Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_13.4708.846ON30330316220.0
Smik_13.4948.846ON30430312481e-174
Skud_13.4538.846ON30030312441e-173
YMR281W (GPI12)8.846ON30430312431e-173
TDEL0B005208.846ON2682875969e-76
KNAG0J002408.846ON2862975952e-75
ZYRO0G14300g8.846ON2802875926e-75
Kpol_1068.48.846ON2912995606e-70
NDAI0K003308.846ON3133125591e-69
KAFR0B039608.846ON2782985527e-69
CAGL0M03047g8.846ON3043005442e-67
SAKL0D01320g8.846ON2602885332e-66
NCAS0C003808.846ON2762975334e-66
TPHA0I002808.846ON3013065232e-64
ABL120W8.846ON2492854681e-56
Kwal_27.102278.846ON2542864662e-56
KLTH0C03740g8.846ON2542904569e-55
Ecym_46178.846ON2492864496e-54
KLLA0D01430g8.846ON2632474491e-53
TBLA0B033008.846ON3193184487e-53
KLLA0C14190gna 1ON59578684.7
KNAG0G013708.155ON267189685.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_13.470
         (303 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W...   629   0.0  
Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W...   485   e-174
Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W...   483   e-173
YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER me...   483   e-173
TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON} ...   234   9e-76
KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}...   233   2e-75
ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} simil...   232   6e-75
Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON} c...   220   6e-70
NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846...   219   1e-69
KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.84...   217   7e-69
CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly...   214   2e-67
SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON...   209   2e-66
NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON} ...   209   4e-66
TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846 ...   206   2e-64
ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic hom...   184   1e-56
Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {O...   184   2e-56
KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {O...   180   9e-55
Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar ...   177   6e-54
KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {O...   177   1e-53
TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.84...   177   7e-53
KLLA0C14190g Chr3 complement(1227049..1228836) [1788 bp, 595 aa]...    31   4.7  
KNAG0G01370 Chr7 complement(303099..311114) [8016 bp, 2671 aa] {...    31   5.8  

>Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W
           (REAL)
          Length = 303

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/303 (100%), Positives = 303/303 (100%)

Query: 1   MSKRVKVCFSKLLFKITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIA 60
           MSKRVKVCFSKLLFKITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIA
Sbjct: 1   MSKRVKVCFSKLLFKITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIA 60

Query: 61  HPDDEVMFFSPVISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERP 120
           HPDDEVMFFSPVISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERP
Sbjct: 61  HPDDEVMFFSPVISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERP 120

Query: 121 VSVQVMDFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIA 180
           VSVQVMDFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIA
Sbjct: 121 VSVQVMDFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIA 180

Query: 181 VEKFIDDYVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSI 240
           VEKFIDDYVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSI
Sbjct: 181 VEKFIDDYVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSI 240

Query: 241 QPLAAPSTTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDI 300
           QPLAAPSTTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDI
Sbjct: 241 QPLAAPSTTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDI 300

Query: 301 FTY 303
           FTY
Sbjct: 301 FTY 303

>Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W
           (REAL)
          Length = 304

 Score =  485 bits (1248), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 228/303 (75%), Positives = 264/303 (87%), Gaps = 1/303 (0%)

Query: 1   MSKRVKVCFSKLLFKITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIA 60
           M +RV+V FSKLL+KITKL+IVLT+LYIYFTPKI+SRN +SLQHVFP++  + QINL+IA
Sbjct: 3   MPRRVRVNFSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSDYQINLIIA 62

Query: 61  HPDDEVMFFSPVISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERP 120
           HPDDEVMFFSP+ISQLH+YFP+TVPFNI+CLSKG+AEGLG+TR +ELNDSA LLL NER 
Sbjct: 63  HPDDEVMFFSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNERA 122

Query: 121 VSVQVMDFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIA 180
           VSVQVMDF+DGM+EVWDIDSITSTLSQTI +NN +++QIIVTFDSYGVS HINHKSCH A
Sbjct: 123 VSVQVMDFQDGMNEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCHTA 182

Query: 181 VEKFIDDYVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSI 240
           V K I DY  S  +++ +   ITALYLRSYKNNI LKYNSFIWEIL+MLY  +SPF ++ 
Sbjct: 183 VRKLIADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTT 242

Query: 241 QPLAAPSTTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDI 300
           Q L +     EKN LLLMNTH+QYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFD+
Sbjct: 243 QALPS-DVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDV 301

Query: 301 FTY 303
           + Y
Sbjct: 302 YIY 304

>Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W
           (REAL)
          Length = 300

