Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_13.4678.843ON54354327190.0
Smik_13.4928.843ON54354322710.0
Skud_13.4518.843ON53953822680.0
YMR279C8.843ON54053822150.0
KNAG0J002608.843ON55048217810.0
NCAS0A02540singletonON53950217530.0
NDAI0K004008.843ON55348616780.0
KAFR0B03930singletonON55553516570.0
Suva_13.278.843ON55353016540.0
CAGL0M03003g8.843ON55848616540.0
YML116W (ATR1)8.843ON54249016520.0
NCAS0B002908.843ON54249916280.0
KAFR0B039408.843ON54749416230.0
Smik_13.188.843ON54548716220.0
Skud_13.258.843ON53753516200.0
KNAG0G034308.843ON54250416170.0
NCAS0C004008.843ON51749916120.0
NDAI0E002808.843ON54954016030.0
SAKL0D01386g8.843ON52149815760.0
TDEL0B005508.843ON53748515500.0
TPHA0C047908.843ON55647815460.0
Kwal_27.102458.843ON51548915340.0
TBLA0D032708.843ON55049715240.0
KLTH0C03806g8.843ON52548315120.0
Kpol_541.168.843ON52848414980.0
CAGL0B02343g8.843ON53749814720.0
KAFR0A028408.843ON52046414350.0
TBLA0D03280singletonON58049214000.0
TBLA0C01160singletonON60048711291e-148
Smik_15.560na 1ON5164808811e-112
Skud_15.545na 1ON5164808751e-111
YOR378Wna 1ON5154808711e-110
KLTH0C10560gna 1ON5154698671e-110
Suva_8.435na 1ON5154788481e-107
KLLA0B00352gna 1ON4984888231e-103
Kwal_23.6547na 1ON5114788191e-102
TDEL0G04950singletonON5124966806e-82
KNAG0D00130na 1ON5654905623e-64
KAFR0C04860na 1ON5344895141e-57
SAKL0C06116gsingletonON1851904478e-52
NCAS0A05720na 1ON5635234591e-49
NDAI0K02730singletonON6045484012e-41
CAGL0L02519gna 1ON5294453852e-39
Smik_6.24na 2ON5444751857e-14
Skud_6.16na 2ON5494751813e-13
SAKL0F00440gsingletonON5444921553e-10
Suva_10.11singletonON5405071536e-10
KLLA0C18931gna 3ON5535291304e-07
TDEL0D06610singletonON4974161252e-06
KLTH0G13464g8.272ON5934241233e-06
Kwal_34.15746na 3ON5184841171e-05
Kwal_56.237548.272ON5894651134e-05
KLLA0F13684g2.473ON571981134e-05
ZYRO0C01430g8.272ON5901091091e-04
Skud_13.2442.473ON562981072e-04
NCAS0A078102.473ON5681221063e-04
Kwal_14.722singletonON6111241054e-04
YMR088C (VBA1)2.473ON562981054e-04
Smik_13.2722.473ON561981037e-04
TDEL0A024902.473ON554781038e-04
NDAI0H022002.473ON571981010.001
KLTH0H16214gsingletonON5514241000.002
Suva_13.2652.473ON561981000.002
Kpol_358.4na 4ON617146990.002
KLLA0A04631g8.272ON57993990.002
Ecym_73992.473ON563126990.002
CAGL0J01375g2.473ON564107990.002
Kpol_543.448.272ON64392980.003
Kpol_416.5singletonON60770970.003
Skud_6.14singletonON636148970.004
SAKL0E02992g2.473ON57078970.004
AGR076C8.272ON686109970.004
Kpol_416.6singletonON597184960.005
ABL040W2.473ON56750930.009
Suva_5.2na 4ON627135930.010
YKR105C (VBA5)singletonON582398930.010
TPHA0G031502.473ON60091920.013
Skud_5.24na 4ON627135910.018
TDEL0F039908.272ON63169910.021
Suva_10.9singletonON63777910.021
YPR198W (SGE1)singletonON54367900.022
Smik_6.22singletonON63699910.022
ZYRO0G07414gsingletonON70758900.025
SAKL0C02178gsingletonON565103900.026
Kpol_467.242.473ON37098890.028
TPHA0M00120singletonON619141900.028
SAKL0A08228gsingletonON56985890.030
KNAG0E025602.473ON578124890.032
KLTH0G09504gna 5ON62481880.042
Smik_5.22na 4ON628141880.042
SAKL0C11066gsingletonON580134870.055
KLTH0D16962gsingletonON571106870.056
Suva_9.712.241ON561150860.066
KLTH0C10120gsingletonON651106860.070
ZYRO0G03234g2.473ON56278860.071
SAKL0H16808g8.272ON65765850.099
KAFR0I01560singletonON63278850.11
NDAI0D010202.242ON592179850.11
Suva_26.1singletonON53467840.12
SAKL0A00726gsingletonON59884840.13
Skud_16.503singletonON54367840.14
TDEL0G04740singletonON601137830.15
Klac_YGOB_Anc_2.2412.241ON602154830.18
TBLA0C01100na 6ON64995830.19
TDEL0C045902.242ON529145820.23
SAKL0A07480gsingletonON573190820.24
TPHA0A017508.272ON636107810.27
KLLA0E14609gsingletonON63961800.38
TBLA0F030408.272ON90692800.40
KLTH0D00110gsingletonON62069800.44
KLTH0B10450gsingletonON62069800.44
Smik_11.370singletonON440108790.45
KLTH0D05434g2.473ON57683790.48
SAKL0E00132gsingletonON62068790.50
CAGL0B02079gna 7ON624142790.56
Smik_17.11singletonON54467780.60
Kwal_23.5241na 8ON59178780.61
NCAS0C03460na 7ON630144780.69
SAKL0F00110gsingletonON62068780.72
SAKL0C12122gna 8ON611130780.74
NDAI0I02650na 4ON63873770.81
KLTH0D18150gsingletonON60775770.91
NCAS0D02350na 4ON634102761.1
KLTH0G09372g2.242ON551163761.2
Smik_11.368singletonON580354761.2
YKR106W (GEX2)singletonON61558761.3
TBLA0F00470singletonON73262761.3
SAKL0G06600gsingletonON62963761.3
YBR293W (VBA2)na 9ON474135751.3
YCL073C (GEX1)singletonON61558751.4
NDAI0A02050singletonON617360751.5
Kwal_23.48242.242ON553138751.5
Skud_18.6singletonON610107751.7
Kwal_26.77552.473ON55945741.8
Ecym_45063.245ON64860741.9
Smik_21.4singletonON60555741.9
SAKL0E08756g2.242ON56583741.9
CAGL0E04092gna 10ON64591742.0
TDEL0G03260singletonON61284742.2
SAKL0F00792gsingletonON61759742.2
Kwal_56.22298singletonON61071742.3
YOL158C (ENB1)singletonON60667732.5
Kwal_34.15711na 10ON61869732.6
NCAS0I00110na 10ON45272732.7
KLLA0A10439gsingletonON63471732.7
KLTH0A01562gna 8ON615215732.9
Skud_2.423na 9ON560135733.0
SAKL0E04246gna 11ON56594723.1
KLTH0D00506gsingletonON61680723.2
ABL210CsingletonON47881723.5
KLLA0F17776gna 11ON55365723.9
Kwal_23.2794singletonON61983714.2
KLTH0C10142gsingletonON573151714.5
Kpol_513.33singletonON626176714.8
Ecym_42988.272ON67846715.0
KLLA0F03311g2.242ON54283715.0
YGR224W (AZR1)na 7ON61384715.3
Skud_7.560na 7ON64284705.7
Kpol_1039.192.242ON573114705.9
SAKL0F00198gsingletonON537158706.3
Smik_14.2622.242ON561170706.3
NCAS0G029902.242ON581118706.8
Kwal_23.4853na 5ON60366697.2
Skud_8.3na 10ON63191697.2
TDEL0H00130singletonON621151697.2
TBLA0G025502.242ON613114698.6
SAKL0C05588gsingletonON67782698.8
KAFR0J009302.242ON566114699.1
TBLA0C01040singletonON66960699.1
Skud_8.84.5ON546125689.2
ZYRO0A00330gsingletonON57651689.6
KLLA0C00220gsingletonON62460689.7
Skud_18.3singletonON59069689.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_13.467
         (543 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...  1051   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   879   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   878   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   857   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   690   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   679   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               650   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   642   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   641   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   641   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   640   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      631   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   629   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   629   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   628   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   627   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      625   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      622   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   611   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   601   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   600   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   595   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   591   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   587   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   581   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   571   0.0  
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   557   0.0  
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   543   0.0  
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   439   e-148
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   343   e-112
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   341   e-111
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   340   e-110
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   338   e-110
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   331   e-107
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   321   e-103
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   320   e-102
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   266   6e-82
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   221   3e-64
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     202   1e-57
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   176   8e-52
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            181   1e-49
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   159   2e-41
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   152   2e-39
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    76   7e-14
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    74   3e-13
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    64   3e-10
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    64   6e-10
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    55   4e-07
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    53   2e-06
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    52   3e-06
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    50   1e-05
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    48   4e-05
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    48   4e-05
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    47   1e-04
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    46   2e-04
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    45   3e-04
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...    45   4e-04
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    45   4e-04
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    44   7e-04
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    44   8e-04
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    44   0.001
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    43   0.002
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    43   0.002
Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON} c...    43   0.002
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    43   0.002
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    43   0.002
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    43   0.002
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    42   0.003
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...    42   0.003
Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON} Y...    42   0.004
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    42   0.004
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    42   0.004
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...    42   0.005
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    40   0.009
Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)       40   0.010
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    40   0.010
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    40   0.013
Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)    40   0.018
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    40   0.021
Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON} ...    40   0.021
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    39   0.022
Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON} Y...    40   0.022
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...    39   0.025
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    39   0.026
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    39   0.028
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}                39   0.028
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    39   0.030
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    39   0.032
KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {...    39   0.042
Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)    39   0.042
SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa] ...    38   0.055
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    38   0.056
Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W (...    38   0.066
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    38   0.070
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    38   0.071
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    37   0.099
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C      37   0.11 
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    37   0.11 
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)        37   0.12 
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    37   0.13 
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    37   0.14 
TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {O...    37   0.15 
Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 b...    37   0.18 
TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432     37   0.19 
TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.2...    36   0.23 
SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {...    36   0.24 
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    36   0.27 
KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} simi...    35   0.38 
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    35   0.40 
KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to ...    35   0.44 
KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {...    35   0.44 
Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106...    35   0.45 
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    35   0.48 
SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to...    35   0.50 
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    35   0.56 
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    35   0.60 
Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL06...    35   0.61 
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    35   0.69 
SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to...    35   0.72 
SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} simi...    35   0.74 
NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON}               34   0.81 
KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]...    34   0.91 
NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON}               34   1.1  
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    34   1.2  
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    34   1.2  
YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}  GEX2Proto...    34   1.3  
TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON}               34   1.3  
SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {...    34   1.3  
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...    33   1.3  
YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}  GEX1...    33   1.4  
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...    33   1.5  
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    33   1.5  
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...    33   1.7  
Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C...    33   1.8  
Ecym_4506 Chr4 complement(1013521..1015467) [1947 bp, 648 aa] {O...    33   1.9  
Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)     33   1.9  
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    33   1.9  
CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} simila...    33   2.0  
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               33   2.2  
SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar ...    33   2.2  
Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C ...    33   2.3  
YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}  E...    33   2.5  
Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C ...    33   2.6  
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}         33   2.7  
KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {...    33   2.7  
KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {...    33   2.9  
Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W ...    33   3.0  
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    32   3.1  
KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar ...    32   3.2  
ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON} Non-s...    32   3.5  
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    32   3.9  
Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C (...    32   4.2  
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    32   4.5  
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...    32   4.8  
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    32   5.0  
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    32   5.0  
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    32   5.3  
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    32   5.7  
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    32   5.9  
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    32   6.3  
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    32   6.3  
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    32   6.8  
Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {O...    31   7.2  
Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL0...    31   7.2  
TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON}       31   7.2  
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    31   8.6  
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    31   8.8  
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    31   9.1  
TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON}               31   9.1  
Skud_8.8 Chr8 (14282..15922) [1641 bp, 546 aa] {ON} YHL036W (REAL)     31   9.2  
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    31   9.6  
KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar ...    31   9.7  
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    31   9.8  

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score = 1051 bits (2719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/543 (95%), Positives = 519/543 (95%)

Query: 1   MYPVIEEKVNVQSKDSPVIDKISMKAEDKXXXXXXXXXXXXXASSNKSTQVSNDSPWQDP 60
           MYPVIEEKVNVQSKDSPVIDKISMKAEDK             ASSNKSTQVSNDSPWQDP
Sbjct: 1   MYPVIEEKVNVQSKDSPVIDKISMKAEDKVVVSSEDEDVTTVASSNKSTQVSNDSPWQDP 60

Query: 61  TYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAG 120
           TYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAG
Sbjct: 61  TYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAG 120

Query: 121 SFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFIL 180
           SFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFIL
Sbjct: 121 SFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFIL 180

Query: 181 PNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFYAFAI 240
           PNVMGLVGHVYKVGSTRKNLVISFIGACAPA           IVNEDSEQWPWVFYAFAI
Sbjct: 181 PNVMGLVGHVYKVGSTRKNLVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAI 240

Query: 241 AFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIA 300
           AFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIA
Sbjct: 241 AFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIA 300

Query: 301 LLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQ 360
           LLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQ
Sbjct: 301 LLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQ 360

Query: 361 LNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLP 420
           LNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLP
Sbjct: 361 LNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLP 420

Query: 421 VKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLG 480
           VKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLG
Sbjct: 421 VKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLG 480

Query: 481 MGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKDSVIT 540
           MGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKDSVIT
Sbjct: 481 MGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKDSVIT 540

Query: 541 EMS 543
           EMS
Sbjct: 541 EMS 543

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/543 (78%), Positives = 472/543 (86%)

Query: 1   MYPVIEEKVNVQSKDSPVIDKISMKAEDKXXXXXXXXXXXXXASSNKSTQVSNDSPWQDP 60
           M P+ ++K++VQ  D  + DK  MK +DK              SSN+S QV+NDSPWQDP
Sbjct: 1   MLPIFKKKMSVQGTDYQIHDKTIMKVDDKVVISTEDEEVTTVTSSNESNQVTNDSPWQDP 60

Query: 61  TYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAG 120
            YFSSFG+ELMFI TCMLAQLLNQAGQTHAL IMNVLSKSFNSES+ QAWLMASFPL AG
Sbjct: 61  IYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAG 120

Query: 121 SFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFIL 180
           SFILISGRLGDIYGLKKML+IGYV II+WS+I GLSKYSN+DAFFITCRAFQGLGIAFIL
Sbjct: 121 SFILISGRLGDIYGLKKMLLIGYVIIIIWSIISGLSKYSNSDAFFITCRAFQGLGIAFIL 180

Query: 181 PNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFYAFAI 240
           PN+MGLVGHVYKVGS RKNLVIS IGACAPA           IV ED EQWPWVFYAF+I
Sbjct: 181 PNIMGLVGHVYKVGSLRKNLVISVIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAFSI 240

Query: 241 AFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIA 300
           A F+++++AWYSIPNN+PTNVHG SMDWTGS LAV+GLILFNFVWNQAP AGWG AYII 
Sbjct: 241 ATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYIIV 300

Query: 301 LLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQ 360
           LLI+SVFFL+AFFVYE+KYA+VPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYY+SFQ
Sbjct: 301 LLILSVFFLIAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ 360

Query: 361 LNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLP 420
           LNLRHYSPVWTGGTYFVFVIFG+IAAF VA SIKR+GPA LLCFAL+AFD GSIMFSVLP
Sbjct: 361 LNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLP 420

Query: 421 VKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLG 480
           V+QS+WKLNF MQAILCFGMDLSFPASSIILSDGLPM+YQGMAGSLVNTVINYSASLCLG
Sbjct: 421 VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 480

Query: 481 MGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKDSVIT 540
           MG TVE QINK+G++LLKGYR AIYLG+GLASLG+LIS TYMLE FWN  ++ +K  +  
Sbjct: 481 MGVTVERQINKSGQNLLKGYRAAIYLGIGLASLGLLISVTYMLENFWNKHKESEKKRLEA 540

Query: 541 EMS 543
           E S
Sbjct: 541 ETS 543

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/538 (80%), Positives = 470/538 (87%), Gaps = 1/538 (0%)

Query: 1   MYPVIEEKVNVQSKDSPVIDKISMKAEDKXXXXXXXXXXXXXASSNKSTQVSNDSPWQDP 60
           M P  E K++VQ   SPV DKISMK EDK             ASS+KS Q+SNDSPWQDP
Sbjct: 1   MLPSFERKMSVQGTSSPVNDKISMKEEDKVIVSTDEEVTTV-ASSSKSNQISNDSPWQDP 59

Query: 61  TYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAG 120
           TYFSSFG+ELMFI TCMLAQLLNQAGQTHAL IMNVLSKSF SES+ QAWLMASFPL AG
Sbjct: 60  TYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAG 119

Query: 121 SFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFIL 180
           SFILISGRLGDIYGLKKMLMIGYV IIVWS+I GLSKYSNND+FFITCRAFQG+GIAFIL
Sbjct: 120 SFILISGRLGDIYGLKKMLMIGYVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFIL 179

