAAQKFYSTHKLNAIDQPTNGNAQRPHDMFKVKDIPIDMFTLRRIIDSSSMNELDFSKS 120
           D + +K +STH + A     NGN  R +D F++K IPID++TLRRII SS   ELDFSK 
Sbjct: 56  DTSTRKSFSTHSMCATGHLNNGNTPRDYDKFELKGIPIDVYTLRRIISSSGSTELDFSKG 115

Query: 121 MTYLFVKAINSEARETLSLEDLSFLLNNLYSQRFEIKKICKDINVRYSEFWFKLFSLYAE 180
           ++YLF K ++S  R +LSL +LSFLLN LYS RF+I+ IC+DI V+YSEFWFK+FSLYAE
Sbjct: 116 ISYLFTKTVDSGPRNSLSLAELSFLLNKLYSLRFQIRGICRDIKVKYSEFWFKIFSLYAE 175

Query: 181 KVDVKRNQINLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKN 240
           KVD KRN INLRNT LD+ EIFD+NL+I+NFIELGQLGKAQK+L+FI+DRN DILLSP N
Sbjct: 176 KVDAKRNHINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNN 235

Query: 241 ADIGTIIHFLQLRCGALAAYWKMPDNS--EQKYSRKMVRLGAKNTSIRITSSYKAMDHQT 298
           ADIGT++HFL+LRCGALAAYWK+PDNS  +QK  RK+VRLGAKNTSIR++S+YK MDHQT
Sbjct: 236 ADIGTMVHFLKLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTYKVMDHQT 295

Query: 299 LLKIADLVLQKERLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKP 358
           LLKIADLVL ++R LNSEDLLSTLIQSFGHLGQTQILERCIEHIW I+ QEFPSH  IKP
Sbjct: 296 LLKIADLVLHEKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKP 355

Query: 359 KTRGCCPSSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFA 418
             RGC PSSKILISILVSFH NDNDLHRGLSILDSFIKHYPEVK+D LFWRRLFQLS+FA
Sbjct: 356 --RGCYPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFA 413

Query: 419 WTPTHDKRATSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQNF 478
           WTP  DK+ATS++RCWHLMKQWH SKG SLSVDYETLRQLYD+ KKTGN+ LGIDVL++F
Sbjct: 414 WTPAKDKKATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVLKSF 473

Query: 479 KPGITRTSAMKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKELNVFC 538
           K GI R     ++K+N ++IK+QKYIIKQLV+RG+ SA REFINDF FD    K LN+FC
Sbjct: 474 KSGIERLRETNSDKLNIVLIKYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNLNIFC 533

Query: 539 TNRILLRSKKLKNKTENRKERNRSGQGNFXXXXXXGMVIGSLW 581
           TNR+LLRSKK K+K EN+KERN+     F      GM+IGSLW
Sbjct: 534 TNRLLLRSKKNKSKIENKKERNKLEPSGFDDDEDDGMIIGSLW 576

>Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {ON}
           YMR282C (REAL)
          Length = 580

 Score =  833 bits (2153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/583 (71%), Positives = 481/583 (82%), Gaps = 5/583 (0%)

Query: 1   MWMNKLAKYPSPSILGLYTRRLCNESFRSLQEVDILPNIMIGNTVHSRRTCVTSRTLLTC 60
           MWMNKL KY   ++ GLY +RLC+ES  S+++ DILPN  I ++  SR+T VT+RTL+  
Sbjct: 1   MWMNKLVKYRFSNVFGLYKKRLCDESLGSVKQFDILPNSTIFHSTRSRKTYVTARTLVR- 59

Query: 61  DIAAQKFYSTHKLNAIDQPTNGNAQRPHDMFKVKDIPIDMFTLRRIIDSSSMNELDFSKS 120
           +I  QKFYSTHKL   +Q T  NA R +D F++K IPID  TLRRII+SS  NE +FSKS
Sbjct: 60  NIVIQKFYSTHKLYLNNQSTYANAHRAYDKFEIKGIPIDAHTLRRIINSSGTNEQEFSKS 119

Query: 121 MTYLFVKAINSEARETLSLEDLSFLLNNLYSQRFEIKKICKDINVRYSEFWFKLFSLYAE 180
           + YLF+K +NS  RE L L DLS LLN LYSQRFEI+ ICK+INV+YSEFWFKLFSLYAE
Sbjct: 120 VNYLFMKIVNSGNREILPLGDLSLLLNKLYSQRFEIRLICKEINVKYSEFWFKLFSLYAE 179

Query: 181 KVDVKRNQINLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKN 240
           KVD +R+Q+NLRNTALDS EIFD+NL+IKNFIELGQL KAQK+LSFILDRN DILLSP+N
Sbjct: 180 KVDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKILSFILDRNPDILLSPRN 239

Query: 241 ADIGTIIHFLQLRCGALAAYWKMPDNSEQKYS--RKMVRLGAKNTSIRITSSYKAMDHQT 298
           ADIGTI+HFLQLRCGAL AYWK+PDNS +K +  R+MVRLGAKNTSIR++S+YKAMDHQT
Sbjct: 240 ADIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMDHQT 299

Query: 299 LLKIADLVLQKERLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKP 358
           LLKIADLVLQ +R LNSEDLLSTLIQSFGHLGQTQILERCIEHIWQIS QEFPSH  IKP
Sbjct: 300 LLKIADLVLQDKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISSQEFPSHVAIKP 359

Query: 359 KTRGCCPSSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFA 418
             RGC PSSKILISILVSFHLND DLHRGLSILDSFIKHYPEVK+D LFWRRL QLSHFA
Sbjct: 360 --RGCYPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFA 417

Query: 419 WTPTHDKRATSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQNF 478
           WTP +DKRA SIV+CWHLMK W+ESK  S SVDYETLRQLY++ KKTGN+SLGIDVL++F
Sbjct: 418 WTPVNDKRAASIVKCWHLMKHWYESKELSPSVDYETLRQLYEVMKKTGNFSLGIDVLKSF 477

Query: 479 KPGITRTSAMKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKELNVFC 538
           K GI +      EK+  I+IK+QK IIKQLVNRGK SAAR+FI DF F+  A K+LN+FC
Sbjct: 478 KSGIEKMRTANPEKLEAILIKYQKCIIKQLVNRGKISAARKFIGDFGFNRRAAKDLNIFC 537

Query: 539 TNRILLRSKKLKNKTENRKERNRSGQGNFXXXXXXGMVIGSLW 581
           +NRI  RSKK+KN  EN+K+R+    GN+      GM+IGSLW
Sbjct: 538 SNRIFSRSKKIKNDIENKKKRDGLAPGNYDDDEDDGMIIGSLW 580

>YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON}
           AEP2Mitochondrial protein, likely involved in
           translation of the mitochondrial OLI1 mRNA; exhibits
           genetic interaction with the OLI1 mRNA 5'-untranslated
           leader
          Length = 580

 Score =  833 bits (2151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/583 (69%), Positives = 480/583 (82%), Gaps = 5/583 (0%)

Query: 1   MWMNKLAKYPSPSILGLYTRRLCNESFRSLQEVDILPNIMIGNTVHSRRTCVTSRTLLTC 60
           MW+N+L K+PS S+L  YT+RLC  S +SL+E  +LPN  I ++V+ RRT V  R ++  
Sbjct: 1   MWINRLVKHPSYSVLRFYTKRLCTVSVKSLREFGVLPNSTICHSVYPRRTYVMGRAVIN- 59

Query: 61  DIAAQKFYSTHKLNAIDQPTNGNAQRPHDMFKVKDIPIDMFTLRRIIDSSSMNELDFSKS 120
           DI  +K YSTH + AID+  + N    +D F+ K IPID+ TL+RII SS M+E +FSKS
Sbjct: 60  DILIKKSYSTHTVCAIDRSKDENNGSAYDKFEAKGIPIDVHTLKRIISSSGMDESEFSKS 119