 Score =  483 bits (1244), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 231/303 (76%), Positives = 273/303 (90%), Gaps = 3/303 (0%)

Query: 1   MSKRVKVCFSKLLFKITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIA 60
           MS+RVKV FSKL++KITKLAIVLT+LYI+FTPKI+SRN + LQHVFPH++R+SQINLVIA
Sbjct: 1   MSRRVKVNFSKLVYKITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIA 60

Query: 61  HPDDEVMFFSPVISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERP 120
           HPDDEVMFFSPVISQLH+YFP TVPFNI+CLSKG+A+GLGE+R KELN SA LLL+NERP
Sbjct: 61  HPDDEVMFFSPVISQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERP 120

Query: 121 VSVQVMDFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIA 180
           VSVQVMDFEDGMDEVWDI+SI ST+SQTID++NE+++QIIVTFDSYGVS+HINHKSCH A
Sbjct: 121 VSVQVMDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTA 180

Query: 181 VEKFIDDYVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSI 240
           V++ ID Y  SK +   E  HITALYL+SYKNNI LKYNSFIWEILK+LY  + PF ++ 
Sbjct: 181 VKRLIDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVPFPKT- 239

Query: 241 QPLAAPSTTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDI 300
             +  P+TTT+++ LLLMNTH+QY+LA+AAMLNAHKSQVVWFRYGWWILSRFVFVNEFD+
Sbjct: 240 --IQPPTTTTQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDV 297

Query: 301 FTY 303
           +TY
Sbjct: 298 YTY 300

>YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER
           membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly, the
           de-N-acetylation of the
           N-acetylglucosaminylphosphatidylinositol intermediate;
           functional homolog of human PIG-Lp
          Length = 304

 Score =  483 bits (1243), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 227/303 (74%), Positives = 262/303 (86%), Gaps = 1/303 (0%)

Query: 1   MSKRVKVCFSKLLFKITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIA 60
           M +R KV FSKLL+KITKLAIVLT+LYIYFTPKI+SRN  SLQH+FPH+  + +INLVIA
Sbjct: 3   MLRRTKVNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLVIA 62

Query: 61  HPDDEVMFFSPVISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERP 120
           HPDDEVMFFSP+ISQL++YFP TVPFNI+CLSKG+AEGLGETR +ELN+SA LLL NER 
Sbjct: 63  HPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERA 122

Query: 121 VSVQVMDFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIA 180
           VSVQVMDF+DGMDE+WDIDSITS+LSQ ID+ N  ++QIIVTFDSYGVSNHINHKSC+ A
Sbjct: 123 VSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAA 182

Query: 181 VEKFIDDYVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSI 240
           V+K +DDY   KTK   +  H+TALYLRSYKNNI LKYNSFIWEILK+LY  +SPF R I
Sbjct: 183 VKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRII 242

Query: 241 QPLAAPSTTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDI 300
           Q L  P+T  EK+ L LMNTH+QY+LAFA MLNAH+SQVVWFRYGWWI SRFVFVNEFD+
Sbjct: 243 QAL-PPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDV 301

Query: 301 FTY 303
           +TY
Sbjct: 302 YTY 304

>TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON}
           Anc_8.846 YMR281W
          Length = 268

 Score =  234 bits (596), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 128/287 (44%), Positives = 169/287 (58%), Gaps = 30/287 (10%)

Query: 15  KITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIAHPDDEVMFFSPVIS 74
           K+ KL   L++LY+  T +I  RN    Q           + L+IAHPDDEVMFFSP + 
Sbjct: 9   KVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEVMFFSPSLL 68

Query: 75  QLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRN-ERPVSVQVMDFEDGMD 133
           QL    P +V FN +CLSKGDA+ LGETR  EL  S  LL  N +R   +   D+ DG D
Sbjct: 69  QLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQFDYPDGFD 128

Query: 134 EVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIAVEKFIDDYVGSKT 193
           E W+I+S+ S +   + + +     +++TFD++GVSNH NH +CH AV + I        
Sbjct: 129 EKWEIESVVSIVESKVFIGSG--FNLLLTFDAHGVSNHPNHVACHNAVARLI-------- 178

Query: 194 KEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSIQPLAAPSTTTEKN 253
               E  H  ALYL S+  N+ LKY+ FIWE+++ML  +V                 E+ 
Sbjct: 179 ----EKGH-KALYLNSHSRNLPLKYSGFIWELIRMLSDSV--------------MKLERT 219

Query: 254 GLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDI 300
           GL  MN+  QYILAFAAM NAH+SQ+VWFRYGWW LSRFVFVN+ +I
Sbjct: 220 GLTFMNSFPQYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEI 266

>KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}
           Anc_8.846 YMR281W
          Length = 286

 Score =  233 bits (595), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 131/297 (44%), Positives = 191/297 (64%), Gaps = 20/297 (6%)

Query: 9   FSKLLFKITKLAIVLTVLYIYF-TPKILSRNTDSLQHVFPHRDRNSQINLVIAHPDDEVM 67
           FS+ ++K+TKL+++L +LYIY  T KI S N  +L+ +  H D NS +NLVIAHPDDEVM
Sbjct: 6   FSRFIYKVTKLSLLLGILYIYASTSKIGSFNYTNLETLGEH-DINS-VNLVIAHPDDEVM 63

Query: 68  FFSPVISQLHAYF--PDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERPVSVQV 125
           FF+P +  L+     P TV FNI+C S G A+GLG  R +EL+DS  +LL   R  S+ V
Sbjct: 64  FFAPSLINLNEQIRDPSTV-FNIICFSNGGADGLGNVREQELSDSIAMLLPT-RNTSIVV 121

Query: 126 MDFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIAVEKFI 185
           +DF+DGM E WD+  + + L   +    +    +++TFD  GVS H+NH +C+ A   + 
Sbjct: 122 LDFKDGMKEKWDVKEMIAKLRNIVP---KLGHNVLLTFDGKGVSGHLNHIACYRAALGYY 178

Query: 186 DDYVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSIQPLAA 245
           +++   K+K+K     +T L L+SY  NI  KY+S+IWE++K+LY +  P  R    L  
Sbjct: 179 NEF---KSKQK-----LTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVP-SRLGNVLPK 229

Query: 246 PSTTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDIFT 302
             +   +  + + +T+ QY+L+ AAMLNAHK+QVVWFRYGWW  SR VFVN+ D+ +
Sbjct: 230 RGSNVARK-ITIFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDVIS 285

>ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} similar
           to uniprot|P23797 Saccharomyces cerevisiae YMR281W GPI12
           ER membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 280

 Score =  232 bits (592), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 174/287 (60%), Gaps = 16/287 (5%)

Query: 15  KITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIAHPDDEVMFFSPVIS 74
           K  K+  +L VL+I F+ +I SRN           D    ++LV+AHPDDEVMFF+P I 
Sbjct: 6   KFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFFAPTIL 65

Query: 75  QLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRN-ERPVSVQVMDFEDGMD 133
           +L +  P  V FN++CLSKG A+ LG+TR +EL +S  LLL N +R   +Q  D+ DG +
Sbjct: 66  ELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPDGHE 125

Query: 134 EVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIAVEKFIDDYVGSKT 193
           E WD +S+ ST+  +  V   + S +++TFD  GVS H+NH +CH AV   + D    K 
Sbjct: 126 ETWDQESVQSTIKDS--VLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNVK- 182

Query: 194 KEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSIQPLAAPSTTTEKN 253
                     ALYL SY +NI LKY++F WEI K+   T   F   + P ++ +      
Sbjct: 183 ---------AALYLDSYGDNIVLKYSAFFWEIWKL---TRDWFLHRVLPTSSYNENKPAT 230

Query: 254 GLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDI 300
            + LM+ +S YIL+FA+ML++HKSQ+VWFRYGWW  SRFVFVN+  +
Sbjct: 231 EITLMSDYSSYILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKV 277

>Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON}
           complement(6124..6999) [876 nt, 292 aa]
          Length = 291

 Score =  220 bits (560), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 119/299 (39%), Positives = 170/299 (56%), Gaps = 28/299 (9%)

Query: 12  LLFKITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIAHPDDEVMFFSP 71
            +FK  KL  +L   Y++F   I   N   ++    +   +S +NLVIAHPDDEVMFFSP
Sbjct: 6   FVFKAIKLYFLLWCGYVWFAGAIRGENARQVRGP-GYFSGSSSVNLVIAHPDDEVMFFSP 64

Query: 72  VISQLHAYFPDTVPFNILCLSKG---DAEGLGETRAKELNDSAVLLLRNERPVSVQVMDF 128
            + QL  + P+ V  N++C SKG   D    GE+RA+EL  S  +L+ ++RPV+V  +D+
Sbjct: 65  TLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVTVHQLDY 124

Query: 129 EDGMDEVWDIDSITSTLSQTIDVNNE-KVSQIIVTFDSYGVSNHINHKSCHIAVEKFIDD 187
           +DG D++WD+DS+   L   I+ + + K   +++TFD +GVS+H NH +CH AV + I+ 
Sbjct: 125 KDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAVHRLIE- 183