Query: 181 PNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFYAFAI 240
           PN+MGLVGHVYKVGS RKNLVIS IGAC P            IV ED  QWPWVFYAF I
Sbjct: 180 PNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGI 239

Query: 241 AFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIA 300
           A F++M++AWYSIPNN+PTNVHG SMDWTGSVLAVIGLILFNFVWN+AP AGW  AYII 
Sbjct: 240 ATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIV 299

Query: 301 LLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQ 360
           LL++SVFFLVAFFVYE+KYA+VPLLPHAVTKNRHMIMILLAVF+GWGSFGIWTFYY+SFQ
Sbjct: 300 LLVVSVFFLVAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQ 359

Query: 361 LNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLP 420
           LNLRHYSPVWTGGTYFVF IFGTIAAF VA SIKR+GPA LLCFAL+AFD GSIMFSVLP
Sbjct: 360 LNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLP 419

Query: 421 VKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLG 480
           V+QS+WKLNF MQA+LCFGMDLSFPASSIILSDGLPM+YQGMAGSLVNTVINYSASLCLG
Sbjct: 420 VEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 479

Query: 481 MGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKDSV 538
           MGATVEHQINK+GK++L+GYR A+YLG+GLASLGVLIS TYMLET WN R+  Q+ S+
Sbjct: 480 MGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRKSL 537

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  857 bits (2215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/538 (77%), Positives = 463/538 (86%)

Query: 1   MYPVIEEKVNVQSKDSPVIDKISMKAEDKXXXXXXXXXXXXXASSNKSTQVSNDSPWQDP 60
           M+ + ++K +VQ  DS + +KI++KA+DK              SS KSTQV+NDSPWQDP
Sbjct: 1   MFSIFKKKTSVQGTDSEIDEKITVKAKDKVVVSTEDEEVTTIVSSTKSTQVTNDSPWQDP 60

Query: 61  TYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAG 120
           TYFSSFG+ELMFI TCMLAQLLNQAGQTHAL IMNVLSKSFNSE++ QAWLMASFPL AG
Sbjct: 61  TYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAG 120

Query: 121 SFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFIL 180
           SFILISGRLGDIYGLKKML++GYV +IVWS+I GLSKYSN+DAFFIT RAFQG+GIAFIL
Sbjct: 121 SFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFIL 180

Query: 181 PNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFYAFAI 240
           PN+MGLVGHVYKVGS RKN+VISFIGACAP            IV ED  QWPWVFYAF I
Sbjct: 181 PNIMGLVGHVYKVGSFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGI 240

Query: 241 AFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIA 300
           A FL++++AWYSIPNN+PTN+HG SMDWTGS LA+IGLILFNFVWNQAP  GW   YII 
Sbjct: 241 ATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIV 300

Query: 301 LLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQ 360
           LLIISV FLVAFFVYE KYA+VPLLP A+TKNRHMIMILLAVFLGWGSFGIWTFYY+SFQ
Sbjct: 301 LLIISVIFLVAFFVYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQ 360

Query: 361 LNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLP 420
           LNLRHYSPVWTGGTYFVFVIFG++AAF VA SIKR+GPA LLCF+L+AFD GSIMFSVLP
Sbjct: 361 LNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLP 420

Query: 421 VKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLG 480
           V+QS+WKLNF MQAILCFGMDLSFPASSIILSDGLPM+YQGMAGSLVNTVINYSASLCLG
Sbjct: 421 VEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLG 480

Query: 481 MGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKDSV 538
           MG TVEHQINK+G DLLKGYR A+YLGVGLASLGV+IS TYMLE  WN  R  +  S+
Sbjct: 481 MGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDRSL 538

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/482 (65%), Positives = 391/482 (81%)

Query: 46  NKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSES 105
           ++S    ND+PWQ+PTYF++  +E  FI TCMLAQLLNQAGQ  A   MN+L+ +FNS +
Sbjct: 51  SESEFTDNDTPWQNPTYFANRWQEYAFISTCMLAQLLNQAGQAQATAPMNILADAFNSSA 110

Query: 106 DKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFF 165
            KQ WLMASFPLV+GSFIL+SGR+GDIYGLKK L+ GY+ +++WSLICG + Y++NDAFF
Sbjct: 111 KKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFF 170

Query: 166 ITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVN 225
           I CRAFQGLGIAFILPNVMGL+G++YK  + RKN VISF+G CAP            I +
Sbjct: 171 ILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAH 230

Query: 226 EDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVW 285
           E+ +QWPW+FYA+AI   +NM++A YSIP+ +PTN+HGF MDWTGS + V+G+ILFNFVW
Sbjct: 231 ENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVW 290

Query: 286 NQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLG 345
           NQ P  GW   YIIALLI+SVF L+AFF+YE+K+AK PLLP  V KNRH+ MILLAVF+G
Sbjct: 291 NQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMG 350

Query: 346 WGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFA 405
           WGSFGIWTFYY +FQLNLRHYS VW GGT+F+FVI+GTIAAF+VAL+IKRVGP+ LLCF+
Sbjct: 351 WGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFS 410

Query: 406 LVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGS 465
           +  F VG IM SV PV QS+WK+N GMQ IL FGMDLSFPASSIILSD LP +YQGMAGS
Sbjct: 411 MTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGS 470

Query: 466 LVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLET 525
           LVNT++NYS SLCLG+G+T E Q+NKNG D LKGYR A+Y+G+GL + G+L++F Y+ E 
Sbjct: 471 LVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFEV 530

Query: 526 FW 527
            W
Sbjct: 531 LW 532

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/502 (64%), Positives = 398/502 (79%), Gaps = 2/502 (0%)

Query: 44  SSNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNS 103
           S++  + + +DSPWQ+P YFSS  +E  FI TCM+A LLNQAGQT  L+ MNV+S+SF+S
Sbjct: 37  SNSTDSVLDDDSPWQNPNYFSSKYKEYFFIFTCMVANLLNQAGQTQVLSTMNVISESFHS 96

Query: 104 ESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDA 163
           +S KQ WLMASFPLV+GSFILISGR+GDIYGLKK ++ GY+ +I+WSL+CG + +++ND 
Sbjct: 97  DSGKQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWSLLCGFADFTHNDT 156

Query: 164 FFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXI 223
           FFI CRAFQGLGI+FILPNVMGL+G++YKVG+ RKN+VIS IG  AP            I
Sbjct: 157 FFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLRKNIVISMIGLTAPTGACMGALWGGLI 216

Query: 224 VNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNF 283
           V E+++QWPW+FYA+A+   +N+I+A YS+PN IPTNVH F+MDW GS++ V+GLILFNF
Sbjct: 217 VTENAKQWPWIFYAYALTGLVNLIMALYSVPNCIPTNVHNFAMDWIGSIIGVVGLILFNF 276

Query: 284 VWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVF 343
           VWNQ P AGW  AYII LLIISV FLVAF VYE+KY   PLLP  VTKN  ++ IL  +F
Sbjct: 277 VWNQGPVAGWDKAYIIVLLIISVLFLVAFVVYELKYPISPLLPVEVTKNGQILTILSILF 336

Query: 344 LGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLC 403
           LGWG+FGIWTFYY +FQLNLR YSPVW GGTYF+F+I+GTIAA +VA +IK+VGPA LL 
Sbjct: 337 LGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTYFMFIIWGTIAALIVAFTIKKVGPAILLF 396

Query: 404 FALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMA 463
           F+ + F +GS+M SV P+ Q +W++N GMQ ILCFGMDLSFPASSIILSD LPM+YQGMA
Sbjct: 397 FSALGFTMGSLMLSVTPIHQMYWRMNLGMQIILCFGMDLSFPASSIILSDHLPMQYQGMA 456

Query: 464 GSLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYML 523
           GSLVNTVINY+ SLCLGMG TVE QINK+G+DLLKGYR A+YL VGL  LG  I+F  + 
Sbjct: 457 GSLVNTVINYATSLCLGMGTTVERQINKSGEDLLKGYRSALYLAVGLGGLGSCIAFINLC 516

Query: 524 ETFWNNRRDRQKD--SVITEMS 543
            T W  RRDR  D  SV T+ S
Sbjct: 517 YTLWMKRRDRLADLKSVSTDDS 538

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/486 (64%), Positives = 387/486 (79%), Gaps = 1/486 (0%)

Query: 52  SNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWL 111
            N+S WQ+P YFSS  +E +F+ TCM+A LLNQAGQ+  L+ MNV+S SF+S +  Q WL
Sbjct: 58  ENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWL 117

Query: 112 MASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAF 171
           MASFPLV+GSFILISGRLGDIYGLK+M++ G++ +I+WSLICG + Y+++D FFI  RAF
Sbjct: 118 MASFPLVSGSFILISGRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVARAF 177

Query: 172 QGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQW 231
           QGLGI+FILPNVMGLVG++YKVG+ RKN+VIS IG  AP            IV E+ +QW
Sbjct: 178 QGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQW 237

Query: 232 PWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTA 291
           PW+FYA+A+A  + +++ +Y++P+NIPTNV+GF+MDW GSVL VIGLILFNFVWNQ P  
Sbjct: 238 PWIFYAYAVAAAVCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIV 297

Query: 292 GWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGI 351
           GW  AYII LLI+SV FL+AFFVYE+KYAKVPLLP AVT+N H++ IL  +FLGWGSFGI
Sbjct: 298 GWEKAYIIVLLIVSVIFLIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGI 357

Query: 352 WTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDV 411
           WTFYY +FQLNLR YSPVW+GGT+FVF+IFGT+AA  VAL+IK+VGPA LL F+ + F  
Sbjct: 358 WTFYYFAFQLNLREYSPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGFTC 417

Query: 412 GSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVI 471
           GSI+ SV PV Q++W+  FGMQ IL FGMDL FPASSIILSD LPM+YQGMA SLVNT++
Sbjct: 418 GSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIV 477

Query: 472 NYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRR 531
           NYS SLCLGMG TVE QINK+G DLLKGYR A+Y GVG+A LG  I+F  +    W+ R 
Sbjct: 478 NYSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRN 537

Query: 532 DRQ-KD 536
            +  KD
Sbjct: 538 AKDPKD 543

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/535 (58%), Positives = 403/535 (75%), Gaps = 5/535 (0%)

Query: 6   EEKVNVQSKDSPVIDKISMKAEDKXXXXXXXXXXXXXASSNKSTQVSNDSPWQDPTYFSS 65
           +EKVNV  K +  I+ ++  +                 S +      N++PWQ+P+YFSS
Sbjct: 20  QEKVNVAVKAT--INTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSYFSS 77

Query: 66  FGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILI 125
             +E +FI+TCML+ LLNQAGQT A + MNV+  +FN++S  + WLMASFPLV+GSFIL+
Sbjct: 78  RWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILV 137

Query: 126 SGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMG 185
           SGR+GDIYGLK+ ++ G + +I+WSLICG + YS++  FFI CRAFQGLGIAF+LPNVMG
Sbjct: 138 SGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMG 197

Query: 186 LVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFYAFAIAFFLN 245
           LVG++YKVGS RKN+VIS IG CAP            I  +  +QWPW+FYA+A A  LN
Sbjct: 198 LVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILN 257

Query: 246 MILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIIS 305
           ++LA YSIP+ +P NVHGFSMDWTGSV+ VIGLILFNFVWN+AP  GW  AYII LLI S
Sbjct: 258 LVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYIIVLLIFS 317

Query: 306 VFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRH 365
           +  +V FF+YE+K+AK PLLP AVT N ++IMIL A+F+GWGSFGIWTFYY +F LNLR 
Sbjct: 318 LLIIVVFFIYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRG 377

Query: 366 YSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQSF 425
           Y+P+  G ++ +F+++GTIAAF VA +IKRVGP+ LL  ++VAF VGSIM S+ PV Q++
Sbjct: 378 YTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTY 437

Query: 426 WKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGATV 485
           WK+ FGMQ IL FGMDLSFPASSIILSD LPMEYQGMAGSLVNT++NYS SLCLGMG T 
Sbjct: 438 WKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTA 497

Query: 486 EHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKDSVIT 540
           E Q+NKNG DLLKGYR A+Y+G+GL  +GV+I+  ++ E+    R+ R + + +T
Sbjct: 498 EIQVNKNGTDLLKGYRAALYVGIGLGVVGVIIAALFLFESL---RQKRGRTAALT 549

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/530 (59%), Positives = 395/530 (74%), Gaps = 2/530 (0%)

Query: 6   EEKVNVQSKDSPVID-KISMKAEDKXXXXXXXXXXXXXASSNKSTQV-SNDSPWQDPTYF 63
           E K   + +D   I+ +++++AED                +N   +V      WQ+P YF
Sbjct: 14  EVKTAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYF 73

Query: 64  SSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFI 123
               +E +FI TCM++QLLNQ+G T  L+IMN+L+ SF S+++ ++WLMASFPLV+GSFI
Sbjct: 74  KYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFI 133

Query: 124 LISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNV 183
           LISGR+GDI+GLK ML+IGYV II+WSLICGL+KYS +D FFI  RAFQGLGIAF+LPNV
Sbjct: 134 LISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNV 193

Query: 184 MGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFYAFAIAFF 243
           +G++G+VY  G+ RKN+VISFIGA AP            I   +  QWPW FYA+ I   
Sbjct: 194 LGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAV 253

Query: 244 LNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLI 303
           +N+IL+ Y+IPNNIPTNVH FSMDW GS L VIGL+L N VWNQAP +GW  AYII LLI
Sbjct: 254 INLILSIYAIPNNIPTNVHRFSMDWIGSGLGVIGLVLLNLVWNQAPISGWNQAYIIVLLI 313

Query: 304 ISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNL 363
           ISV FLV F VYE+ +AK PLLP AV K+RHMI I+L++F GWGSFGI+TFYY  FQLN+
Sbjct: 314 ISVLFLVLFGVYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNI 373

Query: 364 RHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQ 423
           RHY+P+W GG+YF+F+I+G IAA +V  SIKRV P+  L FA+VAF+VGSIM SV PV +
Sbjct: 374 RHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHE 433

Query: 424 SFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGA 483
           +++++  G   IL FGMDLSFPASSII SD LPMEYQGMAGSLVNTV+NYS SLCLGMGA
Sbjct: 434 TYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGA 493

Query: 484 TVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDR 533
           TVE Q++ +GK +LKGYRGA YLG+GLASL  +IS  YM+E +  + R +
Sbjct: 494 TVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAK 543

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/486 (66%), Positives = 394/486 (81%)

Query: 52  SNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWL 111
            NDSP+Q+P YF +  +E+MFI++CM+AQLLNQAGQT +L+ MNVL+  F S S KQ WL
Sbjct: 68  ENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWL 127

Query: 112 MASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAF 171
           MASFPLV+GSFILISGRLGDIYGLKK L +GY+ + +WS+ICGL+KY+N+DAFFI CR+F
Sbjct: 128 MASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSF 187

Query: 172 QGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQW 231
           QGLGIAFILPN+MGLVG++YKVG+ RKN+VIS IG  APA           IV ED+EQW
Sbjct: 188 QGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPAGAALGALFGGLIVTEDAEQW 247

Query: 232 PWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTA 291
           PWVFYAF IA F+NM+LA YSIPNN+PTN++  +MDW GS+L V GL+L N VWNQAP  
Sbjct: 248 PWVFYAFGIASFVNMLLALYSIPNNVPTNLNNLNMDWIGSLLGVSGLLLLNIVWNQAPIV 307

Query: 292 GWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGI 351
           GWG AYII LLIIS+  L+ F VYE+KYA  PLLP +V +N+ ++MIL A+F GWGSFGI
Sbjct: 308 GWGEAYIIVLLIISIILLLIFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGI 367

Query: 352 WTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDV 411
           WT+YY +FQLNLR Y+P+W GGT+F+FVI+GT+AAF+VAL+IK+VGPA LLCF++VAFD 
Sbjct: 368 WTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDC 427

Query: 412 GSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVI 471
           GSIM SV PV Q++W++N GMQ IL FGMDLSFPASSIILSD LPM+YQGMAGSLVNTV+
Sbjct: 428 GSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVV 487

Query: 472 NYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRR 531
           NYS SLCLGMG TVE Q N +G DLLKGYR A+YL +GLAS GV +S  +++      R 
Sbjct: 488 NYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKRH 547

Query: 532 DRQKDS 537
            ++ +S
Sbjct: 548 RKRIES 553

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/490 (63%), Positives = 385/490 (78%)

Query: 44  SSNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNS 103
           + ++   V ++  WQ+P YF    +E +FI TCM++QLLNQAG T  L+IMN+LS SF S
Sbjct: 43  TQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGS 102

Query: 104 ESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDA 163
           E + ++WLMASFPLV+GSFILISGRLGDIYGLKKML++GYV +I+WSLICG++KYS +D 
Sbjct: 103 EGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDT 162

Query: 164 FFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXI 223
           FFI  RAFQGLGIAF+LPNV+G++G++Y  G+ RKN+VISF+GA AP            I
Sbjct: 163 FFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLI 222

Query: 224 VNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNF 283
             ED +QWPW FYA++IA F+N +L+ Y+IP+ IPTN+H FSMDW GSVL VIGLIL NF
Sbjct: 223 GTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHHFSMDWIGSVLGVIGLILLNF 282