Query: 121 MTYLFVKAINSEARETLSLEDLSFLLNNLYSQRFEIKKICKDINVRYSEFWFKLFSLYAE 180
           ++YLF K ++ E ++ LSLEDLSFLL+ LY+QRF+I++IC+DIN +YSEFWFKLFSLYAE
Sbjct: 120 ISYLFAKTVDPEPKDVLSLEDLSFLLSKLYTQRFQIRRICRDINAKYSEFWFKLFSLYAE 179

Query: 181 KVDVKRNQINLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKN 240
           KVD KRNQ+NLRNT LD+ EIFD NL+IKNFIELGQLGKAQK+LSFILDRN DILLSPKN
Sbjct: 180 KVDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKN 239

Query: 241 ADIGTIIHFLQLRCGALAAYWKMPDNSEQK--YSRKMVRLGAKNTSIRITSSYKAMDHQT 298
           ADI TI+HFLQLRCGALA YWK+PDNSEQK  + RKMVRLGAKNTSIR++S+YKAMDHQT
Sbjct: 240 ADISTIVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRLGAKNTSIRLSSTYKAMDHQT 299

Query: 299 LLKIADLVLQKERLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKP 358
           LLKIADL LQ+++LLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQIS QEFPSH  IK 
Sbjct: 300 LLKIADLALQEKKLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISPQEFPSHVVIK- 358

Query: 359 KTRGCCPSSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFA 418
             RGC PSSKIL+SILVSF+ ND+DLHRGLSILDSFIKHYP+VK+D LFWRRLFQLSHFA
Sbjct: 359 -HRGCYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFA 417

Query: 419 WTPTHDKRATSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQNF 478
           WTP +DK+ATS+VRCWHLMKQW+ SK    SVDYETLRQLYD+ KKTGN+ LGIDVL++F
Sbjct: 418 WTPANDKKATSVVRCWHLMKQWYASKRLRPSVDYETLRQLYDIMKKTGNFPLGIDVLRSF 477

Query: 479 KPGITRTSAMKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKELNVFC 538
           KPGI RT A    K+N I+IK+QK IIK+LVNRG+ SA REFI+ + FD    K+LN+FC
Sbjct: 478 KPGIERTRAENAGKVNNIIIKYQKCIIKELVNRGRFSAVREFIDSYGFDRKMTKDLNIFC 537

Query: 539 TNRILLRSKKLKNKTENRKERNRSGQGNFXXXXXXGMVIGSLW 581
            NR+ LRSKK+KNK EN+KER +    +F      GM+IGSLW
Sbjct: 538 ANRMFLRSKKMKNKIENKKEREKVRLDSFDDDEDDGMIIGSLW 580

>Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..5995)
           [1701 nt, 567 aa]
          Length = 566

 Score =  198 bits (503), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 150/509 (29%), Positives = 260/509 (51%), Gaps = 36/509 (7%)

Query: 87  PHDMFK--VKDIPIDMFTLRRIIDSSSMNELDFSKSMTYLFVKAINSEARETLSLEDLSF 144
           P ++++  +K+  ID FTL  +  +S   + DF K+   LF           L+  +LS 
Sbjct: 80  PENIWRNYLKNNEIDKFTLHLL--ASLRGDDDFVKN---LFKSG-------DLTYNELSI 127

Query: 145 LLNNLY-SQRFEIKKICKDIN-VRYSEFWFKLFSLYAEKVDVKRNQINLRNTALDSSEIF 202
            +N +Y S   +IK++ ++ + + Y+E  +++F LY   +  +   I L    L      
Sbjct: 128 FINRIYKSNGHDIKRVIQNHHSLSYTELIYEIFELYTSTIPKESGIIKLNALHLK----- 182

Query: 203 DMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKNADIGTIIHFLQLRCGALAAYWK 262
           D+NL I  FI+  QL KAQ VL +I+D    I    K  D  T+++FL+LRCG L  +W 
Sbjct: 183 DLNLFITIFIKEAQLSKAQNVLQYIIDAEGSI---EKITDHDTMVNFLRLRCGGLPKFWL 239

Query: 263 MPDNSEQ--KYSRKMVRLGAKNTSIRITSSYKA-MDHQTLLKIADLVLQKE--RLLNSED 317
           +P  S    K ++K  RL + + + R  SSYK+ + +  L ++ +++L K+  +  +S  
Sbjct: 240 VPQASYAVTKQTKKNSRLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKVWKSKHSGI 299

Query: 318 LLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTRGCCPSSKILISILVSF 377
           L ST++ S  H  Q Q+++  I+  W IS    P    IK K     PS++ILI+I+ S+
Sbjct: 300 LDSTIVYSLAHTFQKQMMDGFIKEHWGISSHGDPLDLFIKKKKVASAPSNEILIAIMSSY 359

Query: 378 HLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFAWTPTHDKRATSIVRCWHLM 437
              D ++   + ILD FI+ YP++ +D +FWRRL Q  +  W P  D++ T    CW++M
Sbjct: 360 IYKDRNIDGAMKILDKFIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYGCWNMM 419

Query: 438 KQWHES---KGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQN-FKPGIT-RTSAMKTEK 492
           K W+ +   K   L  D++   + Y L K+T N  +  +++ N   P ++ +  A+K  +
Sbjct: 420 KNWNGAGTGKDVVLPYDFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAE 479

Query: 493 INGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKELNVFCTNRILLRSKKLKNK 552
           +N ++ K+Q   +  L+ R +   A  FI ++S D     +L      R  L  +KL  +
Sbjct: 480 LN-LLNKYQTLAMNWLIERRQFKKAAFFIEEWSIDRNNRIQLREAFKKRKQLMLRKLSTR 538

Query: 553 TENRKERNRSGQGNFXXXXXXGMVIGSLW 581
            + + +  +  Q  +       M+IG LW
Sbjct: 539 -DKKSQSQKKRQDRYDEMEEEDMIIGRLW 566

>SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  194 bits (492), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 123/420 (29%), Positives = 215/420 (51%), Gaps = 33/420 (7%)

Query: 167 YSEFWFKLFSLYAEKVDVKRNQINLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSF 226
           ++E  FKL+ +Y + V        + N  L   +++D+N  IK F    QL KAQ+VL F
Sbjct: 160 HTEVLFKLYEIYRDSV--------VGNATLTPVQLYDLNQFIKRFTGDAQLAKAQQVLGF 211

Query: 227 ILDRNSDILLSPKNADIGTIIHFLQLRCGALAAYWKMPDNSEQKYSRKMV--RLGAKNTS 284
           +L+    I   P+     T+I++L+L+CGA+   W +P       SR  +   LG+++  
Sbjct: 212 VLENYGSIPRDPQ-----TLINYLELKCGAMPRNWSIP------LSRPELGKTLGSQSFM 260

Query: 285 IRITSSYKAMDHQTLLKIADLVLQKERLLNSE---DLLSTLIQSFGHLGQTQILERCIEH 341
             +  SYK ++ + LL + D ++ K+R  + +   DL + +I S G++GQ  +LER I+H
Sbjct: 261 SNLAHSYKVLETEALLPLIDEMM-KDRAWHYKRNCDLEAAVIYSLGYMGQFALLERYIKH 319

Query: 342 IWQISLQEFPSHATIKPKTRGCCPSSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEV 401
            W +S+    S     PK     P+S +LISI+  + +  N LH+ L I+DSF+  +P++
Sbjct: 320 TWGVSVSSNTSTEVEVPK--NLYPTSNLLISIVSCYAMKGN-LHQALQIIDSFLSKFPQI 376