Query: 188 YVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSIQPLAAPS 247
                     E     A  L S+  N+ LKY+ F  EI+K  Y                 
Sbjct: 184 ----------EEPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYC-------HQRIKGQ 226

Query: 248 TTTEKN-----GLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDIF 301
           T+  KN       +L NTHS+YI+A+A MLNAH+SQVVWFRYGWW  SR  + NE  +F
Sbjct: 227 TSLNKNMDVPYEYVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANELKLF 285

>NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846
           YMR281W
          Length = 313

 Score =  219 bits (559), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 131/312 (41%), Positives = 188/312 (60%), Gaps = 34/312 (10%)

Query: 9   FSKLLFKITKLAIVLTVLYIYFTPKILSRNTDS---------LQHVFPHRDRN---SQIN 56
           FSK  +K  KL ++L + Y+  T KI S N  S         L+    H D +   +Q++
Sbjct: 5   FSKFTYKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLS 64

Query: 57  LVIAHPDDEVMFFSPVISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLL- 115
           LVIAHPDDE+MFF+P + QL+ + P ++PFNI+C S GDAEGLG  R KEL+DS  LLL 
Sbjct: 65  LVIAHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDSINLLLS 124

Query: 116 -RNERPVSVQVMDFEDGMDEVWDIDSITSTLSQTIDVNNEKV--SQIIVTFDSYGVSNHI 172
             N R +++ ++DF DGMD+VWD   + S+L   + VN      + I++TFD+ G+SNH 
Sbjct: 125 SSNNRKINISILDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHP 184

Query: 173 NHKSCHIAVEKFIDDYVGSKTKEKAENAHITALYLRSYKN------NIFLKYNSFIWEIL 226
           NH +C+ AV   I  Y G K KE     +I  L L S  +      N+  KY  F+ +++
Sbjct: 185 NHIACNKAVHDLI-SYDGGKDKE----MNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLV 239

Query: 227 KMLYRTVSPFGRSIQPLAAPSTTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGW 286
           K+ +   +    +I     P++ + +  L  +NT+SQYIL++A+MLN HKSQ+VWFRYGW
Sbjct: 240 KVYWNLATGTFNTI-----PNSASLE--LSFINTYSQYILSYASMLNTHKSQMVWFRYGW 292

Query: 287 WILSRFVFVNEF 298
           W  SRFVF N+ 
Sbjct: 293 WWFSRFVFSNDL 304

>KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.846
           YMR281W
          Length = 278

 Score =  217 bits (552), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 124/298 (41%), Positives = 172/298 (57%), Gaps = 28/298 (9%)

Query: 10  SKLLFKITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPH----RDRNSQINLVIAHPDDE 65
           SKL+FKITKL ++   LYI  +PKI   N   L    P     R  +  + LV+AHPDDE
Sbjct: 5   SKLIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHPDDE 64

Query: 66  VMFFSPVISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERPVSVQV 125
           VMFFSP + QL ++ P    FNI+  S GDAEGLG  R+ EL  S  +L+   R   + +
Sbjct: 65  VMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIP-RRNKEIFI 123

Query: 126 MDFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIAVEKFI 185
            +  DGM+EVWD   +   L Q   + ++  + I++TFD +GVSNHINHK+CH  V  +I
Sbjct: 124 FNHTDGMNEVWDNKLM---LHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYI 180

Query: 186 DDYVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSIQPLAA 245
                   +  A+N    AL L SY +N+  KY  F W+++  L +     G+++  L  
Sbjct: 181 --------QSHAKNNF--ALLLDSYSSNLLKKYTGFAWQLV-FLAKNYWIHGKTLPNL-- 227

Query: 246 PSTTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDIFTY 303
                  + L L N +S YI A+A ML AHKSQ+VWFRYGWW  SRFV+VN+  ++T+
Sbjct: 228 -------DHLALFNPYSDYITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKLYTH 278

>CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281w GPI12 N-acetylglucosaminyl phosphatidylinositol
           deacetylase
          Length = 304

 Score =  214 bits (544), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 125/300 (41%), Positives = 177/300 (59%), Gaps = 20/300 (6%)

Query: 9   FSKLLFKITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIAHPDDEVMF 68
           FSKLLFK+TKL I+  VLYIYFTPK+   N ++L  + P  D    +NLVIAHPDDE+MF
Sbjct: 18  FSKLLFKLTKLTIIFQVLYIYFTPKVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMF 77

Query: 69  FSPVISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLL--RNERPVSVQVM 126
           FSP I QL  +  +    N++CLS GDA+GLGE RAKEL D+   L   RN R VS+ ++
Sbjct: 78  FSPTILQLIDHVQE---LNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNIL 134