Query: 284 VWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVF 343
           VWNQAP +GW  AYII +LIISV FLV F +YE+++AK PLLP AV K+RHMI I+LA+F
Sbjct: 283 VWNQAPISGWNQAYIIVILIISVIFLVVFIIYEIRFAKTPLLPRAVIKDRHMIQIMLALF 342

Query: 344 LGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLC 403
            GWGSFGI+TFYY  FQLN+R Y+ +W GGTYF+F+I+G IAA +V  +IK V P+  L 
Sbjct: 343 FGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLF 402

Query: 404 FALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMA 463
           F++VAF+VGSIM SV PV +++++   G   IL FGMDLSFPASSII SD LPMEYQGMA
Sbjct: 403 FSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMA 462

Query: 464 GSLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYML 523
           GSLVNTV+NYS SLCLGMGATVE Q+N +GK LLKGYRGA YLG+GLASL  +IS  YM+
Sbjct: 463 GSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMV 522

Query: 524 ETFWNNRRDR 533
           E+F   RR R
Sbjct: 523 ESFIKGRRAR 532

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/499 (61%), Positives = 383/499 (76%)

Query: 45  SNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSE 104
           S   T     S WQ+P YF +  +E +FI +CM++QLLNQA     L+IMN+++ SFNSE
Sbjct: 44  SQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSE 103

Query: 105 SDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAF 164
             K+ WL+ASFPLV+GSFILISGR+GDIYGLKK L+ GY+  I+WS+I GL+KYS++D F
Sbjct: 104 GGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTF 163

Query: 165 FITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIV 224
           FI  RAFQGL IAFILPNVMG+VG++YK  S RKN+VIS IGA AP            I 
Sbjct: 164 FIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIG 223

Query: 225 NEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFV 284
            ED +QWPW FYAFAIA   N+ ++ YSIPN++PTNVHGF+MDW GSVLAVIGLIL NFV
Sbjct: 224 TEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFV 283

Query: 285 WNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFL 344
           WNQ P  GW TAYIIALL++SVFFL  FF YEVKYA+ PLLP  VTKNRH+IMIL A+FL
Sbjct: 284 WNQGPIVGWQTAYIIALLVVSVFFLALFFTYEVKYAESPLLPVEVTKNRHIIMILAALFL 343

Query: 345 GWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCF 404
           GWGSFGI++FYY SF LNLRHYS +W G TYF+F I+GT+AA +V   IK++  AF+L  
Sbjct: 344 GWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFM 403

Query: 405 ALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAG 464
           ++VAF++G IM SV PV Q+++++N G   IL FGMD+SFPA++IILSDGL M+YQGMAG
Sbjct: 404 SMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAG 463

Query: 465 SLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLE 524
           SL NT++NYS SLCLGMG TVE QINK+G DLLKGYRGA YLG+GLA LG++I+  Y+ E
Sbjct: 464 SLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAEYLGIGLAGLGIIITAIYLGE 523

Query: 525 TFWNNRRDRQKDSVITEMS 543
             W  R+     +V+ ++S
Sbjct: 524 ILWGKRKQHLAANVVPDLS 542

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/494 (58%), Positives = 373/494 (75%)

Query: 44  SSNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNS 103
           + +  + +SN+S WQDPTYF S  +E  FI TCMLA LLNQAGQT  L+ MNVL+ S NS
Sbjct: 48  TDDDVSSISNNSKWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNS 107

Query: 104 ESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDA 163
           +   + WLMASF L +GSFIL+SGR+GDIYGLK   + G +   +WS++CG+SKY+ N  
Sbjct: 108 DGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVT 167

Query: 164 FFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXI 223
           FFI CRAFQGLG+AF+LPNVMGLVG++Y VGS RKN+VISFIG  AP            I
Sbjct: 168 FFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLI 227

Query: 224 VNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNF 283
           V+ + +QWPW+F+A AIA F+N+I+  YSIPN++PTN++   MDW GS+L VIGLIL NF
Sbjct: 228 VDSNKDQWPWIFFATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWIGSLLGVIGLILMNF 287

Query: 284 VWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVF 343
           VWNQAP +GW  AYII +LI++VFFLVAFF+YE+K A+ PLLP  VTKNRH++ I++++F
Sbjct: 288 VWNQAPISGWSKAYIIVILIVAVFFLVAFFIYELKKAESPLLPPEVTKNRHIVTIIISLF 347

Query: 344 LGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLC 403
           LGWG+FGIWTFYY +F LNLRH+SP+W G T+FVF+IFG++ A  VA +I +VGP+ L C
Sbjct: 348 LGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFC 407

Query: 404 FALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMA 463
            + + F  G+I+FSV    Q++W+ + GMQ IL  GMDLSFP SSIILSD LPM+YQGM+
Sbjct: 408 LSSIGFTCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMS 467

Query: 464 GSLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYML 523
           GSLVNT+ NY+ SLCLGMG T E Q N  GKD+LKGYR A+Y+ +GL +LG   SF+YM 
Sbjct: 468 GSLVNTITNYATSLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMA 527

Query: 524 ETFWNNRRDRQKDS 537
           E  W   R R+++ 
Sbjct: 528 EDLWIRYRKRRQNE 541

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/487 (63%), Positives = 380/487 (78%)

Query: 47  KSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESD 106
           +   V  +  WQ+P YF    +E +FI TCM++QLLNQAG T  L+IMN+LS SF SE +
Sbjct: 49  EDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGN 108

Query: 107 KQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFI 166
            ++WLMASFPLV+GSFILISGRLGDIYGLKKML++GYV +I+WSLICG++ YS +D FFI
Sbjct: 109 SKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFI 168

Query: 167 TCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNE 226
            CRAFQGLGIAF+LPNV+G++G++Y  G+ RKN+VISF+GA AP            I  E
Sbjct: 169 ICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTE 228

Query: 227 DSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWN 286
           +  QWPW FYAF+IA  +N  L+ Y+IPNNIPTN+H FSMDW GSVL VIGLIL NFVWN
Sbjct: 229 NPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSVLGVIGLILLNFVWN 288

Query: 287 QAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGW 346
           QAP +GW  AYII +LIISV FL  F +YE+ +AK PLLPHAV K+ HMI I+LA+F GW
Sbjct: 289 QAPISGWSQAYIIVILIISVIFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGW 348

Query: 347 GSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFAL 406
           GSFGI+TFYY  FQLN+RHY+ +W GGTYF+F+I+G IAA +V  +IK V P+  L F++
Sbjct: 349 GSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSM 408

Query: 407 VAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSL 466
           VAF+VGSIM SV PV +++++   G   IL FGMDLSFPASSII SD LPMEYQGMAGSL
Sbjct: 409 VAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSL 468

Query: 467 VNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETF 526
           VNTV+NYS SLCLGMGATVE Q++ +GK LLKGYRGA YLG+GLASL  +IS  YM+E+F
Sbjct: 469 VNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESF 528

Query: 527 WNNRRDR 533
            N+ + +
Sbjct: 529 INDHKAK 535

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/535 (57%), Positives = 386/535 (72%), Gaps = 4/535 (0%)

Query: 5   IEEKVNVQS----KDSPVIDKISMKAEDKXXXXXXXXXXXXXASSNKSTQVSNDSPWQDP 60
           + EK  V+S    +DS   +  S+ A  K             ++ +      +   WQ+P
Sbjct: 1   MNEKSLVKSAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNP 60

Query: 61  TYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAG 120
            YF +   E +FI TCM++QLLNQAG T  L+IMN+++ SF S  + + WLMASFPLV+G
Sbjct: 61  NYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSG 120

Query: 121 SFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFIL 180
           SFILISGRLGDIYGLKKML IGYV II+WSLICGL+KYS +D FFI  RAFQGLGIAF+L
Sbjct: 121 SFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVL 180

Query: 181 PNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFYAFAI 240
           PNV+G++G++Y  G+ RKN+VIS +GA AP            I  ++ +QWPW FYA+ I
Sbjct: 181 PNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTI 240

Query: 241 AFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIA 300
              +N+ L+ YSIPNNIPTN+  FSMDW GS L VIGL+L NFVWNQAP +GW  AYII 
Sbjct: 241 TSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIV 300

Query: 301 LLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQ 360
           LL+ISV FLV F +YE ++AK PLLP AV K+RHMI I+LA+F GWGSFGI+TFYY  FQ
Sbjct: 301 LLVISVVFLVVFIIYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQ 360

Query: 361 LNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLP 420
           LN+RHYS VW GGTYF+F+I+G IAA +V + IK+V P+  L  +++AF++GSIM SV P
Sbjct: 361 LNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTP 420

Query: 421 VKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLG 480
           V +++++   G   IL FGMD SFPASSII SD LPMEYQGMAGSLVNTV+NYS SLCLG
Sbjct: 421 VHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLG 480

Query: 481 MGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQK 535
           MGATVE  ++ +GK +LKGYRGA YLG+GLASL  +IS  YM+E    + + + +
Sbjct: 481 MGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKAR 535

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/504 (59%), Positives = 384/504 (76%), Gaps = 3/504 (0%)

Query: 43  ASSNKSTQVSNDSP---WQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSK 99
           + +  ST V+   P   WQD TYF +  +E +F+ TCM++QLLNQA     L++MN+L+K
Sbjct: 39  SGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTK 98

Query: 100 SFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYS 159
           SF+S +  Q WLMASFPLV+GSFILISGR+GDIYGLK  L+ G +  I+W+LI G + Y+
Sbjct: 99  SFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYT 158

Query: 160 NNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXX 219
           ++D FFI  R+FQGLG+AFILPNVMG VG++YK  + RKN+VIS IGACAP         
Sbjct: 159 HSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFF 218

Query: 220 XXXIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLI 279
              I  ++ + WPW FYA AIA  L ++ A YSIPN+IPTNVHGFSMDW GS LAV+GLI
Sbjct: 219 AGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSGLAVVGLI 278

Query: 280 LFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMIL 339
           L NFVWNQ P  GWG AYII LLI+SVF L  FF+YEV YA  PLLP  +T+NRHM+MIL
Sbjct: 279 LLNFVWNQGPIDGWGKAYIIVLLIVSVFVLTLFFIYEVHYAASPLLPRVITQNRHMVMIL 338

Query: 340 LAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPA 399
           +A+FLGWGSFGI++FYY +F LNLRHYS VW GGTYF+F I+G +A+ +V LSI+++  +
Sbjct: 339 MALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISAS 398

Query: 400 FLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEY 459
            +L F+++AFDVG IM SV PVKQ+++++N G   IL FGMD+SFPA++IILSD LP +Y
Sbjct: 399 IILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQY 458

Query: 460 QGMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISF 519
           QGMAGSL NT++NYS SLCLGMG+TVE QIN+NGKDLLKGYR A YLG+G+ASL V++S 
Sbjct: 459 QGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSL 518

Query: 520 TYMLETFWNNRRDRQKDSVITEMS 543
            YM E  W +R++R + +  T +S
Sbjct: 519 IYMCERLWIDRKERMESTSETNLS 542

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/499 (60%), Positives = 381/499 (76%), Gaps = 5/499 (1%)

Query: 43  ASSNKSTQ-----VSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVL 97
           +SS K T      + N +PWQ+  YF S  +E  FI TCM A LLNQAGQT  L+ MNV+
Sbjct: 9   SSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVI 68

Query: 98  SKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSK 157
           S+SF+S+   Q WLMASFPLV+GSFILISGR+GDIYGLKK ++ GY+ +I+W+L+CG + 
Sbjct: 69  SESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFAD 128

Query: 158 YSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXX 217
           Y+++D FFI CRAFQGLGI+FILPN+MGLVG++YKVG+ RKN+VIS IG  AP       
Sbjct: 129 YTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGA 188

Query: 218 XXXXXIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIG 277
                I  E S QWPW+FYA+A+A F+N+I+A YS+P N+PTNVH F+MDW G+++ V+G
Sbjct: 189 LWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGVVG 248

Query: 278 LILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIM 337
           LILFNFVWNQ P  GW   YII LLIIS+ FLVAF +YE+K+   PLLP  VTKN  ++ 
Sbjct: 249 LILFNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREVTKNGQILT 308

Query: 338 ILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVG 397
           IL  +FLGWGSFGIWTFYY +FQLNLR+YSP+W G T+F+F+I+G+IAAF+V  +I RVG
Sbjct: 309 ILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVG 368

Query: 398 PAFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPM 457
           PA LL F+ + F +GS+M SV P+ Q++W++N GMQ IL FGMDLSFPASSIILSD LPM
Sbjct: 369 PAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPM 428

Query: 458 EYQGMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLI 517
           +YQGMAGSLVNT+INYS SLCLGMG TVE QINK G++LL+GYR A+YL VGL  LG  +
Sbjct: 429 QYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAVGLGGLGACV 488

Query: 518 SFTYMLETFWNNRRDRQKD 536
           +F  +    W  R+ R  D
Sbjct: 489 AFLNLCYDLWRKRKSRLDD 507

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/540 (57%), Positives = 396/540 (73%), Gaps = 3/540 (0%)

Query: 4   VIEEKVNVQSKDSPVIDKISMKAEDKXXXXXXXXXXXXXASSNKSTQVSNDSPWQDPTYF 63
           V EEK   QS  S + ++ S   +++             +S  +   + + S WQ+P YF
Sbjct: 13  VEEEKEITQSTSSIIEEECSSITKEENNEVSEDELP---SSEQEDNTIGDHSKWQNPDYF 69

Query: 64  SSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFI 123
            +  +E +FI +CM++QLLNQA     L+IMN+++ SF SE  K+ WL+ASFPLV+GSFI
Sbjct: 70  QNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFI 129

Query: 124 LISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNV 183
           LISGR+GDIYGLKK L+ GY+  I+WSLI G + YS+ND FFI  RAFQGLGIAFILPNV
Sbjct: 130 LISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNV 189

Query: 184 MGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFYAFAIAFF 243
           MG+VG++YK  + RKN+VIS IGA AP            I  E+ +QWPW FYAFAIA  
Sbjct: 190 MGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFAIASA 249

Query: 244 LNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLI 303
           +N+ ++ YSIPNNIPTN+HGF+MDW GS++AVIGLIL NFVWNQ P  GW  AYII LLI
Sbjct: 250 INLAISIYSIPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLI 309

Query: 304 ISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNL 363
           IS+  LV FF YE+KYAK P+LP  VTKNRH+IMIL A+FLGWGSFGI++FYY SF LNL
Sbjct: 310 ISIIALVLFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNL 369

Query: 364 RHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQ 423
           RHYS +W G TYF+F I+GT+AA +V   IKR+  + +L F+++AF++G IM SV PV Q
Sbjct: 370 RHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQ 429

Query: 424 SFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGA 483
           +++++N G   IL FGMD+SFPA++IILSDGL M+YQGMAGSL NT++NYS SLCLGMG 
Sbjct: 430 TYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGT 489

Query: 484 TVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKDSVITEMS 543
           TVE QINK+GK++LKGYR A YLGVGLA LG++IS  YM E  W  R++R   +   +MS
Sbjct: 490 TVERQINKSGKEILKGYRAAEYLGVGLAGLGIVISGIYMAEVLWAKRKERLSSNRDHDMS 549

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/498 (59%), Positives = 374/498 (75%), Gaps = 5/498 (1%)

Query: 44  SSNKSTQVSNDSPW---QDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKS 100
           + +   QV +D  W   QDPTYFS+  +E +FI   M++QLLNQAG T  L+++N+LSK+
Sbjct: 26  TEHSDVQV-DDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKN 84

Query: 101 FNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSN 160
           F+S + +Q WLMASFPLV+GSFIL+SG++GDIYGLKK L++GYV  I+WSLICGL+ Y++
Sbjct: 85  FDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTS 144

Query: 161 NDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXX 220
           +  FFI  RAFQGLGIAFILPN+MG+VG++Y  G+TRKN+VIS IGACAP          
Sbjct: 145 SVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAP-IGATMGVLF 203

Query: 221 XXIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLIL 280
             ++   SE+W W FYA+ I   +NM L+ + IPN IPTNV G SMDW GS + ++G+IL
Sbjct: 204 SGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMDWIGSGIGLLGMIL 263

Query: 281 FNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILL 340
           FNFVWNQ P  GW TAYII LLI+SV  +VAFF+YE KYA  PL+P     N  ++M LL
Sbjct: 264 FNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETKYANDPLIPRPAMHNHRLLMTLL 323

Query: 341 AVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAF 400
           AVF GWGSFGIWTFYY  F LNLR Y+P+W GG+YF+F+I+G IAA  V  +IKR+ P+ 
Sbjct: 324 AVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSL 383

Query: 401 LLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQ 460
           +L  +++AFD G IM SV PV Q+++++  GM  IL FGMDLSFPASSIILSD LPME Q
Sbjct: 384 ILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQ 443

Query: 461 GMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFT 520
           GMAGSLV+T+INYS S+CLG+  TVEHQINKNG DLLKGYR A+YLG+GLASLGV IS  
Sbjct: 444 GMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLGIGLASLGVFISAL 503

Query: 521 YMLETFWNNRRDRQKDSV 538
           +MLE +   RR   K+ V
Sbjct: 504 FMLENYLRMRRRNVKEEV 521

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/485 (58%), Positives = 364/485 (75%)