Query: 402 KVDELFWRRLFQLSHFAWTPTHDKRATSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDL 461
           +++ LFWRRLFQ S   W    D +      CW +MKQWH  +  SL +D   L + Y +
Sbjct: 377 ELEPLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQKRSLPIDLGILNERYYV 436

Query: 462 TKKTGNYSLGIDVLQNFKPGITRTSAMKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFI 521
            K+T N++  + +      G+     +   +++ ++ K QK I+K++  RG      ++I
Sbjct: 437 LKRTNNFTEALRIHDEALAGLYMKRNLIDPEVD-VIKKFQKLILKKMAGRGYYHKPLKYI 495

Query: 522 NDFSFDIGAVKELNVFCTNRILLRSKKLKNKTENRKERNRSGQGNFXXXXXXGMVIGSLW 581
           +++  +     E+  +         K    + E RK++  + Q  F       M++G LW
Sbjct: 496 SEWCLNKRNELEMREYFDR----HRKAYITRIEQRKQKQETAQVTFDAEEEDDMLLGRLW 551

>TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847
           YMR282C
          Length = 550

 Score =  189 bits (481), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 120/366 (32%), Positives = 198/366 (54%), Gaps = 27/366 (7%)

Query: 167 YSEFWFKLFSLYAEKVDVKRNQINLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSF 226
           ++E  F L+ +Y   V +K +Q       L   ++ D+N  IK FI+  QL KAQ+ L F
Sbjct: 157 HTEIIFNLYQIYCTYV-IKDSQ-----NGLTPLQVHDINRFIKRFIDEAQLKKAQECLQF 210

Query: 227 ILDRNS--DILLSPKNADIGTIIHFLQLRCGALAAYWKMPDNSEQKYSRKMVRLGAKNTS 284
           ++D+    +IL S    D+ TI  FLQLRCGAL  +W++  NS +        LG  +  
Sbjct: 211 LIDKQGLHNILQS---GDVETITQFLQLRCGALQKFWRVDSNSTKV-------LGEDSKH 260

Query: 285 IRITSSYKAMDHQTLLKIADLVLQKE--RLLNSEDLLSTLIQSFGHLGQTQILERCIEHI 342
            +   SY  +  Q  L+I + +L+ +  RL +S  + S ++ S  +LGQT+++++ I+  
Sbjct: 261 FKSPKSYNLLKEQPFLEIVNFLLKDKSWRLRSSPIIDSAIVYSLSNLGQTKLIDQYIQLK 320

Query: 343 WQISLQEFPSHATIKPKTRGCCPSSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEVK 402
           W IS      H  +K +     P  ++LI+I+ ++ L + D  +GL ILD F+K YP+ +
Sbjct: 321 WGISED---GHVAVKNE---AVPGHEVLINIVSAYCLKNGDTGKGLRILDQFMKKYPQTE 374

Query: 403 VDELFWRRLFQLSHFAWTPTHDKRATSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLT 462
           +++LFWRRL QLS   W    DK+A     CW++MKQWHE KG S++ D  TLR LY L 
Sbjct: 375 LEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHEQKGVSITYDSGTLRLLYQLF 434

Query: 463 KKTGNYSLGIDVLQN-FKPGITRTSAMKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFI 521
           K T N     +V++  F     +     ++    +++  QK  +K +  +G+ +   + I
Sbjct: 435 KFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQKLALKTMALKGRYNEPLQLI 494

Query: 522 NDFSFD 527
            +++ D
Sbjct: 495 KEWNVD 500

>ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282C AEP2 Mitochondrial protein likely
           involved in translation of the mitochondrial OLI1 mRNA
           exhibits genetic interaction with the OLI1 mRNA 5'-
           untranslated leader
          Length = 550

 Score =  189 bits (479), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 130/453 (28%), Positives = 232/453 (51%), Gaps = 37/453 (8%)

Query: 137 LSLEDLSFLLNNLYSQRFEIKKICKDI-NVRYSEFWFKLFSLYAEKVDVKRNQINLRNTA 195
           L+  + S  +N L S+     K+   I +  ++E  +KL+  Y + +  + N        
Sbjct: 127 LTKSEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYEFYCDHIVDQHN-------- 178

Query: 196 LDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRN--SDILLSPKNADIGTIIHFLQLR 253
           L   +++D+NL +K FI   QL KA  VL FIL R   +D+L    N D+  +I FL+L+
Sbjct: 179 LTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLL---ANTDVEILIQFLRLK 235

Query: 254 CGALAAYWKMPDNSEQKYSRKMVRLGAKNTSIRITSSYKAMDHQTLLKIADLVLQKERLL 313
           CGAL+ +WK+   S++  +   + LG K +   +  SYK  + + LL+I + VL +    
Sbjct: 236 CGALSKFWKIQPASQRNST--AITLGEKASDCHLAKSYKFQNEKVLLQIINSVLGEHNWK 293

Query: 314 N--SEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTRGCCPSSKILI 371
           N  S  L + +I S G+LGQT ++E+ +   W  S          K +     P+S +L+
Sbjct: 294 NRRSPKLDAAIIYSLGYLGQTDLIEKYVNRTWSPS----------KDEGVKTNPNSDLLV 343

Query: 372 SILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFAWTPTHDKRATSIV 431
           ++L S+ + + ++ +GL +LD FI+ YPEV++D LFWRRL QLS   W    D++AT   
Sbjct: 344 AVLTSYCVKEGNMRKGLEVLDRFIRDYPEVELDPLFWRRLLQLSSLLWDKKRDRKATLSH 403

Query: 432 RCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQN--FKPGITRTSAMK 489
            CW +MKQWH  +   +  DY  +++LY +  +T N +  ++V+    F   I     ++
Sbjct: 404 GCWTIMKQWHAQRQRKIPYDYGIMKELYPIFVRTKNKNGALEVITKSFFGAFIQPEFTIR 463

Query: 490 TEKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKELNVFCTNRILLRSKKL 549
             +++ ++ K+Q++I+K +  +G      EF  ++SF        N F      ++ + +
Sbjct: 464 PNELS-LLCKYQRFILKMIALKGNYHKGFEFCQEWSFS-----STNKFELQSYFMKWRGI 517

Query: 550 KNKTENRKERNRSG-QGNFXXXXXXGMVIGSLW 581
             +    + + ++  Q  +       M++G LW
Sbjct: 518 HEQRRTSQSKQKAALQEKYDEMEEDDMLLGRLW 550

>Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282C
           (AEP2) - basic, hydrophilic 67.5 kDa protein [contig 39]
           FULL
          Length = 546

 Score =  177 bits (449), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 139/458 (30%), Positives = 222/458 (48%), Gaps = 48/458 (10%)

Query: 137 LSLEDLSFLLNNLYSQRFEIKKICKDI-NVRYSEFWFKLFSLYAEKVDVKRNQINLRNTA 195
           L+  + S LLN L ++R    K+   + +V+ +E  F L+  Y          + +   +
Sbjct: 124 LTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYL---------MTIPAGS 174

Query: 196 LDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKNADIGTIIHFLQLRCG 255
           L+  ++ D+N  ++ FIE  QLGKAQ VL  IL  N+D L      D  T IH+LQLRCG
Sbjct: 175 LNPLQLHDLNSFVQYFIETAQLGKAQIVLDRILASNNDQL----PCDTTTGIHYLQLRCG 230

Query: 256 ALAAYWKMPDNSEQKYSRKMVRLGA-KNTSIRITSSYKAMDHQTLLKIADLVLQKERLLN 314
           AL   WK+ D S   +S    RLG+ +N S  ++ +YKA+D  ++L+  + VL  E   N
Sbjct: 231 ALPRNWKVFD-SRVGHS---CRLGSHRNKSQPVSHTYKALDQSSVLEFVN-VLNDE---N 282