Query: 127 DFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQ--IIVTFDSYGVSNHINHKSCHIAVEKF 184
           D+ DG +EVW    + + L + I  +   V Q  II+TFD  G+S H NH +C+  V  +
Sbjct: 135 DYTDGQNEVW--SGVATDLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVISY 192

Query: 185 IDDYVGSKTKEKAENAHITALYLRSYKN-NIFLKYNSFIWEILKMLYRTVSPFGRS-IQP 242
           +        K    N+ +  L L+S     I  KY+  + ++L+++Y  +    ++ +  
Sbjct: 193 L--------KTIKSNSFV-FLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSY 243

Query: 243 LAAPSTTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDIFT 302
           L    +    + +  ++T  QY L+FAAM  AHKSQ+VWFRY WW  SR+VFVN+    T
Sbjct: 244 LPNRDSIATDSNVCFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDLSRIT 303

>SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON}
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281W GPI12 ER membrane protein involved in the second
           step of glycosylphosphatidylinositol (GPI) anchor
           assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 260

 Score =  209 bits (533), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 116/288 (40%), Positives = 167/288 (57%), Gaps = 34/288 (11%)

Query: 11  KLLFKITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIAHPDDEVMFFS 70
           +++ K+ K   +L+VLYI  + +I + N    ++VFP R   S +NL++AHPDDE MFFS
Sbjct: 5   EVVAKLLKAYALLSVLYICVSQRIAAHNRQVFRNVFPSRTPTS-VNLIVAHPDDETMFFS 63

Query: 71  PVISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERPVSVQVMDFED 130
           P + QLH  +P +VP  ++CL+ GDA+GLG  R +EL  S  LLL   R  SV V  FED
Sbjct: 64  PTLLQLHVNYPPSVPLRVICLTNGDADGLGAVREQELRLSMQLLL-PARNTSVIVEGFED 122

Query: 131 GMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIAVEKFIDDYVG 190
           GM   WD   + +T+++ +       S +++TFD +GVS H+NH SC+ AV   ++    
Sbjct: 123 GMGVEWDTRQVVATINRHVS----DASPLLLTFDEHGVSGHVNHVSCNTAVSALVEQ--- 175

Query: 191 SKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSIQPLAAPSTTT 250
              +E+ E    TALYL S K     KY SF  ++ +++                    T
Sbjct: 176 ---REQREQ-RFTALYLNS-KRYFPPKYGSFAVDLARII--------------------T 210

Query: 251 EKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEF 298
            +   + M+T  QY+L+ AAM NAH SQ+VWFR+GWW+ SRFVFVNE 
Sbjct: 211 GRQPPVFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258

>NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON}
           Anc_8.846 YMR281W
          Length = 276

 Score =  209 bits (533), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 127/297 (42%), Positives = 171/297 (57%), Gaps = 31/297 (10%)

Query: 9   FSKLLFKITKLAIVLTVLYIYFTPKILSRNT---DSLQHVFPHRDRNSQINLVIAHPDDE 65
           FSKL+FK+TKL +VL +LY+  + +I   NT     L     H    + +NLVIAHPDDE
Sbjct: 8   FSKLIFKVTKLFLVLWLLYLLSSNRIEQFNTLNYSQLNTKIFHE--GTTLNLVIAHPDDE 65

Query: 66  VMFFSPVISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERPVSVQV 125
           VMFF+P + QL    P ++P N++C S GDA+GLGE R  EL  S   L++N+R  +V V
Sbjct: 66  VMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIHALIQNQRQTNVTV 125

Query: 126 MDFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIAVEKFI 185
           + F+DG D++WDID +T  L Q          Q  +TFDS+GVS H NH +CH AV    
Sbjct: 126 LHFQDGNDQIWDIDQMTQYLPQ-------NDHQAFLTFDSHGVSGHKNHIACHNAVWNL- 177

Query: 186 DDYVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSIQPLAA 245
                     K  N ++T L L S  +++  KY  FI +++K+ +     +    QP   
Sbjct: 178 ----------KNTNNNVTILTLDSIHHSLLAKYTFFIIDLVKLYWNL---WKDQQQP--- 221

Query: 246 PSTTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDIFT 302
                  + +   N +SQYILA++ MLNAHKSQVVWFRYGWW  SRFVF N   I T
Sbjct: 222 --QWESHDKITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHLKITT 276

>TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846
           YMR281W
          Length = 301

 Score =  206 bits (523), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 119/306 (38%), Positives = 175/306 (57%), Gaps = 27/306 (8%)