Query: 54  DSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMA 113
           +SPWQDP YF     E++F+++CM+ QLLNQAG T  L+ M VL +  +S S K +WLMA
Sbjct: 48  ESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDSSSAKSSWLMA 107

Query: 114 SFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQG 173
           SFPLV+GSFILISGRLGDIYGLKKML++GY+ + +WSLICGLS +S+ND FFIT RAFQG
Sbjct: 108 SFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQG 167

Query: 174 LGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPW 233
           LGI+F+LPN++G+VG++YK G+ RKN+VIS IG CAP            +V      WPW
Sbjct: 168 LGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPW 227

Query: 234 VFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGW 293
            FYA+ IA FL  I++++ IPN+IP NV+ F+MDW GS L V GL+LFNFVWNQ+   GW
Sbjct: 228 AFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGW 287

Query: 294 GTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWT 353
            T YIIALLI+S+F +  FF++E+KYAKVPLLP  VT++R +IMIL ++  GWGSFGIW 
Sbjct: 288 ATGYIIALLIVSIFLIALFFIFEIKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWI 347

Query: 354 FYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGS 413
           FYY  F L LR+YSPVW GGT+F+  I G IAA  V  SIKRVGPA LL F+++AF  GS
Sbjct: 348 FYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGS 407

Query: 414 IMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINY 473
           I+ SV PV +++++   G   IL FGMDLSFPA+SIILSD L M+YQGMAGSLVNTV+NY
Sbjct: 408 IILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNY 467

Query: 474 SASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDR 533
           S SL LG+G T+E QINK+G  LL+G+R A+Y  +G+ SLG+LIS  ++L+      + R
Sbjct: 468 SMSLFLGIGGTIERQINKSGDRLLEGFRAALYFAIGVGSLGILISGVFVLQKELMRSKSR 527

Query: 534 QKDSV 538
           +++ +
Sbjct: 528 KENEL 532

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/478 (57%), Positives = 359/478 (75%)

Query: 58  QDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPL 117
           Q P YFSS   E  FI TC++ QLLNQAG T +++IMN++++ F SE+ KQAWL ASFPL
Sbjct: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125

Query: 118 VAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIA 177
           V+GSFIL+ GR GDIYGLKKML++GY  + +WS+ICGL+ Y+++D FFI  +AFQGLG++
Sbjct: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185

Query: 178 FILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFYA 237
           FILPN++GLVG +Y+ GS +KN+ ISFIGA AP            +V +D + WPW FYA
Sbjct: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245

Query: 238 FAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAY 297
           FAI  FL  +  ++ +P+N+PTN +   MDW GS + V+GL+LF+FVWNQAP  GW  AY
Sbjct: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAY 305

Query: 298 IIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYM 357
           II LL+ISV  ++AFF+YE+ YA+VPLLP A+T NRH+IMILLA+F+GWG+FGIW+FYY 
Sbjct: 306 IIVLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365

Query: 358 SFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFS 417
           SF LNLRH+SPVWTGG YF F++ G   A  V   IK + P+ +L  ++  F +G+++F+
Sbjct: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFA 425

Query: 418 VLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASL 477
           V P  Q++W+  FGM  +L  GMDLSFPASSIILSD LP EYQGMAGSLVNT++NYS S 
Sbjct: 426 VTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485

Query: 478 CLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQK 535
           CLG+  TVE QIN +G DLLKGYR A Y GVG+ +LG+ I+  YM ETFW + +++ K
Sbjct: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTK 543

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/489 (57%), Positives = 370/489 (75%), Gaps = 1/489 (0%)

Query: 45  SNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSE 104
             ++  +   S  Q+P YF    +E +F+++ ML+QLLNQA  T    + +VLSK  N++
Sbjct: 26  DGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAK 85

Query: 105 SDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAF 164
             +Q WLMASFPLV+GSFIL+SG++GDIYGLKK L+ GYV +++WSLICGLS Y++N  F
Sbjct: 86  VSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDF 145

Query: 165 FITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIV 224
           F+  R+FQGLGIAF+LPNVMG+VG++YK  +  KNLV S IGACAP            ++
Sbjct: 146 FVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAP-IGATLGCVFSGLI 204

Query: 225 NEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFV 284
              ++ W W FYA+AI   LN ++A + IPNNIPTNV+ + MDW GS + V GLILFNFV
Sbjct: 205 GARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFV 264

Query: 285 WNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFL 344
           WNQAP AGWG+AYII LLI++V  L+AF  YE+++AK PLLPH+V  NR ++MIL ++F 
Sbjct: 265 WNQAPIAGWGSAYIIVLLIVAVVALIAFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFF 324

Query: 345 GWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCF 404
           GWGSFGIWTFYYMSF LNLRHYSP+W GGTYF+F I+G +A+ +V  +I + GPA +L  
Sbjct: 325 GWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFL 384

Query: 405 ALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAG 464
           ++VAFD G IM +V PV Q+++++  G+  IL FGMDLSFPA+SIILSD LP +YQGMAG
Sbjct: 385 SMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAG 444

Query: 465 SLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLE 524
           SLV+T+I+YS SLCLG+  T EHQ+NKNG DLLKGY+ A+Y+G+GLASLGV+IS  +M+E
Sbjct: 445 SLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGVVISGAFMIE 504

Query: 525 TFWNNRRDR 533
            +W +RR R
Sbjct: 505 DWWTSRRKR 513

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/497 (56%), Positives = 359/497 (72%), Gaps = 5/497 (1%)

Query: 45  SNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSE 104
           S  +      S +Q+P YF +  +E  FI + M+ QLL+QAG T  L+IMNVL+K  +S 
Sbjct: 50  STDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDST 109

Query: 105 SDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAF 164
           S +QAWLM+SFPL  GSFIL+SGRLGDIYGLKK+L+ GY+   VWS+ICGLS Y++NDAF
Sbjct: 110 SSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAF 169

Query: 165 FITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIV 224
           FIT RAFQGLG+AF LPN++GL+G +Y+ G  RKN++IS IGA +P             V
Sbjct: 170 FITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATLGGLFAGLTV 229

Query: 225 NEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFV 284
             D   WPW FYAF +  F+N+I++WY IPN+IPTN+HG  MDW GSVL V GLI+ NFV
Sbjct: 230 KYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFV 289

Query: 285 WNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFL 344
           +NQAP  GW +AYII LL++S   LV F VYEVKYAK PL+P A++ NR M+MIL ++F 
Sbjct: 290 FNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFC 349

Query: 345 GWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCF 404
           GWGSFGIWTFYY SF+LNLRHYSP+W G +YF+FVI G+  A +  L+IK++ P+ L C 
Sbjct: 350 GWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCC 409

Query: 405 ALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAG 464
           +++ F  G+I+F+  PV Q+F++   G   +L  GMD SFPASSIILSD LPM+YQGMAG
Sbjct: 410 SMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAG 469

Query: 465 SLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLE 524
           SLVNTVINYS S+CLGM  TVE + N +GKDLL GYR AIY  +GLA L V +S  YM+E
Sbjct: 470 SLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIE 529

Query: 525 TFWNNR-----RDRQKD 536
             W +R      ++Q D
Sbjct: 530 CLWKDRVLSLEENKQTD 546

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/483 (58%), Positives = 368/483 (76%), Gaps = 1/483 (0%)

Query: 51  VSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAW 110
           +++ S  Q+P YF    +E +F+++ ML+QLLNQA    A  + ++LS+   +++ +QAW
Sbjct: 32  LASRSRLQNPDYFDKQWKEYLFVISSMLSQLLNQAAALQANPLFDLLSEDLKAKASQQAW 91

Query: 111 LMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRA 170
           LMASFPLV+GSFIL+SG++GDIYGLKK L+ GY  +++WSLICGLS Y++N  FFI  R+
Sbjct: 92  LMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARS 151

Query: 171 FQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQ 230
           FQGLGIAF+LPNV G+VG++YK  +  KN+V S IGACAP            ++  +SE 
Sbjct: 152 FQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAP-IGATLGCLFSGLIGTESEA 210

Query: 231 WPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPT 290
           W W FYA+ I   LN ++AWY IP+NIPTNVH F MDW GS L V GLI+FNFVWNQAPT
Sbjct: 211 WAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLGVCGLIMFNFVWNQAPT 270

Query: 291 AGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFG 350
            GW +AYII LL+ISV  L+ F ++E ++AK PLLP AV  NR ++MIL ++FLGWGSFG
Sbjct: 271 DGWDSAYIIVLLVISVILLLIFIIFEARFAKEPLLPRAVLFNRKLMMILASLFLGWGSFG 330

Query: 351 IWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFD 410
           IWT+YYM+F LNLRHY+P+W GG+YF+F IFGTIAAF+V  +I + GPA +L  +++AFD
Sbjct: 331 IWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAIILLASVIAFD 390

Query: 411 VGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTV 470
           VG IM SV PV Q++++++ G   IL FGMDLSFPASSIILSD LP +YQGMAGSLVNT+
Sbjct: 391 VGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGSLVNTM 450

Query: 471 INYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNR 530
           INYS SLCLG+  T E Q+NK+G DLLKGYR A+Y+G+GLAS+G+ +S  Y +E +W  R
Sbjct: 451 INYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSGAYAIEDWWTRR 510

Query: 531 RDR 533
           R+R
Sbjct: 511 RER 513

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/484 (57%), Positives = 361/484 (74%)

Query: 54  DSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMA 113
           +S  ++P YF+S  +E  FI +CML+QLLN AG T  L+IMNVL++  +S    + WL+A
Sbjct: 39  NSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVA 98

Query: 114 SFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQG 173
           SFPLV+GSFIL+SGRLGDIYGLKKML++GYV +++WSLI GLS YS++  FFI  RAFQG
Sbjct: 99  SFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQG 158

Query: 174 LGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPW 233
           LGI+ +LPNV+GL+G +YK G+ +KN+VIS +GA +P            +  E    WPW
Sbjct: 159 LGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPW 218

Query: 234 VFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGW 293
            FYA+ +A F+N  +++YSIPNNIPTNV+  SMDW GS   V+GLILFNFVWNQAP  GW
Sbjct: 219 AFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGW 278

Query: 294 GTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWT 353
            +AY+I LL+ISV  L+AF +YE++YA+ PLLP  + +NR +IMIL A+  GWGSFGIWT
Sbjct: 279 NSAYLIVLLVISVIALIAFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWT 338

Query: 354 FYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGS 413
           FYY SF LNLR+YSP+W GG+YF+FVI GTI A      +K++ PA LL F++V F++G 
Sbjct: 339 FYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGC 398

Query: 414 IMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINY 473
           I+FSV PV Q++++   G   IL  GMDLSFPASSIILSD LP ++QGMAGSLVNTVINY
Sbjct: 399 IIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINY 458

Query: 474 SASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDR 533
           S SL LG+  TVE   NKNG DLL+GYRGA+Y G+  + + VLI+  YM+ET +++ +DR
Sbjct: 459 SNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDR 518

Query: 534 QKDS 537
           ++  
Sbjct: 519 KEKD 522

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/498 (55%), Positives = 372/498 (74%), Gaps = 2/498 (0%)

Query: 47  KSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESD 106
            +  +  +  WQ+P YF S  +E +F+ +C ++QLLNQAG      IMN+++ S +S++ 
Sbjct: 40  DTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNG 99

Query: 107 KQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFI 166
           KQAWLMA+FPL++GSFILISGR+GDIYGLKK L++GY+ +IVWSLICGL+KY+++D+FFI
Sbjct: 100 KQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFI 159

Query: 167 TCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNE 226
             RAFQGLGI+ ILPN++G+VG +Y  GS RKN+VIS IG  AP            I  E
Sbjct: 160 VSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTE 219

Query: 227 DSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWN 286
           D+ QWPW FY++AI   +N +L+ + IPN IPTNVHG  MDW GS L V+GLI+ NFVWN
Sbjct: 220 DANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWN 279

Query: 287 QAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAK-VPLLPHAVTKNRHMIMILLAVFLG 345
           QAP  GW +AY+I LLIISV  L+AFF+YE+ +    PLLP  V K+   I++L A+F G
Sbjct: 280 QAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALFFG 339

Query: 346 WGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFA 405
           WGSFGI++FYY +FQLNLRHY+P+W GGTYF+F+I+G +AA +V  +IK+V P+ +L  +
Sbjct: 340 WGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLS 399

Query: 406 LVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGS 465
           +VAF+ GSI+ SV P+ Q++++ + GM  IL FGMDLSFPASSI+LSD LP++YQGMAGS
Sbjct: 400 MVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGS 459

Query: 466 LVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLET 525
           LVNT++NYS S CLG+   VE  +N +GKD+LKGYRGA YLG+GLAS+  +IS   ML  
Sbjct: 460 LVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACIISGALMLSE 519

Query: 526 FWNNRRDRQKDSVITEMS 543
               R++ +KDS + E++
Sbjct: 520 IIQGRKN-EKDSAVVEIA 536

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/464 (59%), Positives = 340/464 (73%), Gaps = 2/464 (0%)

Query: 44  SSNKSTQV--SNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSF 101
           SSN+  +V     S WQDP YF +  +E +F+ +CM  QLLNQA     L+IMNVLS SF
Sbjct: 22  SSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDSF 81

Query: 102 NSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNN 161
           NS    Q WL+ASFPLVAGSFILISGR+GDIYGLKK L+ GY+ +I+WSLICG + YS +
Sbjct: 82  NSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKS 141

Query: 162 DAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXX 221
           D F I  RAFQGLGIAF LPNV+G +G++Y VGS RKN+VIS I A AP           
Sbjct: 142 DTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVGAAIGGAFAG 201

Query: 222 XIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILF 281
            IV E   QWPW FYAFAIA   N++++ YSIP+NIPTNV+GF MDW GS L V GLILF
Sbjct: 202 LIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIGSALIVTGLILF 261

Query: 282 NFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLA 341
           NF WNQ P  GW  AYII LLIISV F++AF  YE+ +A  PL+   +T +R+MI+ +  
Sbjct: 262 NFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAPSPLIAREITHSRNMIITIFT 321

Query: 342 VFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFL 401
           +FLGWGS+GIW+FYY SF LNLRHYSPVW GG+YF+F IFG +A+  V +SIK++    +
Sbjct: 322 LFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISIKKITAPVI 381

Query: 402 LCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQG 461
           L F++V F VG+ + SV PV QS++KL     AIL  G+D SFPA++IILSDGLPMEYQG
Sbjct: 382 LLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSDGLPMEYQG 441

Query: 462 MAGSLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIY 505
           MAGSL  T++NYS SLCLGMG TVE QINK+G+D+LKGYR A Y
Sbjct: 442 MAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEY 485

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/492 (52%), Positives = 349/492 (70%), Gaps = 3/492 (0%)

Query: 47  KSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESD 106
            S  + +++    P YF +   E +FI++CM++Q ++QAG T AL+IMN+L++  N+E  
Sbjct: 76  NSENLQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKS 135

Query: 107 KQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFI 166
           +QAWLMASF L  GSFIL+SGRLGDIYGLKK+L+ GY  + +WSLICG S YS+NDAFFI
Sbjct: 136 RQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFI 195

Query: 167 TCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNE 226
           T RAFQGLG+AF+LPN +GL+G +Y+ GS +KN++I  +GA +P            I  +
Sbjct: 196 TSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTK 255

Query: 227 DSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWN 286
           D +QWPW FY+F I  F NMIL+WYSIPNNIPTN++  SMDW G++L + GL++ NFV+N
Sbjct: 256 DPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWIGAILGIFGLLILNFVFN 315

Query: 287 QAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGW 346
           QAP  GW +AYII LL++S   LV F VYEVKYAK PL+P A++ NR M+MIL A+F GW
Sbjct: 316 QAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGW 375

Query: 347 GSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFAL 406
           G+FG WTFYY SF LN+R Y+  W GG+YF+F++ G   A +    +K+V P+ +L  ++
Sbjct: 376 GAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISM 435

Query: 407 VAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSL 466
           + F  G +M +V P+ QS+++   G+  +L  G+DLSFPA+SIILSD LP++YQGMAGSL
Sbjct: 436 IGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSL 495

Query: 467 VNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYM---L 523
           V T+ NYS S+CLGM  +VE   N NG+++LKGYR A+     LA LG+++S  YM   L
Sbjct: 496 VYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINL 555

Query: 524 ETFWNNRRDRQK 535
            T   N +   K
Sbjct: 556 ITIRENSKSTNK 567

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  439 bits (1129), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 212/487 (43%), Positives = 313/487 (64%)

Query: 51  VSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAW 110
           ++     + P  F +  +E  F++  ++ Q L+Q G T  L+ MN+L++  ++   +Q W
Sbjct: 104 ITESQNLRRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQVLSTMNILAEELHTTKMRQPW 163

Query: 111 LMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRA 170
           LMA+FPL  G  ILISGRLGDI+GLKK+L++GY+   +W+LICG S Y+++D  FI  R 
Sbjct: 164 LMAAFPLGLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLICGFSSYAHSDDLFIVSRT 223

Query: 171 FQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQ 230
           FQGLG+A  LPN+  L+G +YK    +KN++   IGA +P             V  + + 
Sbjct: 224 FQGLGLACALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKN 283