Query: 315 SE-------DLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTRGCCPSS 367
           SE        L + +I S G +GQ  +L+  I   W I+       A++  +     PS 
Sbjct: 283 SEWFHKKSPTLEAAVIYSLGFMGQLTLLKEHIAVRWGIT----ELGASLATEVNEVPPSP 338

Query: 368 KILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFAWTPTHDKRA 427
           ++LI+I  SF  +  ++  GL ++D+FI  Y E+ +D +FWRRLFQ ++  W    D R 
Sbjct: 339 EVLIAIFTSF-ASHQEVTLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRG 397

Query: 428 TSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQNFKPGITRTSA 487
                CW +M +WHE     L  D   L + Y +  +T NY   + V+    P +     
Sbjct: 398 DLSRGCWRVMTEWHEKGSKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQLYEKPT 457

Query: 488 MKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKELNVFCTNRILLRSK 547
           + ++++  IV K+ K ++K +   G       FI ++S +      L V+         K
Sbjct: 458 LSSKEM-AIVQKYSKLVLKSMAELGYYHKPLTFITEWSPNKAVEDSLRVYF--------K 508

Query: 548 KLKNKTENRKER----NRSGQGNFXXXXXXGMVIGSLW 581
           K ++    RKER    +R  Q  +       M++G LW
Sbjct: 509 KHRDGFTKRKERLREESRRKQNTYDDEEEDNMLLGRLW 546

>KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  176 bits (445), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 134/455 (29%), Positives = 217/455 (47%), Gaps = 42/455 (9%)

Query: 137 LSLEDLSFLLNNLYSQRFEIKKICKDI-NVRYSEFWFKLFSLYAEKVDVKRNQINLRNTA 195
           LS+ + S  +  L S    + K+   + NV  +E  F L+ LY + V             
Sbjct: 129 LSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKTVTP---------GP 179

Query: 196 LDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKNADIGTIIHFLQLRCG 255
           L   ++ D N  I+ FI   QL KAQ VL  IL  N++ L      D  T  H+LQLRCG
Sbjct: 180 LSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILKSNNNQL----PCDSATATHYLQLRCG 235

Query: 256 ALAAYWKMPDNSEQKYSRKMVRLGAKNTSIRITS-SYKAMDHQTLLKIADLVLQKERLL- 313
           AL   WK+ D +  + +R    LGA+    ++ S SYKA+DH+++L    L+   + +  
Sbjct: 236 ALPRNWKVLDENLGRSTR----LGARKNRYQLVSHSYKALDHKSVLTFMSLLSDPKSVWF 291

Query: 314 --NSEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTRGCCPSSKILI 371
              S  L S ++ S G +GQ ++LE  +   W ISLQE   H  +   +    PSS++L+
Sbjct: 292 HRKSAALESAVVYSLGFMGQLKLLEEHVWRNWGISLQE---HNQVTDAS-FTSPSSEVLV 347

Query: 372 SILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFAWTPTHDKRATSIV 431
           ++L S+  N N +   L ++D F+  YP +++D +FWRRLFQ S   W+   D R     
Sbjct: 348 AVLTSYASNKN-ISSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSR 406

Query: 432 RCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVL-QNFKPGITRTSAMKT 490
            CW +M++WH ++   L  D   L + + +  +T NY   I+V+ Q +     + +  + 
Sbjct: 407 GCWRVMREWHAARNRQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKANLSRH 466

Query: 491 EKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKELNVFCTNRILLRSKKLK 550
           E +  +  K  K I+K + + G      +FI ++S         N    + +    +K +
Sbjct: 467 EAV--LFQKFAKLILKNMAHLGYYHKPLKFIKEWS--------PNKLLEHTLRAYFEKHR 516

Query: 551 NKTENRKERN----RSGQGNFXXXXXXGMVIGSLW 581
           N    RK+R     +  Q  F       M++G LW
Sbjct: 517 NAYSARKQRRTEAAQKAQKRFDDEEEDSMLLGRLW 551

>TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}
           Anc_8.847 YMR282C
          Length = 569

 Score =  169 bits (428), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 127/455 (27%), Positives = 230/455 (50%), Gaps = 34/455 (7%)

Query: 122 TYLFVKAINSEARETLSLEDLSFLLNNLYSQRFEIKK--ICKDI-NVRYSEFWFKLFSLY 178
           +Y+F++ +  E+++ L+  + S  LN L  ++  I    + K+  N ++SE  FKLF LY
Sbjct: 110 SYMFLREL-LESKQ-LTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKHSEMVFKLFQLY 167

Query: 179 AEKVDV-KRNQINLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLS 237
              +   K + ++LR          DMNL I+ FI  G LG+A+ VL+F+L++   IL  
Sbjct: 168 GNAIGSDKLSLLSLR----------DMNLFIEFFINEGHLGRAEIVLTFVLNKTRSIL-- 215

Query: 238 PKNADIGTIIHFLQLRCGALAAYWKMPDNSEQ---------KYSRKMVRLGAKNTSIRIT 288
               D+ T+ H+LQLRCGAL  YW   + S +         + S+   RLG KN ++++T
Sbjct: 216 -DLYDVDTVTHYLQLRCGALPRYWMFQNKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLT 274

Query: 289 SSYKAMDHQTLLKIADLVLQKERLL--NSEDLLSTLIQSFGHLGQTQILERCIEHIWQ-- 344
           + YK +D   +LKIA+ ++  ++    +S  L +T++ S  + GQ   +   I   W   
Sbjct: 275 NRYKILDPLGVLKIANKIITDDKWKSNHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVD 334

Query: 345 ISLQEFPSHATIKPKTRGCCP-SSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKV 403
           IS+ +  S    +       P  S+++ +IL S+  +D  + R ++I+D  +  YP +++
Sbjct: 335 ISMSDGNSDVGTQISNEASKPLPSEVMEAILSSYSYDDKSIERAINIIDKIMNSYPNLEL 394

Query: 404 DELFWRRLFQLSHFAWTPTHDKRATSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLTK 463
           ++ FWRRL Q S   W    D++ + +  C+  +K++HE +   ++ D   L++LY L  
Sbjct: 395 NQQFWRRLMQWSVLCWDHKLDRKGSLVYGCFKTLKKYHEMRSIRINFDEGLLQELYTLVY 454

Query: 464 KTGNYSLGIDVLQNFKPG-ITRTSAMKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFIN 522
            T N  +  +V+  F P    + S   T     ++   QK  I  ++ +     A  FI 
Sbjct: 455 YTKNSRIAAEVVSEFMPQFFYKRSDEITFGERKLLFYFQKRSIDGMLGKKDYFTASNFIE 514

Query: 523 DFSFDIGAVKELNVFCTNRILLRSKKLKNKTENRK 557
            +S D    +EL  +  + I  + +K++  +  +K
Sbjct: 515 KWSMDNQNKEELFKYYKDSIAKKLQKVRRNSLQQK 549

>KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 518

 Score =  126 bits (316), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 118/412 (28%), Positives = 200/412 (48%), Gaps = 47/412 (11%)

Query: 133 ARETLSLEDLSFLLNNL---YSQRFEIKKICKDINVRYSEFWFKLFSLYAEKVDVKRNQI 189
           + E L+ ED S  +N L   YS+  E+        +  +E W  L+ +Y   V    N +
Sbjct: 93  SNEKLTPEDYSVFVNQLMDVYSKDIEL--------LNKTEVWKSLYHIYRVFV---VNAV 141

Query: 190 NLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFIL--DRNSDILLSPKNADIGTII 247
           +  N  +    ++D+N  ++ FI L  L  A+ V   IL   +N +I   PK  D+ TI 
Sbjct: 142 DDGNAMV----LYDLNQFVRMFINLNDLPLARNVFQLILKNSKNGEI---PK--DVQTIC 192