Query: 12  LLFKITKLAIVLTVLYIYFTPKILSRNTDS----LQHVFPHRDRNSQINLVIAHPDDEVM 67
           +LFK+ K   +L++LYI+ TP I   N  S    +Q     +   S +NL+IAHPDDEVM
Sbjct: 3   ILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKS-VNLIIAHPDDEVM 61

Query: 68  FFSPVISQLHAYFPDTVPFNILCLSKG---DAEGLGETRAKELNDSAVLLLRNERP---- 120
           FF+P + QL    P  VPFN++CLSKG   D   +G+ R+ E+ DS  +LL + R     
Sbjct: 62  FFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLNR 121

Query: 121 -VSVQVMDFEDGMDEVWDIDSITSTLSQTIDV--NNEKVSQIIVTFDSYGVSNHINHKSC 177
            V +   ++EDGMD+ WDI  + + +  TI +  N + +   ++TFD+ GVS H NH +C
Sbjct: 122 EVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIAC 181

Query: 178 HIAVEKFIDDYVGSKTKEKAEN-AHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPF 236
           + A+            K+K+ N      + L SY +NI LKY+SF+  + K+L   ++  
Sbjct: 182 YDAMMTL---------KQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDK 232

Query: 237 GRSIQPLAAP--STTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVF 294
            R  +    P  S   E + +  +NT   YI+A ++MLN+H SQ+VWFRYGWW  SRFVF
Sbjct: 233 FRIFELKQVPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVF 292

Query: 295 VNEFDI 300
           VN+  I
Sbjct: 293 VNDLHI 298

>ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR281W (GPI12)
          Length = 249

 Score =  184 bits (468), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 99/285 (34%), Positives = 158/285 (55%), Gaps = 41/285 (14%)

Query: 14  FKITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIAHPDDEVMFFSPVI 73
           F + KL ++L  +Y +   ++   NT   + +     +++ + LVIAHPDDEVMFF+P +
Sbjct: 6   FAVVKLYLLLLAVYCWSRRRLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMFFAPTL 65

Query: 74  SQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERPVSVQVMDFEDGMD 133
            QL A  P  +PF ++CL+ G AEGLG+ R  EL   A+ LL  E  V+++V DF DGM 
Sbjct: 66  LQLDARLPAWMPFRVVCLTDGGAEGLGQLRRAELQ-KALRLLVLEHDVTLEVADFTDGMK 124

Query: 134 EVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIAVEKFIDDYVGSKT 193
           E WD+  + + L + +         +++TFD  GVS H NH  C +A  +     +G KT
Sbjct: 125 EDWDLAEVRTRLGELV----TDAKPLVLTFDERGVSGHRNHIGCALAAAR-----LGHKT 175

Query: 194 KEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSIQPLAAPSTTTEKN 253
                      L+LRS + N+  KY+ F+ ++ ++++ T  P                  
Sbjct: 176 -----------LFLRS-ERNLLRKYSFFVLDVFRVVFGTPPP------------------ 205

Query: 254 GLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEF 298
             + ++T +QY+ A  AM+ AH+SQ+VWFR+GWW+ SR+V+ NE+
Sbjct: 206 -TVFVSTLAQYLHALVAMVVAHRSQMVWFRWGWWMASRYVYANEY 249

>Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {ON}
           YMR281W (GPI12) -
           N-acetylglucosaminylphosphatidylinositol de-N-acetylase
           [contig 39] FULL
          Length = 254

 Score =  184 bits (466), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 108/286 (37%), Positives = 159/286 (55%), Gaps = 38/286 (13%)

Query: 16  ITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIAHPDDEVMFFSPVISQ 75
           + K++ +L ++YI  + +I   N  +L  +F      S INLVIAHPDDEVMFF+P + Q
Sbjct: 7   VFKVSGILWLVYILGSVQIERSNRRALGSLFRGSAPTS-INLVIAHPDDEVMFFAPTLLQ 65

Query: 76  LHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERPVSVQVMDFEDGMDEV 135
           +  + P ++  N++ L+ G A+GLG+ R KEL D   LLLR +R  SV+V+DF DGMD  
Sbjct: 66  IDEWLPGSIEVNVISLTDGGADGLGDLRTKELQDCVRLLLR-KRKASVEVLDFLDGMDVE 124

Query: 136 WDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIAVEKFIDDYVGSKTKE 195
           WD++     L + I       S + +TFD  G+S H+NH SC+ AV+K    Y  S   +
Sbjct: 125 WDLERAVKALQERI----LDESPLFLTFDENGISGHVNHISCYKAVQKVRKHYSKSSCFK 180