Query: 231 WPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPT 290
           WPW FY+FAI  FLN I+AW+ IPN+I  N  G  MDW GS L + GL++ NFV+NQ P 
Sbjct: 284 WPWSFYSFAIVAFLNGIIAWFCIPNDIEKNPQGLKMDWIGSALGLFGLVVLNFVFNQTPI 343

Query: 291 AGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFG 350
            GW +AY+I LL++SV  L+ F +YE+  A  PL+P  +  N  +I+ILL +F GWG F 
Sbjct: 344 DGWSSAYLIVLLVVSVVALILFVIYELTMANFPLIPKGIHSNYRLILILLTLFCGWGGFA 403

Query: 351 IWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFD 410
           IWTFYY +FQLNLRHYSP+W   + FV +I GTI   +  L+++R+ P  LL F+++ F 
Sbjct: 404 IWTFYYFAFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAVQRMKPPILLFFSMLGFL 463

Query: 411 VGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTV 470
            G+I+F+V P+ Q+F++  FG   +   GM  SFP++S++ ++ LP  Y+ MAGSLVN  
Sbjct: 464 GGNILFAVTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLPTHYKSMAGSLVNVA 523

Query: 471 INYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNR 530
           INY+ S+C+GM  +     N +G+DLL G+R A YL +GL+   V +S  YM+ + W +R
Sbjct: 524 INYATSICVGMAGSANVNHNNHGQDLLHGFRAASYLAIGLSGFSVFLSGLYMIGSIWTDR 583

Query: 531 RDRQKDS 537
             + K++
Sbjct: 584 NQKMKEN 590

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  343 bits (881), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 190/480 (39%), Positives = 275/480 (57%), Gaps = 13/480 (2%)

Query: 69  ELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQ-AWLMASFPLVAGSFILISG 127
           E  F+     AQL+ QAG   +L  ++++  SF + +  Q +W  +++ L  G+FILI+G
Sbjct: 43  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAG 102

Query: 128 RLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLV 187
           RLGDI+G KK  ++G+    +WSL+ G S YSN   FF  CRAFQG+G AF+LPN + ++
Sbjct: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQ-IFFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 188 GHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFYAFAIAFFLNMI 247
           G  YK G  RKN+V S  GA AP            +       WPW ++   IA FL  +
Sbjct: 162 GRTYKPGR-RKNMVFSLFGASAPGGFVLGAVFSSML--GQLAWWPWAYWLMGIACFLLAV 218

Query: 248 LAWYSIPNNIPTN--VHGFSM----DWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIAL 301
             +Y IP+    N  V  F +    D+ GSV  V+GLILFNF WNQ P  GW T Y  AL
Sbjct: 219 AGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 278

Query: 302 LIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQL 361
           LI+   FL+ F   E + A  PLLP A   +     +L  +  GW SFGIW FY   F  
Sbjct: 279 LIVGTVFLIIFAFIESR-AAFPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFME 336

Query: 362 NLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPV 421
           + R  +P+ +   +    I G  AA M    +    P+ ++ FA+ AF VG+I+ +  PV
Sbjct: 337 DSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPV 396

Query: 422 KQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGM 481
            Q++W   F    ++ +GMD+SFPA++I+LSD +P E+QG+A SLVNTV+NYS S+ LG+
Sbjct: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 456

Query: 482 GATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKDSVITE 541
             T+E  +N  G ++LKGYR + YLG+GL+  G+ ++ TY + TF  +++   +     E
Sbjct: 457 AGTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKRVSEKQHFIE 516

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  341 bits (875), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 187/480 (38%), Positives = 270/480 (56%), Gaps = 13/480 (2%)

Query: 69  ELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQ-AWLMASFPLVAGSFILISG 127
           E  F+     AQL+ QAG   +L  ++++ KSF + +  Q +W  +++ L  G+FILI+G
Sbjct: 43  ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAG 102

Query: 128 RLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLV 187
           RLGDI+G KK  ++G+    +WSL+ G S YSN   FF  CRAFQG+G AF+LPN + ++
Sbjct: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNK-IFFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 188 GHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFYAFAIAFFLNMI 247
           G  YK G  RKN+V S  GACAP            +       WPW ++   IA F   I
Sbjct: 162 GRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLL--GQLAWWPWAYWIMGIACFFLAI 218

Query: 248 LAWYSIPNNIPTNVHGFS------MDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIAL 301
             ++ IP+    + H  S      +D+ GSV  VIGLILFNF WNQ P  GW T Y   L
Sbjct: 219 AGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYIL 278

Query: 302 LIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQL 361
           LI+   FL  F   E + A  PLLP A   +     +L  +  GW SFGIW FY   F  
Sbjct: 279 LIVGTVFLAIFAFIESR-AAFPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFME 336

Query: 362 NLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPV 421
           + R  +P+ +   +    + G  AA      + R  P+ ++ FA+ AF  G+I+ +  PV
Sbjct: 337 DSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPV 396

Query: 422 KQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGM 481
            Q++W   F    ++ +GMD+SFPA++I+LSD +P E+QG+A SLVNTV+NYS S+ LG+
Sbjct: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 456

Query: 482 GATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKDSVITE 541
             T+E  +N  G   LKGYR + Y+G+GL+ LG+ ++  Y   TF  +++   +     E
Sbjct: 457 AGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIYAWSTFKKSKKRTSEKQHFIE 516

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  340 bits (871), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/480 (39%), Positives = 276/480 (57%), Gaps = 13/480 (2%)

Query: 69  ELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQ-AWLMASFPLVAGSFILISG 127
           E  F+     AQL+ QAG   +L  ++++  SF + +  Q +W  +++ L  G+FILI+G
Sbjct: 42  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAG 101

Query: 128 RLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLV 187
           RLGDI+G KK  ++G+    +WSL+ G S YSN   FF  CRAFQG+G AF+LPN + ++
Sbjct: 102 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQ-IFFDCCRAFQGMGPAFLLPNAIAIL 160

Query: 188 GHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFYAFAIAFFLNMI 247
           G  YK G  RKN+V S  GA AP            +       WPW ++   IA F+  +
Sbjct: 161 GRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSML--GQLAWWPWAYWIMGIACFVLAV 217

Query: 248 LAWYSIPNN-IPT-NVHGFSM----DWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIAL 301
             ++ IP+  +P+ +   F +    D+ GSV  V+GLILFNF WNQ P  GW T Y  AL
Sbjct: 218 AGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 277

Query: 302 LIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQL 361
           LI+  FFLV F   E + A  PLLP A   +     +L  +  GW SFGIW FY   F  
Sbjct: 278 LIVGTFFLVIFAYIESR-AAFPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFME 335

Query: 362 NLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPV 421
           + R  +P+ +   +    I G  AA      +    P+ ++ FA+ AF VG+I+ +  PV
Sbjct: 336 DSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPV 395

Query: 422 KQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGM 481
            Q++W   F    ++ +GMD+SFPA++I+LSD +P E+QG+A SLVNTV+NYS S+ LG+
Sbjct: 396 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 455

Query: 482 GATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKDSVITE 541
             T+E ++N  G   LKGYR + Y+G+GL+ LG+ ++ TY   TF  +++   +     E
Sbjct: 456 AGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKKRISEKQHFIE 515

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  338 bits (867), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 191/469 (40%), Positives = 270/469 (57%), Gaps = 12/469 (2%)

Query: 69  ELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQ-AWLMASFPLVAGSFILISG 127
           E  F+     AQL+ QAG   ++  ++++  SF + +  Q +W  A++ L  G+FILI+G
Sbjct: 45  EAAFVGVICGAQLMTQAGLGQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAG 104

Query: 128 RLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLV 187
           RLGD+YG KK  +IG+    +WSL+ G S YSN   FF  CRAFQG+G A +LPN + ++
Sbjct: 105 RLGDVYGHKKFFIIGFFWYALWSLLAGFSVYSNQ-IFFDCCRAFQGIGPALLLPNAIAIL 163

Query: 188 GHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFYAFAIAFFLNMI 247
           G  Y  G  RK +++S  GA APA            +      WPW ++A  I  F   +
Sbjct: 164 GRTYVPGR-RKAMILSLFGATAPAGFVLGAVFSS--IFGQLTWWPWAYWAMGIVCFFLAV 220

Query: 248 LAWYSIPN----NIPTNVHGFS-MDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALL 302
                IP      + T+V  +  +D  GSV  VIGL+L NF WNQ P  GW T Y  +LL
Sbjct: 221 AGILVIPRMPLPELDTSVSTYQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLL 280

Query: 303 IISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLN 362
           I+S  FL  F   E + A  PLLP +   +     +L  V  GW SFGIW +Y+  F   
Sbjct: 281 IVSAVFLCVFAFIESR-APHPLLPLSALSS-DAAFVLGCVGAGWSSFGIWIYYFWLFLEE 338

Query: 363 LRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVK 422
           LR +SP+ T   +    I G  AA      I RV  + ++ FA+ AF VG I+ +  PVK
Sbjct: 339 LRGHSPLLTSAQFAPVAISGLCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVK 398

Query: 423 QSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMG 482
           Q +W   F    ++ +GMD+SFPA++I+LSD +P E+QG+A SLVN V+NYS S+ LG+ 
Sbjct: 399 QVYWAQAFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLA 458

Query: 483 ATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRR 531
            TVE ++N  G +LLKGYRGA Y+G+GL+  G+LI+F Y   TF  +++
Sbjct: 459 GTVEGRVNNGGANLLKGYRGAWYMGIGLSGFGILIAFMYEYHTFKKSKK 507

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  331 bits (848), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/478 (38%), Positives = 271/478 (56%), Gaps = 13/478 (2%)

Query: 69  ELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQ-AWLMASFPLVAGSFILISG 127
           E  F+     AQL+ QAG   ++  ++++  SF + +  Q +W  +S+ L  G+FILI+G
Sbjct: 43  EAAFVGVLCSAQLMTQAGLGQSIAPLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAG 102

Query: 128 RLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLV 187
           RLGDI+G +K  ++G+    +WSL+ G S YSN   FF  CRAFQG+G AF+LPN + ++
Sbjct: 103 RLGDIFGHRKFFILGFFWYALWSLLAGFSVYSNK-IFFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 188 GHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFYAFAIAFFLNMI 247
           G  YK G  RKN+V S  GA AP            +       WPW ++   IA FL  +
Sbjct: 162 GRTYKPGK-RKNMVFSLFGASAPGGFVLGAVFSSML--GQLAWWPWAYWIMGIACFLLAV 218

Query: 248 LAWYSIPN-NIPT-NVHGFSM----DWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIAL 301
             ++ IP+  +P+ +   F+M    D+ GSV  VIGLILFNF WNQ P  GW T Y   L
Sbjct: 219 AGYFVIPHVQMPSRDSPSFNMLERVDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVL 278

Query: 302 LIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQL 361
           LI+   FL  F   E + A  PLLP A   +     +L  +  GW SFGIW FY   F  
Sbjct: 279 LIVGTVFLGVFVFIESR-AAYPLLPFAALSS-DAAFVLGCIAAGWSSFGIWIFYTWQFME 336

Query: 362 NLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPV 421
             R  SP+ +   +    I G  AA      +     + ++ FA+ AF VG I+ +  PV
Sbjct: 337 ESRKQSPLLSSAQFAPVAISGFCAAVTTGFLLSHTPASTVMLFAMTAFTVGIILIATAPV 396

Query: 422 KQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGM 481
            Q++W   F    ++ +GMD+SFPA++I+LS+ +P E+QG+A SLVNTV+NYS S+ LG+
Sbjct: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGI 456

Query: 482 GATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKDSVI 539
             T+E Q+N  G + LKGYR + Y+G+GL+ LG+ ++  Y   TF  +++   +   I
Sbjct: 457 AGTIESQVNDGGANALKGYRCSWYMGIGLSGLGIFVAAVYASSTFLKSKKKASEKQYI 514

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  321 bits (823), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 187/488 (38%), Positives = 279/488 (57%), Gaps = 14/488 (2%)

Query: 58  QDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQ-AWLMASFP 116
           Q+   ++S  +E   I+    AQL+ QAG   ++  + ++  SF  ++  Q +W  ++F 
Sbjct: 18  QNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFS 77

Query: 117 LVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGI 176
           L  G+FILI+GRLGD +G KK  ++G++   +WS++ G S YSN   FF  CRAFQG+G 
Sbjct: 78  LTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQ-IFFDCCRAFQGIGP 136

Query: 177 AFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFY 236
           AF LPN + ++   Y+ G  ++N++ S  GACAP+           +   +   WPW ++
Sbjct: 137 AFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL--SEFAWWPWAYW 193

Query: 237 AFAIAFFLNMILAWYSIPNNIPTNVHG-----FSMDWTGSVLAVIGLILFNFVWNQAPTA 291
              I  FL  +  +  IP++ P +          +D  GSV  V+GLILFNF WNQ P  
Sbjct: 194 IMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVV 253

Query: 292 GWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTK-NRHMIMILLAVFLGWGSFG 350
           GW T+Y  ALLI+   FL AF   E + AK PLLP  V K +   I ++  +  GW SFG
Sbjct: 254 GWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLP--VRKLSSDTIFVMGCIAAGWSSFG 310

Query: 351 IWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFD 410
           IW +Y      NLR   P+ +   +    I G  AA      + R  P+ ++  A++AF 
Sbjct: 311 IWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFT 370

Query: 411 VGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTV 470
           VGSI+ + +PV Q++W   F    ++ +GMD+SFPA++IILS  +P  +QG+A SLVNT+
Sbjct: 371 VGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTI 430

Query: 471 INYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNR 530
           INYS S+ LG   T+E QI+    DLLKGYRGA Y+G+GLA LG+ ++ +Y +  +   +
Sbjct: 431 INYSISIGLGFAGTIESQISDGEDDLLKGYRGAYYMGIGLAGLGLGVAISYAIFHYSRLK 490

Query: 531 RDRQKDSV 538
           R   +  V
Sbjct: 491 RSLSEKYV 498

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  320 bits (819), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/478 (37%), Positives = 265/478 (55%), Gaps = 12/478 (2%)

Query: 65  SFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFN-SESDKQAWLMASFPLVAGSFI 123
           S  RE +F+     AQL+ QAG   ++  + ++  SF  S   + +W  A++ L  G+FI
Sbjct: 35  SLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFI 94

Query: 124 LISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNV 183
           LI+GRLGD++G KK+ ++G++   +WSL+ G S YSN   FF  CRA QG+G AF+LPN 
Sbjct: 95  LIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSN-QIFFDCCRALQGIGPAFLLPNS 153

Query: 184 MGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFYAFAIAFF 243
           + ++G  Y  G  RK +V S  GA AP             +      WPW ++A   A  
Sbjct: 154 IAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSS--IFSQLAWWPWAYWAMGTACL 210

Query: 244 LNMILAWYSIPNNIPTNVH---GF--SMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYI 298
           +  +     IP   P  +    G    +D  G+   ++GL L NF WNQ P  GW T Y 
Sbjct: 211 VLGVAGIIVIPQAPPPKIDISAGILERIDAAGATTGILGLALVNFAWNQGPVVGWQTPYT 270

Query: 299 IALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMS 358
            ALLI+   FL+ F + E + A+ PLLP A      +  +L  +  GW SFGIW FY+  
Sbjct: 271 YALLIVGFVFLLVFSLIESR-ARFPLLPFAALST-DLAYVLGCIAAGWSSFGIWIFYFWQ 328

Query: 359 FQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSV 418
           F  + R  SP+ T   +    I G  AA      +  V    ++  A++AF VG ++ + 
Sbjct: 329 FLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVAT 388

Query: 419 LPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLC 478
            P+ Q++W   F    I+ +GMD+SFPA++I++S+ +P E+QG+A SLVNTV+NYS SL 
Sbjct: 389 APINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLA 448

Query: 479 LGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKD 536
           LG   T+E ++N  G + L+GYRGA Y+G+GL+ LGVL++  Y   T    + ++  +
Sbjct: 449 LGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAIVYAWSTLKKFKEEQLSE 506

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  266 bits (680), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 166/496 (33%), Positives = 271/496 (54%), Gaps = 17/496 (3%)

Query: 27  EDKXXXXXXXXXXXXXASSNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAG 86
           ED+              +   S +  +   W   + F    +E  F+ T ++AQ  NQAG
Sbjct: 8   EDQYVFFSECTERSISCNQESSKEAYDRCSWLKSSNFHFLCKEYAFVFTGVMAQAFNQAG 67

Query: 87  QTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTI 146
            T  L ++NVLS SF+ +     +L+ S+P+V GSF+LI GRLG+++G K+ L+ GY+ +
Sbjct: 68  GTMILPLVNVLSDSFHGK-----FLLNSYPMVCGSFMLIGGRLGEVHGYKETLLGGYIIL 122

Query: 147 IVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYK--VGSTRKNLVISF 204
           I+ SL+ GLS+YS +  F++ CRAFQG+G+A ILPN      + Y+    + RK ++ + 
Sbjct: 123 ILSSLLGGLSRYSKSSIFYVICRAFQGVGMALILPNFSAAYDYRYQSQAKAHRKTILSTI 182

Query: 205 IGACAPAXXXXXXXXXXXIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTN---- 260
           IG  A              V      W W +Y + IA  L + L++YS+P+NI       
Sbjct: 183 IGCGASTGAFLGTFLSGICVTRSESNWSWAYYTYTIAATLTLALSYYSVPDNITKKNKPC 242