Query: 248 HFLQLRCGALAAYWKMPDNSEQKYSRKMVRL-GAKNTSIRITS--SYKAMD-HQTLLKIA 303
            +L+L CGAL+  W     S   Y   +  L G+  +SIRI S  +Y  +   Q  L + 
Sbjct: 193 MYLRLYCGALSELWTT-QTSRNFYQDLIGSLSGSNASSIRIPSHIAYPTIGVPQFQLLLR 251

Query: 304 DLVLQKE--RLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTR 361
            LV   E  +L N+E + S +IQ+ GH  +   L++ I   + I   E  +     P  +
Sbjct: 252 KLVEDPEYSKLRNTE-MDSLIIQALGHYKEVPFLKQYISIFYGID--ENVTITETHPGIK 308

Query: 362 GCCPSSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFAWTP 421
              P S++L S++ ++  N+N +  G++++ SF++ YPE+ +D+ FWR     S   W  
Sbjct: 309 KLTPDSQLLKSVISAYGHNNN-ITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNK 367

Query: 422 THDKRATSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGI-DVLQNFKP 480
             D + +   + W+LM  W+ + G ++  D + +       K   +++  I DV Q FK 
Sbjct: 368 YKDSKGSQPKKAWNLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFK- 426

Query: 481 GITRTSAMKTEKINGIVIK-----HQKYIIKQLVNRGKTSAAREFINDFSFD 527
                  +KTEK   IV +     +Q++IIK LVN+ + +   +FIN++  D
Sbjct: 427 ----RIFIKTEKNTFIVERLVLYAYQRFIIKNLVNQNENAKCVDFINEWRID 474

>CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282c AEP2 required for the expression of
           subunit-9 of atp synthase
          Length = 548

 Score =  122 bits (306), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 107/400 (26%), Positives = 183/400 (45%), Gaps = 41/400 (10%)

Query: 203 DMNLIIKNFIELGQLGKAQKVLSFILD----RNSDILLSPKNADIGTIIHFLQLRCGALA 258
           DMN  IK FIE  QL +AQ  L F+LD    R  D LL P   D  TI HFL LR GAL 
Sbjct: 169 DMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGED-LLGPY-GDKQTIAHFLMLRSGALQ 226

Query: 259 AYWKMPDNSEQKYSRKMVRLGAKNTSIRITSSYKAMDHQTLLKIADLVLQ-------KER 311
             WK+  ++     +   ++   + +++  S+Y  +D   L +I   +L+        + 
Sbjct: 227 DLWKIDVSNGNNKKQAFYKINGSHRNVK--STYNVLDSVKLFEIVRYILRYNDKDNHSQP 284

Query: 312 LLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTRGCCPSSKILI 371
           +   E +L  +I   G++GQT ++E  I  IW++     P    I         +S +L 
Sbjct: 285 VYFDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVPPKYNI-------TVTSDLLT 337

Query: 372 SILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHF---AWTPTHDKRAT 428
           +I+ ++      +  GL I D F    P + V + FW  L + +      W  T D    
Sbjct: 338 AIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNIILPNKWRSTIDLSK- 396

Query: 429 SIVRCWHLMKQWHES--KGFSLSVDYETLRQLYDLTK----KTGNYSLGIDVLQNFKPGI 482
              R W LMK W  S   G  ++ + E L  +Y +      K  +     D+ Q+    +
Sbjct: 397 ---RTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVTL 453

Query: 483 TRTSAMKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKEL-NVFCTNR 541
              +++  ++I  ++ K Q + IK++V  G  S   +FI ++S+D    ++L N+F    
Sbjct: 454 YSKNSLTVDEIK-LLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQQLTNLF---- 508

Query: 542 ILLRSKKLKNKTENRKERNRSGQGNFXXXXXXGMVIGSLW 581
           ++LR++ L+ +  N+++     Q  +       M++G LW
Sbjct: 509 VVLRNRYLQKRGYNQEKEMTKVQKKYDEEEQEDMLLGGLW 548

>KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {ON}
           Anc_8.847 YMR282C
          Length = 474

 Score =  120 bits (300), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 111/459 (24%), Positives = 197/459 (42%), Gaps = 62/459 (13%)

Query: 126 VKAINSEARETLSLEDLSFLLNNLYSQRFEIKKICKDINVRYSEFWFKLFSLYAEKVDVK 185
           ++ I +    T+ L   + L+N   S+++ I++I +    R  E  F+LF  Y + +   
Sbjct: 75  IQEIITSMHATIDLNRFARLINIALSEKYNIQRIKE----RRPEIIFQLFETYVKLIS-- 128

Query: 186 RNQINLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKNADIGT 245
                  +  L   ++ DMN  I  F+E  QL KAQ V+ +++ ++  +L   +  D+ T
Sbjct: 129 ------SHEELTILQVEDMNKFINYFVEFKQLKKAQLVMKYLILKSPRVL---EKYDVST 179

Query: 246 IIHFLQLRCGALAAYWKMPDNSEQKYSRKMVRLGAKNTSIRITSSYKAMD--HQTLLKIA 303
             ++L+L CGA    W                           ++YK  D  + TL K+ 
Sbjct: 180 TRNYLKLNCGACHELW--------------------------YTNYKIFDFNNTTLDKLV 213

Query: 304 DLVLQKERLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTRGC 363
              L  +  +   D+   +I S G+ G+ + LE  I   W ISL +       +  T   
Sbjct: 214 KYSLDNK--IGYWDV--EIIHSLGYSGRIRSLEDYILKKWGISLCD-----RAQVNTTNE 264

Query: 364 CPSSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFAWTPTH 423
            P S++L +I+  F   D  + R + IL+ F+  YP++ +   FW+         W    
Sbjct: 265 APESEVLEAIINGFFYRDKRMFRAIKILNEFVNVYPDLNLKITFWKTFMNNCIKEWDEKV 324

Query: 424 DKRATSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQN-FKPGI 482
           D++   IV  W  MK+W+      +  +   L+ +    KK  N  L  D+ QN F    
Sbjct: 325 DQKGVVIVEYWETMKRWYTVHNRRIPFNINFLKVMRTCFKKNNNLVLATDIFQNCFHNFY 384

Query: 483 TRTSAMKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKELNVFCTNRI 542
              + M   ++N ++ ++Q +I+ +L+ +   S A  FIND  F +   ++L  +   R 
Sbjct: 385 FCATRMNDSELN-VIKEYQNFILSRLIEKKGFSNALTFINDHCFSLENKRQLMNYYHGR- 442

Query: 543 LLRSKKLKNKTENRKERNRSGQGNFXXXXXXGMVIGSLW 581
             +  KLK  T     RN + +  +        +IG LW
Sbjct: 443 --KEHKLKKMT-----RNENLEKTYDDMVEEDFIIGKLW 474

>Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {ON}
           similar to Ashbya gossypii ABL119C
          Length = 527

 Score =  120 bits (300), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 94/372 (25%), Positives = 175/372 (47%), Gaps = 16/372 (4%)

Query: 192 RNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKNADIGTIIHFLQ 251
           + T     E+ D+N     F+   +L  A+KVL  IL +     L P+  D  T++ + Q
Sbjct: 147 KKTRFTPMELHDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQL-PR--DHQTLVTYFQ 203

Query: 252 LRCGALAAYWKMPDNSEQKYSRKMVRLGAKNTSIRITSSYKAMDHQTLLKIADLVLQKE- 310
           L  G+LA+ W  P      Y  K+VR G++     +   Y ++    +  +   +L+ + 
Sbjct: 204 LYLGSLASLWPTPKVQSACYD-KLVR-GSRRPKYVV---YNSLPEGIMYDVLQKLLENDD 258