Query: 196 KAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSIQPLAAPSTTTEKNGL 255
                          K  +F KY+ F   I  + +  +S         ++PST       
Sbjct: 181 LVS------------KRYLFEKYSGF---IPALFHSFIS---------SSPST------- 209

Query: 256 LLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDIF 301
            L+N+  QY+LA ++M+NAH SQ+VWFRYGWW+ S +V+ NE   F
Sbjct: 210 -LINSFRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANELQAF 254

>KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {ON}
           weakly similar to uniprot|P23797 Saccharomyces
           cerevisiae YMR281W GPI12 ER membrane protein involved in
           the second step of glycosylphosphatidylinositol (GPI)
           anchor assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 254

 Score =  180 bits (456), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 109/290 (37%), Positives = 154/290 (53%), Gaps = 44/290 (15%)

Query: 11  KLLFKITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIAHPDDEVMFFS 70
           ++L  + KL  VL +LY   + +I + N  +   +F   +  S INLVIAHPDDEVMFF+
Sbjct: 2   RILKVVCKLLAVLCILYFASSARIKASNEQAFTTLFSVLNPTS-INLVIAHPDDEVMFFA 60

Query: 71  PVISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERPVSVQVMDFED 130
           P + QL  YF   +P ++  L+ G A+GLG+ R +EL DS  LL R  R   V V++FED
Sbjct: 61  PTLLQLDHYFDTDIPVSVFSLTDGGADGLGKLREEELRDSVHLLFR-RRKAEVTVLNFED 119

Query: 131 GMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIAVEKFIDDYVG 190
           GM   WD+   +  L + + V ++    + +TFD +GVS+HINH SC+  V         
Sbjct: 120 GMKVEWDLQKTSEALRKQV-VGDQP---LFLTFDDHGVSSHINHISCYETVRNL------ 169

Query: 191 SKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSIQPLAAPSTTT 250
                +A +    +  L S K +IF KY +F+                       PS  T
Sbjct: 170 -----RAAHPESRSFSLTS-KRSIFQKYTAFV-----------------------PSLIT 200

Query: 251 EKNG---LLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNE 297
              G    + M+T  QY+LA + M+NAH SQ+VWFRYGWW  S +VF NE
Sbjct: 201 VLRGSRQAVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCYVFANE 250

>Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar to
           Ashbya gossypii ABL120W
          Length = 249

 Score =  177 bits (449), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 154/286 (53%), Gaps = 41/286 (14%)

Query: 13  LFKITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIAHPDDEVMFFSPV 72
            F + KL +VL  +Y      + + N+   +++       + + L+IAHPDDEVMFF+P 
Sbjct: 5   FFAVIKLYLVLLAVYCGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFAPT 64

Query: 73  ISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERPVSVQVMDFEDGM 132
           + QL A    +VPF ++CL+ GDA+GLGE R +EL+  A+ LL  ER V +Q+  F+DGM
Sbjct: 65  LLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELH-KALRLLVLERDVEIQMGGFKDGM 123

Query: 133 DEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIAVEKFIDDYVGSK 192
           DE W ++ +   L+Q +         +++TFD  GVS H NH +C  A  K     +G  
Sbjct: 124 DEEWKMEVVREELAQVVTDRRP----LVLTFDERGVSGHRNHIACAHAAAK-----LGHH 174

Query: 193 TKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSIQPLAAPSTTTEK 252
           T           L+L S  +N+  KY+ F  ++ ++L+    P                 
Sbjct: 175 T-----------LHLDS-GHNLIRKYSFFFVDLFRLLFGYPMP----------------- 205

Query: 253 NGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEF 298
              + ++T SQY+ +   ML AHKSQ+VWFR+GWW  SR+V+ NEF
Sbjct: 206 --TVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRYVYANEF 249

>KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {ON}
           similar to uniprot|Q75DZ3 Ashbya gossypii ABL120W
           ABL120Wp and weakly similar to YMR281W uniprot|P23797
           Saccharomyces cerevisiae YMR281W GPI12 ER membrane
           protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de- N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 263

 Score =  177 bits (449), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 99/247 (40%), Positives = 141/247 (57%), Gaps = 37/247 (14%)

Query: 53  SQINLVIAHPDDEVMFFSPVISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAV 112
           + + LV+AHPDDEVMFFSP ++Q +   P ++P N++C++ GDA+GLG  R +EL DS  
Sbjct: 49  TSVTLVVAHPDDEVMFFSPTLTQFNELLPISIPINVVCMTAGDADGLGHIRKQELVDSLR 108

Query: 113 LLLRNERPVSVQVMDFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHI 172
           ++    R     V+DFEDGMD VWD   +   L  +I  +N     +++TFD +GVS HI
Sbjct: 109 IMFHG-RQFGCDVLDFEDGMDAVWDQVLLEKQLRSSIPDSNP----LVLTFDQFGVSGHI 163

Query: 173 NHKSCHIAVEKFIDDYVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRT 232
           NH SC              +  EK   +H   L+LRS    I++KY++FI  I ++   T
Sbjct: 164 NHISC-------------GRLVEKLPYSH--KLHLRS-DQPIYVKYSAFIAGIFQLGIST 207

Query: 233 VSP-FGRSIQPLAAPSTTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSR 291
           V P +G+       P           ++T  QY+LA +AM  AH SQ+VWFR GWW+ SR
Sbjct: 208 VYPDYGK-------PRC--------FISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSR 252

Query: 292 FVFVNEF 298
           F F+NE 
Sbjct: 253 FCFINEL 259

>TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.846
           YMR281W
          Length = 319

 Score =  177 bits (448), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 109/318 (34%), Positives = 177/318 (55%), Gaps = 41/318 (12%)

Query: 15  KITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPH-----RDRNSQIN---LVIAHPDDEV 66
           +  KL ++  ++YI+ +  I   N  S  +   H       ++ +IN   L+IAHPDDE+
Sbjct: 9   RTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLIIAHPDDEI 68

Query: 67  MFFSPVISQLHAYFPDTVPFNILCLSKG-DAEGLGE--TRAKELNDSAVLLL------RN 117
           MFFSP + QL+ Y    + FN++CLS+G D+ G  +   R  ELNDS  LL        +
Sbjct: 69  MFFSPTLLQLNNYLEKDIMFNVVCLSQGLDSTGSFKDPQRVHELNDSLNLLFNRGSNNEH 128

Query: 118 ERPVSVQVMDFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSC 177
            R   +  +D+ DGM E+W++D I   L Q ++  +  ++ +++TFD  GVSNH NH +C
Sbjct: 129 NRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGIN-LLLTFDKSGVSNHKNHLAC 187

Query: 178 HIAVEKFIDDYVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFI---WEILKM-LYRTV 233
           + AV K +        K    ++++  ++L S+  N FLKY+ F+   + I+K+  +R++
Sbjct: 188 NEAVTKLL--------KYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSI 239

Query: 234 S----------PFGRSIQPLAAPSTTTEKN-GLLLMNTHSQYILAFAAMLNAHKSQVVWF 282
           S           F +S Q ++     T+ N      N  ++Y+L+++ MLNAH+SQ+VWF
Sbjct: 240 SLFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWF 299

Query: 283 RYGWWILSRFVFVNEFDI 300
           RY WWI SRF F+N+  I
Sbjct: 300 RYLWWIFSRFAFINDLTI 317

>KLLA0C14190g Chr3 complement(1227049..1228836) [1788 bp, 595 aa]
           {ON} conserved hypothetical protein
          Length = 595

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 102 TRAKELNDSAVLLLRNERPVSVQVMDFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQIIV 161
           TR K L D A L+   E PV   ++D  D  +      S T+T+S+ + + +E  S  I+
Sbjct: 151 TRHKLLQDIATLIESMETPVLESILD-SDVYNTTPLFASPTTTVSKAMSMMSENKSTAIL 209

Query: 162 TFDSYGVSNHINHKSCHI 179
             DS   S+  N+  C+I
Sbjct: 210 IHDSSTKSDIRNNNDCNI 227

>KNAG0G01370 Chr7 complement(303099..311114) [8016 bp, 2671 aa] {ON}
           Anc_8.155 YGL195W
          Length = 2671

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 13/89 (14%)

Query: 109 DSAVLLLRNERPVSVQVMDFEDGMDEVW---------DIDSITSTLSQTIDVNNEKVSQI 159
           +S V LL N  P  +   D E  +DEV+         +  S+ S +   + VN++ VS  
Sbjct: 352 NSIVALLSNAPPQKLAEPDLEKLVDEVFKNIKANLNAEYKSLASKILIKVPVNSQTVSSK 411

Query: 160 IVTFDSYGVSNHINHKSCHIAVEKFIDDY 188
           +VT    G+SN+I  +S   A+   +D +
Sbjct: 412 LVT----GLSNYILKESNEAALSLLLDAF 436

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.136    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,929,908
Number of extensions: 1450735
Number of successful extensions: 4231
Number of sequences better than 10.0: 36
Number of HSP's gapped: 4285
Number of HSP's successfully gapped: 36
Length of query: 303
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 194
Effective length of database: 40,982,805
Effective search space: 7950664170
Effective search space used: 7950664170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)