Query: 261 VHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYA 320
           ++G  + W  +     GL++ N   N A  A    ++II LL++ V  L+ F V+E+K++
Sbjct: 243 LNG--LGWFSN--RSCGLLMLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLVFELKFS 298

Query: 321 KVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVI 380
           + P+    +  N  + ++L ++F GWG++GIW+ Y+  F LNLR+YSP+  G TY   VI
Sbjct: 299 EDPVFSKELFTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGSTYLTLVI 358

Query: 381 FGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGM 440
            G +A   +++ +KR GP   L F+ + F    I+ SV P+ QS+++   G    L  G+
Sbjct: 359 GGYVAEIGISMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMIFLALGL 418

Query: 441 DLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGY 500
           D SFP+S+IIL + LP +Y  M   L N + NY+ S   G+  +    ++    +L+K Y
Sbjct: 419 DFSFPSSAIILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSALRSLSS--IELIKYY 476

Query: 501 RGAIYLGVGLASLGVL 516
           R   Y  +GL+++G+ 
Sbjct: 477 RYVYYFAIGLSAIGLF 492

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  221 bits (562), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 152/490 (31%), Positives = 246/490 (50%), Gaps = 25/490 (5%)

Query: 46  NKSTQV--SNDSPW--QDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSF 101
           NKS      +D P   ++ T   S   E++F++    +Q+L  AG    +  M+V+ + F
Sbjct: 51  NKSAPAPEEHDPPCTGEEATLNMSLLHEIIFVLLVSSSQVLGLAGAVQGIPQMDVIVEWF 110

Query: 102 N-SESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSN 160
             +      W    +    GSF+LI+G++GD+ G K M +IGY  + +WSL+ G S+Y  
Sbjct: 111 KLTHPSDSGWCNGGYATTYGSFVLIAGKMGDMNGHKSMFLIGYAWLALWSLLTGFSRYCP 170

Query: 161 NDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXX 220
           +  FF  CRA QG+G AF   + + ++G  Y     RKN + SF GAC            
Sbjct: 171 SSHFFFFCRAAQGIGAAFTFTSALSILGKSYP-PCKRKNFIFSFFGACGSFGVVLGMVFS 229

Query: 221 XXIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNI-----PTNVHGFSMDWTGSVLAV 275
                     W W +++ AIA  + +IL+ + IP ++      +NV  F  D+ G+ L V
Sbjct: 230 ALFTQL--AHWSWAYWSMAIACVVIIILSIFFIPGDVVEKHETSNV--FYFDYLGAFLFV 285

Query: 276 IGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLP-HAVTKNRH 334
            GL+LF+  WNQAPT G+G  Y+  LLI+SV  L      E K    PLLP   ++ N  
Sbjct: 286 TGLVLFSVAWNQAPTYGFGRTYVYVLLIVSVVILALAMYVETKVDD-PLLPWTHISANT- 343

Query: 335 MIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIK 394
            + +LLA+F  + SF +W  Y   F L  +  + +          + G  AA   AL + 
Sbjct: 344 -LKVLLAIFFAYASFTMWAAYTFRFNLMAKGDTLLLAAAKMTPMAVSGVFAALFSALLLN 402

Query: 395 -RVGPAFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSD 453
             V     +  +L+AF V  I+ + +   Q++W   F    ++ FG+D+SFP+++++LS+
Sbjct: 403 IHVQVQIRMLISLLAFLVPPILMATMGAGQTYWGEVFVTTIVISFGLDISFPSATLLLSN 462

Query: 454 GLPMEYQGMAGSLVNTVINYSASLCLGMGATV-EHQ----INKNGKDLLKGYRGAIYLGV 508
            +P +++G+  SLV  V+NY+ +L     A+V  +Q    +   G    K      Y+G+
Sbjct: 463 RIPDKFKGLGASLVGAVLNYATALGPPTAASVLRYQCPDCMAHKGNAFTKTINIIGYVGI 522

Query: 509 GLASLGVLIS 518
           G A LG L++
Sbjct: 523 GTAGLGTLVA 532

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  202 bits (514), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 143/489 (29%), Positives = 250/489 (51%), Gaps = 20/489 (4%)

Query: 68  RELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQ---AWLMASFPLVAGSFIL 124
           +E++ ++     Q ++  G    +  M  ++ +F+   D+     W  A++   A +F++
Sbjct: 47  KEIIIVLLISSGQFISLLGAVQGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFVI 106

Query: 125 ISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDA-FFITCRAFQGLGIAFILPNV 183
           I+G+LGDI G K M + GY  + +WSL+ G SKY+  +A FF  CR  QG+G AF+ P  
Sbjct: 107 IAGKLGDINGHKNMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTG 166

Query: 184 MGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFYAFAIAFF 243
           + L+G  Y     RKN V SF GAC P                 +  W W +++ A+   
Sbjct: 167 LALLGKHYP-PCKRKNYVFSFYGACGPFGIVAGSVFSALFTQLTT--WAWTYWSMAVTCL 223

Query: 244 LNMILAWYSIP-NNIPTNVHG--FSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIA 300
           +  IL++  IP +N P       +S D+ G    + G+ILF+ VWNQAP + +   Y+ +
Sbjct: 224 IITILSYIFIPKDNTPKRERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYS 283

Query: 301 LLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQ 360
           LLI+SV F+    + + +  K PL+P   +   ++I  L+ VF G+  F IW FY   F 
Sbjct: 284 LLIVSVVFMTMALIIDSR-VKDPLIPWK-SMCSNVIKALIVVFFGFLGFTIWLFYSWRFY 341

Query: 361 LNLRHYSPVWTGGTYFVFVIFGTIAA-FMVALSIKRVGPAFLLCFALVAFDVGSIMFSVL 419
           L  ++ S +     +    I G  AA F V L  K+V     L  A+ AF + +I+ S +
Sbjct: 342 LVAKNDSLLLAAAKFIPLGISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILISTM 401

Query: 420 PVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCL 479
            +++++W   F    I+  G+D++FP+++++LS+G+  E QG+A +L  T +NY  +L  
Sbjct: 402 TLQETYWGNAFVATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALGP 461

Query: 480 GMGATV-----EHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRD-- 532
           G+   +     +  + ++    +     A Y+ +G A + V+++    +  ++  R D  
Sbjct: 462 GVATLIITYQCDDCLARSDGRFVHAVHIAGYVAIGTAGIAVVVAIFGSITEYYKERMDDL 521

Query: 533 RQKDSVITE 541
           R+K   I+ 
Sbjct: 522 REKKRPISS 530

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  176 bits (447), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 91/190 (47%), Positives = 120/190 (63%), Gaps = 34/190 (17%)

Query: 77  MLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLK 136
           M++QLLNQ G T  L ++NVLS+ F S + +Q  L+AS PLV+GSFIL+SG++GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 137 KMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGST 196
             L+ GY T+IVWS ICGL++Y+ +  FF+  RAFQGLG+AF+LPNVMG V +VY  GS 
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 197 RKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNN 256
           RKN+V                                  YA+ +A  LNM L  +++P N
Sbjct: 121 RKNMV----------------------------------YAYTVAVSLNMALCVWALPWN 146

Query: 257 IPTNVHGFSM 266
           IPTNV G +M
Sbjct: 147 IPTNVRGQAM 156

 Score = 36.6 bits (83), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 6/43 (13%)

Query: 455 LPMEYQGMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDLL 497
           +P   +G A      ++ YS  +CLG+  TVEH+++K G D L
Sbjct: 147 IPTNVRGQA------MLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  181 bits (459), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 146/523 (27%), Positives = 242/523 (46%), Gaps = 40/523 (7%)

Query: 44  SSNKSTQVSNDSPWQ--------DPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMN 95
           S     Q SN  P Q        +P    S  RE MFIV    +Q ++ A  + A+  M+
Sbjct: 38  SQRTKEQCSNLQPAQAQDQLESMNPPPGPSRLRECMFIVIIASSQFISLAAASQAILQMD 97

Query: 96  VLSKSFNSESDKQ---AWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLI 152
            ++  F   +D+     W  A+F +  G+FI+ +G+L D+ G K + + GY    +WSL+
Sbjct: 98  AITAWFQLPADRSLEAGWANAAFAITCGTFIIPAGKLCDLIGSKTVFIFGYAWYTLWSLL 157

Query: 153 CGLSKYS--NNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAP 210
            G+S+Y+      FF   R  QG+G A + P+ + L+G  Y   S +KN+V S  G C P
Sbjct: 158 VGISRYAPKGQATFFFFGRGCQGIGAAALFPSSLALLGKYYP-PSCKKNIVFSLYGFCVP 216

Query: 211 AXXXXXXXXXXXIVNEDSEQWPWVFYAFAI-AFFLNMILAWYSIPNNIPTN--------- 260
                        +      W W +++ AI + F  +I  +Y  P+ I  +         
Sbjct: 217 --LGVVVGGVFSAIFTQLAHWSWNYWSMAIVSAFFTLISCFYIPPDEIIKSEEQKKKRAW 274

Query: 261 VHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYA 320
            H    D+ G+ L V  L+LF   WNQA    + +  +   LI+S+   VA  + E  Y 
Sbjct: 275 FHLPKFDYLGTFLYVASLLLFAVCWNQATGFKFKSVQVYVTLIVSLVCFVAMVIVEF-YV 333

Query: 321 KVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVI 380
             P++P A   +   I  LL VF  + SF IW FY   +   +R+ + +     +    I
Sbjct: 334 DDPIIP-ARKIHPQTIKALLVVFFSYLSFTIWLFYLWKYFTVVRNDTVLLGAAKFVPLSI 392

Query: 381 FGTIAAFMVALSIKRVGPAFLLCFA-LVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFG 439
            G IAA    L I    P  +   A   +F +  I+F  L   +S+W   F    I+  G
Sbjct: 393 AGFIAALFSILLISTAVPVQIRLLAGACSFLLAHILFITLSRTESYWARPFLTIIIISIG 452

Query: 440 MDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGAT-VEHQINK-----NG 493
           +D+SFP+++++LS+G+P E +G++ +LV T +NY   +   +  T + +Q +K     + 
Sbjct: 453 LDISFPSATLLLSNGVPQELRGISAALVGTALNYGTGIGPPIAQTIIGYQCDKCMASGDM 512

Query: 494 KDLLKGYRGAIYLGVGLASLGVLISF-----TYMLETFWNNRR 531
              +K    A  +G+G + + V++        Y  ET   ++R
Sbjct: 513 DQFVKAIHIAAAVGIGASGIAVVVGLYGTVTEYSWETHSYSKR 555

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  159 bits (401), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 139/548 (25%), Positives = 242/548 (44%), Gaps = 78/548 (14%)

Query: 58  QDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFN---SESDKQAWLMAS 114
           Q PT  +S+  +++FI     +Q +  A  + A+  M+ LS  F    + + +  W+ AS
Sbjct: 62  QSPT--NSYLNDIIFIFLICSSQFITLASASQAILQMDSLSVWFKIPPTSTLQLGWVNAS 119

Query: 115 FPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKY-SNNDAFFITCRAFQG 173
           F +  G+FI+++G+L DI   + + + GYV   +W+LI G + Y   N  F   CR  QG
Sbjct: 120 FAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWTLITGFASYVPKNMIFLYICRGCQG 179

Query: 174 LGIAFILPNVMGLVGHVYKVGS-------------------------------------- 195
           +G A + P+ + L+   Y V                                        
Sbjct: 180 IGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSPSHDIEKNLSSDDDNDGDSSI 239

Query: 196 --------TRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFYAFAIAFFLNMI 247
                   T K++  S  GACAP                 +  WPW +++ +I   L  I
Sbjct: 240 ADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSAIFTQLAT--WPWNYWSMSIVTTLLSI 297

Query: 248 LAWYSIPNNIP-----TNVHGF----SMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYI 298
           L+++ +   IP     +N +      + D+ G +L +  LILF   W+QA    + T ++
Sbjct: 298 LSYFYVVVPIPVEKLDSNPNSLKNWKNFDFLGVILGISALILFGVSWDQATMYKFKTIHV 357

Query: 299 IALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRH--MIMILLAVFLGWGSFGIWTFYY 356
              L+ S+   +A  ++E  Y   P++P    +  H   I  LL VF  + SF  W FY 
Sbjct: 358 YLTLLFSLVSFIAMIIWEY-YFNNPIIP---IRQIHPGTIKALLVVFFSYISFTQWLFYT 413

Query: 357 MSFQLNLRHYSPVWTGGTYFVFVIFGTIAA-FMVALSIKRVGPAFLLCFALVAFDVGSIM 415
                 ++  SP+     +    + G I+A F + L +KRV     L     +F +  I+
Sbjct: 414 WKLFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIVKRVPVQIRLLAGASSFLLSHIL 473

Query: 416 FSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSA 475
                +  S+W   F     +  G+D+SFP+++++L++G+P E QG+  +LV +V+NY  
Sbjct: 474 LLTCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTNGIPPEIQGICAALVGSVLNYGT 533

Query: 476 SLCLGMGAT-VEHQIN------KNGKDLLKGYRGAIYLGVGLASLGVLIS-FTYMLETFW 527
           ++   +  T +++Q         + K  LKG   A  +GVG + + VLI  +  + E  W
Sbjct: 534 AIGPPIAQTIIQYQCESCMSDPHDKKAFLKGIHIAGAVGVGCSGIAVLIGIYGTITEYSW 593

Query: 528 NNRRDRQK 535
             +   +K
Sbjct: 594 KTKGFSKK 601

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  152 bits (385), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 122/445 (27%), Positives = 209/445 (46%), Gaps = 20/445 (4%)

Query: 68  RELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQA---WLMASFPLVAGSFIL 124
           RE+  ++  + +QL+   G    + I   L + +  E  K     W  AS+ L +   +L
Sbjct: 37  REIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWANASYMLGSAVMVL 96

Query: 125 ISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSN-NDAFFITCRAFQGLGIAFILPNV 183
           I+G+LGD+ G K+M++ G++ + +WSLI G S Y   N AF+ T RA QG+G  FI+PN 
Sbjct: 97  IAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSGFIVPNS 156

Query: 184 MGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFYAFAIAFF 243
           + ++G  Y     +K ++ S  G                       +W W ++A A    
Sbjct: 157 LAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQL--TKWAWNYWALACVCV 214

Query: 244 LNMILAWYSIP-NNIPTNVHGFSM----DWTGSVLAVIGLILFNFVWNQAPTAGWGT--A 296
           L  + A   IP +NI    +   +    D+ G++  V GL+LF+  + QA   GW     
Sbjct: 215 LYTVGAILFIPPDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFDVAFTQASALGWSPPHT 274

Query: 297 YIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYY 356
           YI  ++ + +  +  F  + V    VPL  H       +++IL+ V+ G+ SF IW  ++
Sbjct: 275 YITLIIGVILILIAMFVDWRVDDPLVPL-QHL---RADVVVILICVYFGFLSFVIWANWF 330

Query: 357 MSFQLNLRHYSPVWTGGTYFVFVIFGTIAA--FMVALSIKRVGPAFLLCFALVAFDVGSI 414
             F   + + SP+          I G+I A  F V      +    ++  ++V F V +I
Sbjct: 331 WQFYELVHNDSPLRIAAKLVPLAI-GSIPAAIFTVTCLQLNIKAPTMMVISMVCFLVPNI 389

Query: 415 MFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYS 474
           + + +    ++W   F    I  F +D++ P ++++ SD +  E QG+A SL+ TVI+Y+
Sbjct: 390 LMATVTPNTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLIITVISYA 449

Query: 475 ASLCLGMGATVEHQINKNGKDLLKG 499
            S+     A V   +   G D   G
Sbjct: 450 ISIGPSYTAMVMWYVAPLGNDSTPG 474

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 75.9 bits (185), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 104/475 (21%), Positives = 184/475 (38%), Gaps = 46/475 (9%)

Query: 80  QLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKML 139
            LLN A     +++++ L+K +N      +W + S+ +    FI   GRLGDI G   + 
Sbjct: 41  DLLNVASM---ISLIDDLAKKYNISYTTASWSLTSYAVTFAGFIACMGRLGDIVGNSVLF 97

Query: 140 MIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKN 199
            I      + SL+C +     N   F   RA QG+  A ++P    L+  +      +K 
Sbjct: 98  TISCSCFAILSLLCAVMP---NFPAFAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKY 154

Query: 200 LVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFY-AFAIAFFLNMILAWYSI----- 253
             I    +C  +                   +  +FY  FA+   +++I  +++      
Sbjct: 155 FSIV---SCGFSSTIGLGLIIGGAFAATKIGYRGIFYLTFAVMSLISVIAFFFTYNVENF 211

Query: 254 ---PNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLV 310
              P  I       S+D+ GS++ V G IL      +   + W        LII +    
Sbjct: 212 DKKPQKIQAQTSVKSLDFIGSLIFVAGSILIVVGLTEGGES-WNRPVTYVTLIIGILLFF 270

Query: 311 AFFVYEVKYAKVP-------------------LLPHAVTKNRHMIMILLAVFLGWGSFGI 351
            FFV+   YAK+                    L+P  V   ++ I I+LA  L       
Sbjct: 271 GFFVWNCTYAKIVRGIRFVGIDTSKYFEKVQLLIPVDVLFMKNFIPIVLAFALNNACLFS 330