Query: 311 -RLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPK-TRGCCPSSK 368
            + L S +L + ++ S  H  +  + E  +E  W I          +    + G  P S+
Sbjct: 259 WKHLRSSELDAKILYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISSGTYPGSE 318

Query: 369 ILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFAWTPTHDKRAT 428
           +LI+I+ SF    NDL + + ++D+F+  YP++ +   FW +LF  +   +    D   +
Sbjct: 319 VLIAIVTSFSYR-NDLEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGS 377

Query: 429 SIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQNFKPGITRTSAM 488
               CW  M  W++S+G S+          Y++ K+T NY   + +  ++   +   SA 
Sbjct: 378 LQKACWLRMLSWYKSRGESVPYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAVYAKSAA 437

Query: 489 KTEKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKEL-NVFCT--NRILLR 545
               +  +V K+QK++I++L  RGK  A  +FI  + F+    KEL + F    N+  +R
Sbjct: 438 AKHNLT-VVRKYQKFVIRELSARGKRDACTQFIEQWRFNEENEKELQDTFQRHWNKYTIR 496

Query: 546 SKKLKNKTENRK 557
            +K ++   N++
Sbjct: 497 QEKRRSSARNKQ 508

>NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847
           YMR282C
          Length = 495

 Score =  117 bits (293), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 101/389 (25%), Positives = 189/389 (48%), Gaps = 48/389 (12%)

Query: 135 ETLSLEDLSFLLNNLYSQRFEIKKICKDINVRYSEFWFKLFSLYAEKVDVKRNQINLRNT 194
           E  +LE+ S  L  + S +        D+NV      F+LF +YA        ++     
Sbjct: 98  EHFTLEEYSLFLGKVLSMK------DSDVNVNVV---FQLFEIYA--------RMYCGEG 140

Query: 195 ALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKNADIGTIIHFLQLRC 254
           +L++ +I+D+N +IK FI+  QL + Q VL FI+ +   I     + D+ ++ + L+L+ 
Sbjct: 141 SLNALQIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKN 200

Query: 255 GALAAYWKMPDNSEQKYSRKMVRLGAKNTSIRITSSYKAMDHQTLLKIADLVLQKERLLN 314
           G+L   WK    + +    +  RL           +YK +D  +LLKIADLVL     + 
Sbjct: 201 GSLVKDWKFEGKNLRYLQSRQGRL-----------NYKFLDGWSLLKIADLVLNDP--MK 247

Query: 315 SEDLLS-TLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTRGCCPSSKILISI 373
            +++L+ ++I S GHL Q ++L+  I+ +W   +QE       +P+     P +  +I+I
Sbjct: 248 CQNVLTNSIIYSLGHLRQVELLDHFIDQMW---MQE------TRPRNGLLYPDTNNIIAI 298

Query: 374 LVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFAWTPTHDKRATSIVRC 433
           + S+  N  ++ +   +LD  ++ Y  +K D+ FWRRLFQ      T  +  +   + +C
Sbjct: 299 ITSYCYNYGNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWC--ILTEPNANKGFILGQC 356

Query: 434 WHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQNFKPGITRTSAMKTEKI 493
           W LM++  +     +  D   L  L +   K  +  L + VL+     + + + +    +
Sbjct: 357 WSLMEKQEK-----VEFDGVLLELLREKIVKVRDVPLALRVLKMIVIELKKVNFINELDM 411

Query: 494 NGIVIKHQKYIIKQLVNRGKTSAAREFIN 522
             +++K+QK++  +L    KT  A E ++
Sbjct: 412 E-LLLKYQKFVFSKLGEINKTVKAMELLS 439

>NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON}
           Anc_8.847 YMR282C
          Length = 624

 Score =  115 bits (288), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 114/441 (25%), Positives = 202/441 (45%), Gaps = 38/441 (8%)

Query: 169 EFWFKLFSLYAEKVDVKRNQINLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFIL 228
           E  F LF++  ++     NQ+N          ++D+N  IK F+  GQL KAQ VL +I+
Sbjct: 194 EVIFSLFNICKDEYCNNTNQLN-------PLMVYDLNQFIKYFLREGQLKKAQLVLDYII 246

Query: 229 DRNSDILLSPKNADIGTIIHFLQLRCGALAAYWK-MPDNSEQKYSRKMVRLGAKNTSIRI 287
           DR   I    K+ D+ T+ + L+L+ GA+   WK + D+    + +  + L  K+ + + 
Sbjct: 247 DRFGGIEQLIKSKDLTTLDNHLKLKNGAIYKNWKPLTDSESNTFLQYRLSLEDKSHNFKG 306

Query: 288 TSSYKAMDHQTLLKIADLVL-QKERLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQIS 346
             +YK +D  +LLKI D+VL  K   LN   L  +++ S G L Q + +E  I+ IW + 
Sbjct: 307 FKNYKFLDGWSLLKIIDMVLTDKTHCLNI--LNESILYSLGTLRQIEFMEHFIKQIWDVH 364

Query: 347 LQEFPSHATIKPKTRGCCPSSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDEL 406
             +       +       P +  LI+IL S+      + R   +LD  I+ YPE     L
Sbjct: 365 PDDAVEERNHQLDKYNLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRL 424

Query: 407 ----FWRRLFQLS-HFAWTPTHDKRATSIVRCWHLMKQWHESKG--------FSLSVDYE 453
               FW ++ Q     A    ++   T+I  C  +M++W   KG        + +  DY 
Sbjct: 425 NDNKFWIKMLQWGIKIADKNGNNVNGTTIDNCLEIMEEWF-LKGKKKTALEHWKIDDDYG 483

Query: 454 T--LRQLYDLTKKTGNYSLGIDVLQNFKPGITRTSAMK--TEKINGIVIKHQKYIIKQLV 509
           +  +  L+++ K+  N  +G+  ++NF   +   S  K     +  ++   QK I +++ 
Sbjct: 484 SILINLLHNIMKERKNVDIGLKAIENFVQKLKLGSVNKYYERNLTHVLYGLQKCIFRKIA 543

Query: 510 NRGKTSAAREFINDFSFDIGAVKE---LNVFCTNRILLRSKK-LKNKTE-NRKERNRSG- 563
             G  +     I++ ++   +  E      + T    +RSK+  +NK + N ++R +   
Sbjct: 544 ESGSYNKGLALIDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQDEF 603

Query: 564 ---QGNFXXXXXXGMVIGSLW 581
              Q  +      GM+IG LW
Sbjct: 604 EKLQQKYDEIEEEGMIIGKLW 624

>KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.847
           YMR282C
          Length = 474

 Score =  111 bits (277), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 91/373 (24%), Positives = 170/373 (45%), Gaps = 49/373 (13%)

Query: 186 RNQINLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKNADIGT 245
           +  I L++  L   ++ D NL+   FI   QL KAQ ++ F+L ++          D+  
Sbjct: 123 KGAIALQSNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQDVKF-------DVFM 175

Query: 246 IIHFLQLRCGALAAYWKMPDNSEQKYSRKMVRLGAKNTSIRITSSYKAMDHQTLLKIADL 305
           I ++ +LRCG+  ++ K   N++                     +YK  D  T+ ++   
Sbjct: 176 IKNYTKLRCGS--SFGKQTLNNK---------------------AYKVFDQNTVFQLIGK 212

Query: 306 VL--QKERLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTR-- 361
           V   +K    N+E     ++ S G+     ++E  I  +W+IS+ +   H+T   K    
Sbjct: 213 VEADRKFAFWNNE-----IVSSLGYTNNITLMEIYIWDLWRISIHD---HSTENIKIDHL 264