Query: 352 WTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDV 411
             +    +       SP+  G      +I   +   + A    ++ P   +         
Sbjct: 331 CLYIIDQYSQYAEKDSPLLAGVKLVPLIICMVVGNALCAFESTKLKPRVGVALGFSLALA 390

Query: 412 GSIMFSVLPVKQS--FWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNT 469
           GSI+   L + +   FWK+ F  QA++ FG+ + +P +  I   G P + +G+A  +  T
Sbjct: 391 GSIILIQLHLIKDNVFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDQSKGIASGVAQT 450

Query: 470 VINYSASLCLGMGATVEHQIN--KNGKDLLK----GYRGAIYLGVGLASLGVLIS 518
                  +   + A+V   IN  K  +D ++    G++   Y  V + +LG L++
Sbjct: 451 FGQLGIEITFSVMASVLGDINEMKGKEDAIQNFRTGFQNCSYFTVAVGALGFLVT 505

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 106/475 (22%), Positives = 183/475 (38%), Gaps = 46/475 (9%)

Query: 80  QLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKML 139
            LLN A     +++++ L+K++N      +W + S+ +    FI   GRLGDI G   + 
Sbjct: 41  DLLNVASM---ISLIDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRLGDIIGNSVLF 97

Query: 140 MIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKN 199
            I      V SL+C +     N   F   RA QG+  A ++P    L+  +      +K 
Sbjct: 98  TISCSCFAVLSLLCAVMP---NFPAFAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKY 154

Query: 200 LVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFY-AFAIAFFLNMILAWYSI----- 253
             I    +C  +                   +  +FY  FA+   +++I  +++      
Sbjct: 155 FSIV---SCGFSSTIGLGLIIGGAFATTKIGYRGIFYLTFAVMTLISIIAFFFTYGVEKL 211

Query: 254 ---PNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLV 310
              P     +    S+D+ GS++ V G IL      +   + W        L+I +    
Sbjct: 212 NKKPQKDQASTSVKSLDFIGSLIFVAGSILIVVGLTEGGES-WNRPVTYVTLVIGIILFF 270

Query: 311 AFFVYEVKYAKVP-------------------LLPHAVTKNRHMIMILLAVFLGWGSFGI 351
            FFV+   Y K+                    L+P  V   ++ I I+LA  L       
Sbjct: 271 GFFVWNCTYTKIVRGFKYCGIDTSKYFEKVQLLIPIDVLFMKNFIPIVLAFALNNACLFS 330

Query: 352 WTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDV 411
             +    +       SP+  G      +I   I   + A    ++ P   +         
Sbjct: 331 CLYIIDQYSQYAERNSPLLAGVKLVPLIICMVIGNALCAFESTKLRPRVGVAIGFFLALA 390

Query: 412 GSIMFSVLP-VKQS-FWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNT 469
           GSI+   L  VK+  FWK+ F  QA++ FG+ + +P +  I   G P E +G+A  +  T
Sbjct: 391 GSIILIQLHLVKEDLFWKIFFSAQALVGFGVAIFYPYALQIAVGGAPDESRGIASGVAQT 450

Query: 470 VINYSASLCLGMGATVEHQINK-NGK-----DLLKGYRGAIYLGVGLASLGVLIS 518
                  +   + A+V   IN+  GK         G++   Y  V + +LG L++
Sbjct: 451 FGQLGIEITFSVMASVLGNINEMKGKSNAIQKFRTGFQNCSYFTVAVGALGFLVT 505

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 109/492 (22%), Positives = 199/492 (40%), Gaps = 67/492 (13%)

Query: 49  TQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQ 108
           T+ S  S +Q+ + F  +   ++ +V+C    L+N    T  L+    +  ++  E    
Sbjct: 8   TRDSIRSNFQNIS-FHRYINLVLIMVSCAF-DLINV---TAVLSATRDIENTYQIEFTTA 62

Query: 109 AWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITC 168
           +W + ++ +    FI   GR+GDI G   + +       + SLIC +    NN   F   
Sbjct: 63  SWALTAYAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAVV---NNFGTFAVF 119

Query: 169 RAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISF--IGACAPAXXXXXXXXXXXIVNE 226
           RA QG+  A I+P+   L+  +     + ++ V SF  I +C  +               
Sbjct: 120 RALQGIAAAGIVPSGYALIPTL-----SDEHEVQSFFAIVSCGFSTSFGIGFIIGGAFTL 174

Query: 227 DSEQWPWVFY-AFAIAFFLNMILAWYSI---PNNIPTN---------VHGFSMDWTGS-- 271
               +  +FY  FA+   ++ I++++SI    N  P               S+D+ GS  
Sbjct: 175 TRIGYKGIFYLTFAVMLVIS-IISYFSIGTSANQKPCTKDSPKTTKWSDALSLDFIGSFM 233

Query: 272 -----VLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKY------- 319
                +L V+GL      W +       +AY+   LI+ +   V FF++ + Y       
Sbjct: 234 FISSTILIVVGLTEGGESWKKP------SAYVT--LIVGIALFVLFFIWNICYGVLVKNL 285

Query: 320 --AKVP-----------LLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHY 366
             A  P           L+P  V   ++ I I +AVF  +G      +    +   +   
Sbjct: 286 KSASNPKVYNYFRTIQVLIPKDVLMMKNFIPITVAVFANYGCLFSNLYIVNQYCQYVSKN 345

Query: 367 SPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPV--KQS 424
           SP+         V+   I   ++A+    + P   +        +GSI+   L +     
Sbjct: 346 SPLLAAVKLLPLVVSMLIPNVVIAIKSDLISPRKAVVLGFFIMFIGSIILIQLHLITDNL 405

Query: 425 FWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGAT 484
           +WK+ F  Q+++ FG  + FP S  IL    P EY+G+A  ++ T   +   +   +  +
Sbjct: 406 YWKIFFCSQSLIAFGAAIFFPYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTS 465

Query: 485 VEHQINK-NGKD 495
           +   IN+ +GK 
Sbjct: 466 ILGNINELSGKS 477

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 108/507 (21%), Positives = 196/507 (38%), Gaps = 54/507 (10%)

Query: 58  QDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPL 117
           Q  TY  +    L+F+  C    LLN A     +++++ L++ ++      +W + S+ +
Sbjct: 21  QKSTYQLNVNVALIFL-GCTF-DLLNVASM---ISLIDDLAQKYDISYTTASWSLTSYAV 75

Query: 118 VAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIA 177
               FI   GRLGDI G   +  +      + SL+C +     N   F   RA QG+  A
Sbjct: 76  TFAGFIAFMGRLGDIVGNSILFTVSCFFFAILSLLCAVMP---NFPAFAVFRAIQGISAA 132

Query: 178 FILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFY- 236
            ++P    L+  +      +K   I    +C  +                   +  +FY 
Sbjct: 133 GLVPCAYALIPMLAPEEEVQKYFSIV---SCGFSSTIGLGLIIGGAFAATKIGYKGIFYL 189

Query: 237 AFAIAFFLNMILAWYSI--------PNNIPTNVHGFSMDW-------TGSVLAVIGLILF 281
            FA+ F ++++  +++         P          S+D+       TGS+L V+GL   
Sbjct: 190 TFAVMFLISIVAFFFTYGVENLSEPPRKDQATNRVRSLDFIGSLIFVTGSILIVVGLTEG 249

Query: 282 NFVWNQAPT--------------AGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLL-P 326
              WN+  T                W  +Y   +  I    +     +E    KV LL P
Sbjct: 250 GESWNRPATYVTLVIGIILFFGFFFWNCSYARIVRGIRCCGIDTSRYFE----KVQLLIP 305

Query: 327 HAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAA 386
             V   ++ I I+LA  L         +    +       SP++ G      +I   I  
Sbjct: 306 VDVLFMKNFIPIVLAFALNNACLFSCIYIIDQYSQYEEKNSPLYAGVKLVPLIICMVIGN 365

Query: 387 FMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPV--KQSFWKLNFGMQAILCFGMDLSF 444
            + A    ++ P   +         GSI+ + L +  +  FWK+ F  QA++ FG+ + +
Sbjct: 366 GLCAFESTKLKPKVGVVLGFSLALAGSIILTQLHLIKEDMFWKIFFSSQALVGFGVAIFY 425

Query: 445 PASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGATVEHQIN----KNG--KDLLK 498
           P +  I   G P   +G+A  +  T       +   + A+V   I+    K+G  +    
Sbjct: 426 PYALQIAVGGAPDRSKGIASGVAQTFGQLGIEITFSVMASVLGNIDGIRGKSGASQKFRT 485

Query: 499 GYRGAIYLGVGLASLGVLISFTYMLET 525
           G++   Y  V + +LG L++   + +T
Sbjct: 486 GFQNCTYFTVAVGALGFLVTLFGLKDT 512

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 111/529 (20%), Positives = 205/529 (38%), Gaps = 57/529 (10%)

Query: 45  SNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSE 104
           S KS      S +   T      + L FI   ++A  L+ A     + ++  +   FN  
Sbjct: 3   SEKSVTFPKGSLFHQDTL-----KHLKFICI-LIACGLDLASVGAMIVLVTDIETRFNVS 56

Query: 105 SDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAF 164
             +  W + S+ +    FI   GR+GDI G   M+ +  V   ++SL+C +     N   
Sbjct: 57  HTQSGWALTSYVITFAGFIAFFGRVGDIVGNGIMMCVFSVIFGIFSLLCAVVP---NFIA 113

Query: 165 FITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRK--NLVISFIGACAPAXXXXXXXXXXX 222
           F   RAFQG+  A I+P    LV  +++  + ++  +++ S I A A             
Sbjct: 114 FTVFRAFQGMAGAGIVPCAYALVNKMFQGPNLQRYFSILSSVISAMAGVGFIIGGAFGET 173

Query: 223 IVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPT-----------NVHGFSMDWTGS 271
            +   S  +     + A A  + +++ +  +  N  +           +V G  +  +GS
Sbjct: 174 ALGYKSFFYFLFAASLATAAVICVLIGYPELLLNRHSYKEKFQRVYKLDVIGCLLFISGS 233

Query: 272 VLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKV-----P--- 323
           +L V+GL      WN        TAY+   L +S+  L+ FF++ + YA V     P   
Sbjct: 234 ILLVVGLTQGGESWNDP------TAYV--PLAVSIVLLIIFFMWNLGYAVVLKLIKPIST 285

Query: 324 ------------LLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWT 371
                       L+P  +  + + I +LLA F  +  F +  +   ++   +   S +  
Sbjct: 286 HKGYAYMESVNLLIPKNLMFSHNFIPVLLATFFLFCGFMVVMYVIANYSATVEGNSMIVA 345

Query: 372 GGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVK----QSFWK 427
                  +    +A   VA       P   L        +G   F  +P+K      FWK
Sbjct: 346 SIKIIPMISGLVLANGTVAYKQDLFKPKNALVVGSFISILGGAFF--VPIKYVDDNLFWK 403

Query: 428 LNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGATVEH 487
           L F        G    F     +     P +Y+ +AG +V T   +   + L +  ++  
Sbjct: 404 LFFMGGFFTGLGGAFFFCYMITMAIGDAPDQYKALAGGIVQTSGQFGNEVSLSIVISLLG 463

Query: 488 QINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKD 536
               +  DL   ++ A Y+ +  A++  L+S  ++++    +  D +K 
Sbjct: 464 NQTTDKADLRDRFQNASYIVITAATISTLVSL-FLVKGPLESSGDEEKQ 511

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 91/416 (21%), Positives = 165/416 (39%), Gaps = 57/416 (13%)

Query: 91  LTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWS 150
           +++++ LS  ++      +W + S+ +    FI   GRLGDI G  ++  +      + S
Sbjct: 49  ISLIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFAILS 108

Query: 151 LICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYK---VGSTRKNLVISF-IG 206
           L+CGL    N +AF +  RA QG+  A       GLV   Y    + S ++ +   F I 
Sbjct: 109 LLCGL--MPNFEAFAVM-RALQGIAAA-------GLVMCGYALIPILSPKEQVQEYFSIV 158

Query: 207 ACAPAXXXXXXXXXXXIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGF-- 264
           +C              I+      +  +FY    A  L  I+A++   +       G   
Sbjct: 159 SCG----FSSTIGIGFIIGGAXXGYKGIFYLTFAAMTLICIMAFFFTCDVEKNEEKGLEV 214

Query: 265 --------SMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYE 316
                   S+D+ GS++ + G IL      +   + W  A       I +   ++FF + 
Sbjct: 215 KESTATVASLDFIGSLIFITGSILIVVGLTEGGES-WREAKAYVTFAIGIILFLSFFAWN 273

Query: 317 VKYAKV----PLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLN---------- 362
             Y K+     L+    TK    + +L+ + + +      T   ++F +N          
Sbjct: 274 CFYLKIVNGIRLIGIDTTKYFEKVQLLVPLNIHF-----MTXIVLAFAMNNACPFSSIYI 328

Query: 363 LRHYS-------PVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIM 415
           +  YS       P+  G      +I   I  F+  +   R+ P F +         GSI+
Sbjct: 329 IDQYSQYKENDSPLMAGVKLVPLIISMIIGNFLCGIEKTRMRPKFGVTLGFFLALSGSII 388

Query: 416 FSVL-PVKQS-FWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNT 469
            + L  VK   FWK+ F  + ++ FG+ + +P +  +     P E +G+A  +  T
Sbjct: 389 LTQLRAVKYDVFWKIFFSAEVLVGFGVAIFYPYAQQLAVGRAPDEAKGIASGVAQT 444

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 90/424 (21%), Positives = 168/424 (39%), Gaps = 62/424 (14%)

Query: 92  TIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSL 151
           T++  +   FNS  DK +W+  S+ L + +   + G+L D  G K +L+       +  L
Sbjct: 108 TLLTHIGSEFNSL-DKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCL 166

Query: 152 ICGLSKYSNNDAFFITCRAFQGLG-------IAFILPNVM---------GLVGHVYKVGS 195
           ICGLS   N+    +  R   G+G          I+ +++         GL   V+ +G+
Sbjct: 167 ICGLS---NSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGT 223

Query: 196 TRKNLVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFYAFAIAFFLN--MILAWYSI 253
               LV ++                          W   F        L+  +I+ +  +
Sbjct: 224 ASGGLVGAYF-----------------------RDWRLAFILQCPISVLSGILIVVYLEL 260

Query: 254 PNNI-PTNVHGFS-----MDWTGSVLAVIGLILFNFVWNQAPTA-GWGTAYIIALLIISV 306
           P     +N   +S     +DW G+   +  L LF    +   ++  +G+    A+   ++
Sbjct: 261 PPRASASNKDCWSARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATL 320

Query: 307 FFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFY---YMSFQLNL 363
            F   F   E++ A  P+LP    ++R ++   LA +    S     FY   Y S  L +
Sbjct: 321 VFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGM 380

Query: 364 RHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGP--AFLLCFALVAFDVGSIMFSVLPV 421
           +           F  V FG++ A    L +KR G    FLL F ++A   G +   ++  
Sbjct: 381 KATDVGKRAMPSFFSVAFGSLGA---GLYMKRTGKYYYFLLAFCVLAI-AGQVQIVLITP 436

Query: 422 KQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGM 481
           +   W+  + +Q +  FG+ +    + + +   +P E+     S+     +  A+L + +
Sbjct: 437 QMPVWR-QYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSV 495

Query: 482 GATV 485
           GA V
Sbjct: 496 GAAV 499

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 96/484 (19%), Positives = 188/484 (38%), Gaps = 60/484 (12%)

Query: 80  QLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKML 139
            LLN AG    ++++  L +++       +W + S+ +    FI   GRLGDI G   + 
Sbjct: 40  DLLNVAG---VISVIEDLGETYKLGYTGASWALTSYAITFAGFIAFMGRLGDIVGNSVLF 96

Query: 140 MIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKN 199
            I      ++SL+C + +     A F   RA QG+  A I+P    L+  + +    +K 
Sbjct: 97  TISCFLFTLFSLLCAVVRDFPTFAVF---RALQGISAAGIVPCGYALIPLLAEPQDIQKF 153

Query: 200 LVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFY-AFAIAFFLNMILAWYS------ 252
             I    +C  +                   +  +FY +FA    +++  ++Y+      
Sbjct: 154 FSIV---SCGFSSTIGIGLIVGGAFALTKVGYAGIFYLSFAGMLVVSIAASFYTYRIEER 210

Query: 253 ---------IPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLI 303
                    IP++ P      S+D+ GS++ V G +L      +   + W          
Sbjct: 211 KFLEVKVEDIPHDHPKVA---SLDFVGSLIFVSGSVLIVAGLTEGGES-WRRPVAYVPFS 266

Query: 304 ISVFFLVAFFVYEVKYAKV-------------------PLLPHAVTKNRHMIMILLAVFL 344
           I V    +FF++   Y K+                    L+P  V    + I I+L+   
Sbjct: 267 IGVLLFCSFFIWNCYYQKMVSRLKAVGFNTPQYLNNVQVLVPKDVLFMPNFIPIILS--F 324

Query: 345 GWGSFGIWTFYYMSFQLN--LRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLL 402
              +  +++  Y+  Q +  +   SP+  G      ++   I     A+   ++ P   +
Sbjct: 325 ACNNACLFSVIYIIDQYSQYVEKNSPLIAGVRLIPLIVSMVIGNTTCAIRSLQLRPKVGV 384