Query: 362 ----GCCPSSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHF 417
                  PSSK+L +I+ S+  +D  + R + I++ F K YP++ ++  FW  L      
Sbjct: 265 QQGDAMYPSSKVLATIVSSYARHDQTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNC--- 321

Query: 418 AWTPTHDKRATSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQN 477
           A      K  +  + CW+LMK+WH  +   +      L  +    ++T N    +D+LQ 
Sbjct: 322 AIKCGGSKDPSQFLACWNLMKKWHTQRSKLMPFQSALLVTILRYMRQTSNLHGTVDILQY 381

Query: 478 FKPGITRTSAMKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKELNVF 537
           +   +        E    ++IK+QK I+++LV++ K +    FI+ +S D    ++L  F
Sbjct: 382 WLGPLYLKRGNIPEFERDVLIKYQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDLEAF 441

Query: 538 CTNRILLRSKKLK 550
             +R+ +R  K +
Sbjct: 442 YESRVDVRESKTR 454

>TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {ON}
           Anc_8.847 YMR282C
          Length = 613

 Score =  109 bits (272), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 123/494 (24%), Positives = 228/494 (46%), Gaps = 56/494 (11%)

Query: 108 DSSSMNELDFSKSMT---YLFVKAINSEARETLSLEDLSFLLNNLYS-QRFEIKKICKDI 163
           D +S+N   F   +    YL  KA+N    + L+  +LS ++N L     F+ K   +  
Sbjct: 119 DGTSINYKKFVDELIQWHYLDAKALNKLVNKHLNDMNLSIVINLLVKYNHFQPKDSDRLS 178

Query: 164 NVRYSEFWFKLFSLYAEKVD----VKRNQINLRNTALDSS------EIFDMNLIIKNFIE 213
              +SE  FK++ +Y E+++       N  ++++ A  SS      +++D+N +I  FI+
Sbjct: 179 FKSHSELIFKVYQIYIERIEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIK 238

Query: 214 LGQLGKAQKVLSFILDR-NSDILLSPKNADIGTIIHFLQLRCGALAAYWKM-PDNSE--Q 269
            GQL KA   L +IL R N++I   P   D  TII+FL+L CG L   W++ P N    +
Sbjct: 239 AGQLKKATTALMYILKRYNAEIFQIP---DSKTIINFLKLYCGGLPTNWRIEPINHRFIK 295

Query: 270 KYSRKMVRLGAKNTSIRITSSYKAMDHQTLLKIADLVLQKE----------RLLNSEDLL 319
              ++  +LG  ++  R+ SSYKA+  +  ++I + + +              + + +  
Sbjct: 296 NQGKRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFD 355

Query: 320 STLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTRGCCPSSKILISILVSF-H 378
           STLI S   LG+  + E+  +  W            +         +S I+I+I  S+ +
Sbjct: 356 STLIYSLTSLGRFDLAEQYFKDNW------------LSDSCDDVELTSDIVIAIFSSYVY 403

Query: 379 LNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFAWTPTHDKRATSIVRCWHLMK 438
            N N++ +   ++   IK YP++ ++   W R+ + +   W  T D         ++ M 
Sbjct: 404 NNSNNIEKANKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTML 463

Query: 439 QWHES--------KGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQN-FKPGITRTSAMK 489
            ++ +        K   +  +   L  LY L     + +  + ++ N FK  + +T +  
Sbjct: 464 TYYSNYCSRNSTFKSCHIPYNKMLLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKV 523

Query: 490 TEKINGIVIKHQKYIIKQLVNRGKTSAAR--EFINDFSFDIGAVKELNVFCTNRILLR-S 546
           T K   I++K+QK I+K L+N  K ++ +  +FI  +S D    ++L  +   R+  R S
Sbjct: 524 TTKDYQILLKYQKMILKYLINDRKLTSNKPLDFIEKYSLDTNNKEQLLEYRLERLEYRKS 583

Query: 547 KKLKNKTENRKERN 560
           +K      N  E+N
Sbjct: 584 RKEYYGNLNANEKN 597

>ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR282C
           (AEP2)
          Length = 537

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 66/340 (19%), Positives = 141/340 (41%), Gaps = 26/340 (7%)

Query: 201 IFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKNADIGTIIHFLQLRCGALAAY 260
           + D N   + F+   +L  A+ V + ++   +++   P+  D  TII  LQL  GA   +
Sbjct: 187 LHDANSFARWFMAESKLRLARTVFAELVGNPTELAKLPR--DTETIITLLQLHLGAKHIF 244

Query: 261 WKMPDNSEQKYSRKMVRLGAKNTSIRITSSYKAMDHQTLLKIADLVLQKE--RLLNSEDL 318
           W+ P NS  +  +           + + ++Y ++  +TLL++  L+      + + S DL
Sbjct: 245 WRDPGNSVGRGGQLFT-----PAHMAVVTAYNSLGEETLLRLLRLLQSDPQWKSVCSPDL 299

Query: 319 LSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTRGCCPSSKILISILVSFH 378
              +I +     +  ++     H          +     P T    P   ++ +++ +F 
Sbjct: 300 DRNIILALAFHNRLDLV-----HAQAARYYAPAAPGHGLPST-PLLPDGALVGAVVTAFA 353

Query: 379 LNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFAWT----PTHDKRATSIVRCW 434
              + L +GL+I   F+  +  +  +   W+ +     F W     PT  + A      W
Sbjct: 354 FK-HQLAQGLAIAYQFLDRFTHLPNEHELWKII-----FTWLARRHPTGSQGAALYDEAW 407

Query: 435 HLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQNFKPGITRTSAMKTEKIN 494
             M+  +   G     DY   R  Y + ++  +      +L ++   + +  A+   +  
Sbjct: 408 SKMRTRYAEHGQPTPYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQPAV-APRDR 466

Query: 495 GIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKEL 534
            +++K Q +I+ +LV   + SAA +F++ ++ D  A   L
Sbjct: 467 LLLLKCQAHIVGRLVRARRNSAAADFVDQWALDSEARSHL 506

>Smik_2.102 Chr2 (187680..189260) [1581 bp, 526 aa] {ON} YBL015W
           (REAL)
          Length = 526

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 65/159 (40%), Gaps = 27/159 (16%)

Query: 6   LAKYPSPSILGLYTRRLCN---------ESFRSLQEVDILPNIMIGNTVHSRRTCVTSRT 56
           L+ +P     G YTR   +         E+    ++  I+P   +G +       V+ + 
Sbjct: 118 LSMFPQDLTYGFYTRERTDNKILDYTIIEATAIKEDGSIVPGPSVGGS--PEFITVSDKV 175

Query: 57  LLTCDIAAQKFYSTHKLNAIDQPTNGNAQRPHDMFKVKD------IPIDMFTLRRIIDSS 110
           ++  + A   F   H    ID P N   ++P+   KV D      IP+D   +  I++S+
Sbjct: 176 IIEVNTATPSFEGIHD---IDMPVNPPFRKPYPYLKVDDKCGVDSIPVDPEKVVAIVEST 232

Query: 111 SMNEL-------DFSKSMTYLFVKAINSEARETLSLEDL 142
             +++       D S+++    V+   +E R     E+L
Sbjct: 233 MRDQVPPNTPSDDMSRAIAGHLVEFFRNEVRHGRLPENL 271

>TBLA0E03560 Chr5 (890420..891994) [1575 bp, 524 aa] {ON} Anc_8.161
           YBL015W
          Length = 524

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 36/192 (18%), Positives = 80/192 (41%), Gaps = 27/192 (14%)

Query: 6   LAKYPSPSILGLYTRRLCN---------ESFRSLQEVDILPNIMIGNTVHSRRTCVTSRT 56
           L+ +P     G YT++  +         E+    ++  I+P   +G +       V+ + 
Sbjct: 116 LSMFPQDLTYGFYTKQRTDGKILDFTIIEATAIKEDGSIVPGPSVGAS--PEFISVSDKV 173

Query: 57  LLTCDIAAQKFYSTHKLNAIDQPTNGNAQRPHDMFKVKD------IPIDMFTLRRIIDSS 110
           ++  + A       H    ID P N   ++P+   KV D      IP+D   +  I++S+
Sbjct: 174 IIEVNTATPSMEGMHD---IDMPVNPPFRKPYPYLKVDDRCGVDSIPVDPEKVLAIVEST 230

Query: 111 SMNEL-------DFSKSMTYLFVKAINSEARETLSLEDLSFLLNNLYSQRFEIKKICKDI 163
           +M+++         SK++    V  + +E ++    E+L  L + + +    + +   D 
Sbjct: 231 TMDKVPPNTPSDSVSKAIAGNLVDFLKNEVKQGRLPENLLPLQSGIGNIANAVIEGLTDA 290

Query: 164 NVRYSEFWFKLF 175
           N ++   W ++ 
Sbjct: 291 NFKHLNVWTEVL 302

>KAFR0F04260 Chr6 complement(833718..834101) [384 bp, 127 aa] {ON}
           Anc_6.358 YCR082W
          Length = 127

 Score = 32.7 bits (73), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 5/46 (10%)

Query: 435 HLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQNFKP 480
           HL ++  E + F     Y+ L+ LY   +KT NY   IDVL N KP
Sbjct: 34  HLQRKLTEQRYF-----YKQLQVLYSQVEKTKNYQEFIDVLTNLKP 74

>YML025C Chr13 complement(224406..225239,225339..225365) [861 bp,
           286 aa] {ON}  YML6Mitochondrial ribosomal protein of the
           large subunit, has similarity to E. coli L4 ribosomal
           protein and human mitoribosomal MRP-L4 protein;
           essential for viability, unlike most other mitoribosomal
           proteins
          Length = 286

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 42/72 (58%), Gaps = 10/72 (13%)

Query: 173 KLFSLYAEKVDV-------KRNQINLRNT-ALDSSEIFDMNLIIKNFIELGQLGKAQKVL 224
           KLF +  EKVD+         N+++L NT  ++  EIF+  +I + F+E  QL K +++L
Sbjct: 164 KLFVIGGEKVDLISPTPELDLNRLDLVNTNTVEGKEIFEGEVIFRKFLEEFQL-KGKRLL 222

Query: 225 SFILDRNSDILL 236
            FI D+  + L+
Sbjct: 223 -FITDKTREGLI 233

>ZYRO0G07832g Chr7 (628580..634129) [5550 bp, 1849 aa] {ON} similar to
            uniprot|P38737 Saccharomyces cerevisiae YHL030W ECM29
            Major component of the proteasome tethers the proteasome
            core particle to the regulatory particle and enhances the
            stability of the proteasome
          Length = 1849

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 321  TLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTRGCC 364
            T   SFGH+     LE+C+++  Q+S + F S+ +I  K  G  
Sbjct: 1436 TFALSFGHVYHVASLEKCVKYAEQLSERYFTSNESISRKVVGSA 1479

>KLLA0F27599g Chr6 (2558178..2559746) [1569 bp, 522 aa] {ON} highly
           similar to uniprot|P10869 Saccharomyces cerevisiae
           YER052C HOM3 Aspartate kinase (L-aspartate 4-P-
           transferase) cytoplasmic enzyme that catalyzes the first
           step in the common pathway for methionine and threonine
           biosynthesis expression regulated by Gcn4p and the
           general control of amino acid synthesis
          Length = 522

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 87/193 (45%), Gaps = 41/193 (21%)

Query: 15  LGLYTRRLCNESFRSL-QEVDILPNIMI---GNTVHSRRTCVTSRTLLTCDIAAQKFYS- 69
           +G +++++ NE  +   QE D   N+ +     + +++    TSR LL CD+A+   Y  
Sbjct: 17  IGKFSKQIVNEIIKVYSQEYD--NNVAVVCSARSSYTKAEGTTSRLLLACDLASNNNYEY 74

Query: 70  THKLNAIDQPTNGNAQRPHDMFKVKDIPI----------DMFTLRRIIDSS------SMN 113
            + L+ +++    NA+       VKDI I          ++  +RR +D+S      S  
Sbjct: 75  KNVLDLVERDHVANAEE-----SVKDITIQETLIEDTKREINIVRRYLDASQVLGEVSTR 129

Query: 114 ELDFSKS----MTYLFVKAINSEARETLSLEDLSFLLNNLYSQRFEIKKICKDINVRYSE 169
            LD   S    ++ L+V A+  +        DLSF++ + Y         CK+  +  S 
Sbjct: 130 TLDLVMSLGEKLSCLYVTALCQDNGVNARYVDLSFIVPSDYE--------CKEGTLDNSF 181

Query: 170 FWFKLFSLYAEKV 182
           + F L + + EK+
Sbjct: 182 YTF-LVTAFREKL 193

>KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 857

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 56/129 (43%), Gaps = 21/129 (16%)

Query: 278 LGAKNTSIRITSSYKAMDHQTLLKIADLVLQKERLLNSEDLLSTLIQSFGHLGQTQILER 337
           +G  N S +I ++    + QT + +       +R + S+ L    +   GH G + +   
Sbjct: 378 MGFMNNSPKIFTALHITETQTAMNM------NQRSILSQSLAEVSLN--GHDGDSGLSSA 429

Query: 338 CIEHI---------WQISLQEFPSHATIKPKTRGCCPSSK-ILISILVSFHLNDNDLHRG 387
           CIE I         W+   Q+  S   ++ K+ G C + K  LI     FH  D+D +R 
Sbjct: 430 CIEEIFRNEDSKRRWKSYTQQRDS---VEGKSVGFCDNEKEFLIDEYAFFHNEDSDAYRD 486

Query: 388 LSILDSFIK 396
           LS L +  K
Sbjct: 487 LSNLGTHEK 495

>Skud_14.133 Chr14 complement(249544..252120) [2577 bp, 858 aa] {ON}
           YNL201C (REAL)
          Length = 858

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 45/92 (48%), Gaps = 4/92 (4%)

Query: 322 LIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTRGCCPSSKILISILVSFHLND 381
           L+Q++G++ +       I+ + +I  +  P H++ +    G   S  I    L S HL D
Sbjct: 759 LVQTYGNVLRKATYIPFIQDMLEIGEENQPEHSSFENSLEGDTDSVNISSDGLTSNHLED 818

Query: 382 NDLHRGLSILDSFIKHY---PEVKVDELFWRR 410
            D+ + +  L S I+H+   P    D+L +++
Sbjct: 819 IDV-KNVKRLHSEIEHFGDDPHYSSDKLAFKK 849

>KLTH0B10318g Chr2 (869187..873833) [4647 bp, 1548 aa] {ON} no
            similarity
          Length = 1548

 Score = 31.6 bits (70), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (62%)

Query: 213  ELGQLGKAQKVLSFILDRNSDILLSPKNADIGTIIHFLQL 252
            EL +  KA K+ SF+LD+N  +L+ PK A  G  +  L++
Sbjct: 1051 ELDKTEKAMKMQSFLLDKNVQVLMGPKLAVEGIDVAELRM 1090

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,345,834
Number of extensions: 2573792
Number of successful extensions: 8149
Number of sequences better than 10.0: 53
Number of HSP's gapped: 8347
Number of HSP's successfully gapped: 54
Length of query: 581
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 466
Effective length of database: 40,294,809
Effective search space: 18777380994
Effective search space used: 18777380994
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 69 (31.2 bits)