Query: 403 CFALVAFDVGSIMFSVLPVKQS--FWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQ 460
               +    GSI+   L   ++  FWKL F  Q  +  G  + +P +  ++  G P   +
Sbjct: 385 VLGFLFMLCGSIILIQLHTIENGIFWKLFFCSQISVGLGAAIFYPYALKLVVGGAPDGAK 444

Query: 461 GMAGSLVNTVINYSASLCLGMGATVEHQINK-----NGKDLLKG-YRGAIYLGVGLASLG 514
           G+A  +  T   +   +   +  +V   I       N ++  K  ++   Y  V +A+LG
Sbjct: 445 GIASGMTQTFAQFGVEVTFSVMVSVLGNITDVKETLNSQETFKDRFQNCAYFSVAVAALG 504

Query: 515 VLIS 518
           ++++
Sbjct: 505 LILT 508

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 101/465 (21%), Positives = 184/465 (39%), Gaps = 72/465 (15%)

Query: 56  PWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASF 115
           P + P +  S  R  + +++  L   L     T   T++  +   FNS  DK +W+  S+
Sbjct: 68  PSETPEFALSSSRIRIIMISMFLGIFLAALDGTIVSTLLTRIGSEFNSL-DKVSWIATSY 126

Query: 116 PLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSK----------YSNNDAFF 165
            L + +   + G+L D  G K +L+   V   +  LICG+S            S      
Sbjct: 127 LLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCG 186

Query: 166 ITCRAFQGLGIAFILP-----NVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXX 220
           +TC A   + I+ ++P        GL   ++ +G+    LV    GA             
Sbjct: 187 LTCLA--SMVISDLVPLRERAVYQGLCNFIFGLGTASGGLV----GAAF----------- 229

Query: 221 XXIVNEDSEQWPWVFYAFAIAFFLN-----MILAWYSIPNNIPTNVHGFSMDWTGSV--- 272
                   + W     AF I   ++     +I+++  +P   P +       WT  +   
Sbjct: 230 --------QDWR---MAFTIQCPISLASCALIVSYLELP---PRHEDDKDRHWTSKLRDL 275

Query: 273 --LAVIGLILFNFVWNQAPT-AGWGTAY---IIALLIISVFFLVAFFVYEVKYAKV-PLL 325
               V+ L+ F F++    +  G   AY   + ALL ++   L + F Y   Y  V P+L
Sbjct: 276 DWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVL 335

Query: 326 PHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGT---YFVFVIFG 382
           P A  K R ++   LA +    S     +Y   +  ++ +  P   G      F  V FG
Sbjct: 336 PIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFG 395

Query: 383 TIAAFMVALSIKRVGPA--FLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGM 440
           ++ A    + +KR G    FLL F  +   +G +  ++L      W+  + +  +  FG+
Sbjct: 396 SLGA---GIYMKRTGKYYWFLLAFCGIGI-LGQLKINLLTPATPVWQ-QYLLLVVPSFGL 450

Query: 441 DLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGATV 485
            +    + + +   +P E+     S+     +  A+L + +GA +
Sbjct: 451 SVLITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAAI 495

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 48/98 (48%), Gaps = 4/98 (4%)

Query: 78  LAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKK 137
           +   L     T    IMN +++ F  ESDK+ W++ SF L   +F  + G+L D+ G K 
Sbjct: 48  MGSFLGSLDSTIVANIMNKVAEEFE-ESDKKQWIVTSFLLTNTAFQPLYGKLSDLAGRKT 106

Query: 138 MLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLG 175
            LM+ +   +V  L   LS+   N   F   RA  G+G
Sbjct: 107 ALMVAHSFFLVGCLFTALSR---NLVEFSIARAVCGMG 141

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 55/109 (50%), Gaps = 3/109 (2%)

Query: 50  QVSNDSPWQDPTYFSSFGRELMFIVTC--MLAQLLNQAGQTHALTIMNVLSKSFNSESDK 107
            + N+   +D    S    + + ++T    L   L  A  T   TIM  ++  FN E  +
Sbjct: 57  SIDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFN-ELPR 115

Query: 108 QAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLS 156
            +W+  ++ L + +F  + G+L DI+G K +LM+  +  +V  L+CGL+
Sbjct: 116 ISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLT 164

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 48/98 (48%), Gaps = 4/98 (4%)

Query: 78  LAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKK 137
           L   L+    T    IMN +++ F SES ++ W+  SF L   +F  + G+L DI G K 
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEDF-SESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKS 102

Query: 138 MLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLG 175
            L+I       + L C L+ ++ N   F   RA  G+G
Sbjct: 103 ALLIAQ---FFFGLGCLLTCFARNVTEFSIARAICGIG 137

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 58/122 (47%), Gaps = 7/122 (5%)

Query: 78  LAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKK 137
           L   L+    T    IMN +++ F  ESDK+ W+  SF L   +F  + G+L DI G K 
Sbjct: 48  LGSFLSSLDSTIVANIMNKVAEEFE-ESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKF 106

Query: 138 MLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTR 197
            ++  +     + L C L+ ++ N   F   RA  G+G   +  N M  +  V  + STR
Sbjct: 107 AVLTSH---FFFGLGCFLTCFAQNITQFSIARAICGIGAGGV--NAMSSI-TVSDICSTR 160

Query: 198 KN 199
           + 
Sbjct: 161 ER 162

>Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C -
           Hypothetical ORF [contig 245] FULL
          Length = 611

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 54/124 (43%), Gaps = 11/124 (8%)

Query: 232 PWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGF---------SMDWTGSVL--AVIGLIL 280
           P++ Y F      +    W  + N + T+              +D  G+VL  A +GLIL
Sbjct: 234 PFITYLFYATHISSKTKKWKDLRNKVETHKRNIILVVKDIFNQIDIVGTVLVTAALGLIL 293

Query: 281 FNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILL 340
                    +  W    IIA L+I +  L+ F  +E K+AK   LP  + K+R +   ++
Sbjct: 294 VPLTLAGGVSERWHEPGIIATLVIGIALLLVFLFWEAKFAKNAALPFNLLKDRGVWASIV 353

Query: 341 AVFL 344
           A FL
Sbjct: 354 AAFL 357

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 47/98 (47%), Gaps = 4/98 (4%)

Query: 78  LAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKK 137
           L   L+    T    IMN +++ F SES K+ W+  SF L   +F  + G+L DI G K 
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLLTNTAFQPLYGKLSDITGRKS 102

Query: 138 MLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLG 175
            L+        + L C L+ ++ N   F   RA  G+G
Sbjct: 103 ALLTAQ---FFFGLGCLLTCFARNVTEFSIARAICGIG 137

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 48/98 (48%), Gaps = 4/98 (4%)

Query: 78  LAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKK 137
           L   L+    T    IMN +++ F SES ++ W+  SF L   +F  + G+L DI G K 
Sbjct: 44  LGSFLSSLDGTIVANIMNRVAEEF-SESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKS 102

Query: 138 MLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLG 175
            L+  +     + + C L+ ++ N   F   RA  G+G
Sbjct: 103 ALLTAH---FFFGIGCLLTCFARNVTEFSIARAICGIG 137

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 44/78 (56%), Gaps = 4/78 (5%)

Query: 93  IMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLI 152
           IMN +++ F SESDK+ W+  SF L   +F  + G+L D+ G K  L++ Y  +++  L+
Sbjct: 58  IMNRVAEEF-SESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVIGCLL 116

Query: 153 CGLSKYSNNDAFFITCRA 170
             L++   N   F   RA
Sbjct: 117 TCLAR---NVTEFAVARA 131

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 48/98 (48%), Gaps = 4/98 (4%)

Query: 78  LAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKK 137
           L    +    T    IMN +++ F +ESDK+ W+  SF L   +F  + G+L DI G K 
Sbjct: 51  LGSFFSSLDSTIVANIMNRVAEEF-AESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKF 109

Query: 138 MLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLG 175
            ++  +     + L C L+ ++ N   F   RA  G+G
Sbjct: 110 AVLTAH---FFFGLGCLLTCFAQNVTQFSIARAICGMG 144

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 81/424 (19%), Positives = 149/424 (35%), Gaps = 44/424 (10%)

Query: 80  QLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKML 139
            LLN AG    ++++  L +++  E    +W + S+ +     I   GRLGDI G   + 
Sbjct: 44  DLLNVAG---VISVIEDLGETYGLEYTTASWALTSYAITFAGLIAFMGRLGDIIGNSVLF 100

Query: 140 MIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKN 199
            I   +   +SL C L     N   F   RA QG+  A ++P    L+  +      +  
Sbjct: 101 TI---SGFFFSLFCLLCAVVTNFPAFAVLRALQGIAAAGLVPCGYALIPTLADPEDVQLF 157

Query: 200 LVISFIGACAPAXXXXXXXXXXXIVNEDSEQWPWVFY---------AFAIAFFLNMILAW 250
             +   G  +             + N     +  +FY         + A  FF   I   
Sbjct: 158 FAVVSCGFSSTIGIGLIIGGAFALTNVG---YKGIFYLSFAGMLLVSIAAFFFTYRIEEH 214

Query: 251 YSIPNNIPTNVHG----FSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISV 306
                +   ++H      S+D+ GS++ + G +L      +   + W          I +
Sbjct: 215 KFAEQDYEGSIHRPGKVASLDFVGSLIFISGSVLIVVGLTEGGES-WKRPVAYVPFTIGM 273

Query: 307 FFLVAFFVYEVKYAKV-------------------PLLPHAVTKNRHMIMILLAVFLGWG 347
            F   FF +   Y  +                    L+P  V    + I I L      G
Sbjct: 274 IFFCGFFAWNCSYQNLVIFLKKLGCDTSRYLEKVQVLIPRDVLFMTNFIPITLGFLCNGG 333

Query: 348 SFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALV 407
                 +    +   +   SP+  G      +I   I   + A    ++ P   +    +
Sbjct: 334 CLYSNIYIIDQYSQYVDKNSPLLAGVKLVPLIITMVIGNTICASKSVKLRPRIGVALGFL 393

Query: 408 AFDVGSIMFSVLPVKQS--FWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGS 465
           +   GSI+   L + +   +WK+ F  Q ++ FG  + +P +  ++    P   +G+A  
Sbjct: 394 SMVCGSIILIQLHLVEENLYWKIMFCSQILVGFGAAIFYPYALKLVVGDAPSGAKGIASG 453

Query: 466 LVNT 469
           +  T
Sbjct: 454 VTQT 457

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 47/98 (47%), Gaps = 4/98 (4%)

Query: 78  LAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKK 137
           L   L+    T    IMN +++ F SES K+ W+  SF L   +F  + G+L DI G + 
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLLTNTAFQPLYGKLSDIIGRRP 102

Query: 138 MLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLG 175
            L+        + L C ++ ++ N   F   RA  G+G
Sbjct: 103 ALLTAQ---FFFGLGCLMTCFARNVTEFSIARAVCGIG 137

>Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON}
           complement(9458..11311) [1854 nt, 618 aa]
          Length = 617

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 68/146 (46%), Gaps = 8/146 (5%)

Query: 260 NVHGFSMDWTGSVL--AVIGLILFNFVWNQAPTAGWGTAYIIALLIIS-VFFLVAFFVYE 316
           +V  + +D+ G +L  A  G IL  F         W TA+II   +I     L  F ++E
Sbjct: 281 DVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWE 340

Query: 317 VKYAKVPLLPHAVTKNRHMIMILLAVF---LGWGSFGIWTFYYMSFQLNLRHYSPVWTGG 373
           +K++KVPL P A+ K+R +   L+  F     W   G + +  +   +N    S      
Sbjct: 341 IKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITS 400

Query: 374 TY-FVFVIFGTIAAFMVALSIKRVGP 398
            Y FV VI GT+   +V + ++R  P
Sbjct: 401 LYSFVSVITGTLLG-LVIIKVRRTKP 425

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 49/93 (52%), Gaps = 1/93 (1%)

Query: 65  SFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFIL 124
           S  R  + I +  L   L     T   T+++ ++  FN E    +W+  ++ L + +F  
Sbjct: 56  SRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATFQP 114

Query: 125 ISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSK 157
           + G++ DI+G + +++I  +  I+  LICGLSK
Sbjct: 115 LYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 60/126 (47%), Gaps = 12/126 (9%)

Query: 58  QDPTYFSS--FGR------ELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQA 109
           QD   F S  FG+       L  +++  +A  L    +T    IMN +++ F  ES +  
Sbjct: 27  QDCKIFDSDEFGKLQEVMPRLPMLLSLWMANFLASMDRTIIANIMNSVTEEFK-ESHRIQ 85

Query: 110 WLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCR 169
           W+  SF L +  F  I G+L D+ G + +L++ Y   +   L C ++ Y+ N   F   R
Sbjct: 86  WVATSFLLTSTVFQPIYGKLSDVTGRRFVLVLAYSLFL---LGCLVTAYARNIWEFAFGR 142

Query: 170 AFQGLG 175
           A  G+G
Sbjct: 143 AICGIG 148

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 54/107 (50%), Gaps = 4/107 (3%)

Query: 69  ELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGR 128
           +L  +++  L   L+    T    IMN +++ F  ESDK+ W+  S+ L   +F  + G+
Sbjct: 36  KLPIVLSLWLGSFLSSLDGTIVANIMNRVAEEFQ-ESDKKQWIATSYLLTNTAFQPLYGK 94

Query: 129 LGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLG 175
           L D+ G K  ++  +     + L C L+ ++N+   F   RA  G+G
Sbjct: 95  LSDLTGRKFAVLTAH---FFFGLGCLLTCFANSVTQFAIARAICGVG 138

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 49/92 (53%), Gaps = 1/92 (1%)

Query: 65  SFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFIL 124
           S  R  + +++  L   L     T   T++  ++  FN E  + +W+  ++ L + +F  
Sbjct: 116 STARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFN-ELPRISWVATAYLLSSATFQP 174

Query: 125 ISGRLGDIYGLKKMLMIGYVTIIVWSLICGLS 156
           I G++ DI+G K +L+   +T  V SLICGLS
Sbjct: 175 IYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 274 AVIGLILFNFVWNQAPTAGWGTAYIIALLIIS-VFFLVAFFVYEVKYAKVPLLPHAVTKN 332
           A+ G+IL  F         W TA II   ++   F L  F V+E+K+A+ PL P    KN
Sbjct: 282 AIFGMILIPFTLAGGEEKVWSTARIIVPEVLGWAFALPLFLVWEIKFARYPLTPKDALKN 341

Query: 333 RHMIMILLAV 342
           R ++  L+ V
Sbjct: 342 RGIVSALVLV 351

>Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 70/148 (47%), Gaps = 22/148 (14%)

Query: 259 TNVHGFSMDWTGSVLAVI-----GLILFNFVWN---------QAPTAGWGTAYIIALLII 304
           ++V GF   W    +++I     GLIL  F ++              GW    +IA+ ++
Sbjct: 282 SHVSGFREYWELVKVSLIEIDAFGLILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVV 341

Query: 305 SVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFL----GWGSFGIWTFY-YMSF 359
              FL+++ V+EV +A  PLLP  V  NR  I  ++  F+    G+ S   +T Y ++  
Sbjct: 342 GGIFLISYVVFEVFFAPFPLLPKRVLMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVL 401

Query: 360 QLNLRHY---SPVWTGGTYFVFVIFGTI 384
            L+ R++   S   T G  F  V++G +
Sbjct: 402 NLSYRNWVYLSNTTTMGLCFFGVVWGAL 429

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 4/78 (5%)

Query: 93  IMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLI 152
           IMN +++ F  ESDK+ W+  SF L   +F  + G+L DI G K  L++ +     + L 
Sbjct: 74  IMNRVAEEFQ-ESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFALLVAHT---FFCLG 129

Query: 153 CGLSKYSNNDAFFITCRA 170
           C L+ ++ N   F   RA
Sbjct: 130 CLLTCFARNVTEFSIARA 147

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 55/109 (50%), Gaps = 2/109 (1%)

Query: 49  TQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQ 108
           T  + ++  +D     +  R ++    C L   L     T   T+++ ++  FN E  + 
Sbjct: 120 TATAVEAAKEDAGGLGATRRRVVMASMC-LGVFLAALDGTIVTTLLDHIASEFN-ELPRI 177

Query: 109 AWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSK 157
           +W+  ++ L + +F  + G+L DI+G + +L+   +   + +LICG+SK
Sbjct: 178 SWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSK 226

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 100/241 (41%), Gaps = 23/241 (9%)

Query: 255 NNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLV-AFF 313
            +IP       +DWTG+V  V+ L  F  V +      +G       LI  V  L  ++F
Sbjct: 331 RSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSL-----YGEDLPHLYLIFVVILLSGSYF 385

Query: 314 VY-EVKYAKVPLLPHAVTKNRHMIMILLA---VFLGWGSFGIWTFYYMSFQLNLRHYSPV 369
           +Y E+  A  P+LP    +NR ++   L+     +G  + G +   Y +  LN+    P 
Sbjct: 386 IYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNM---GPT 442

Query: 370 WTGGTY---FVFVIFGTIAAFMVALSIKRVGPA--FLLCFALVAFDVGSIMFSVLPVKQS 424
             G      F    FG++ A      +KR G    FLL F LV   +G +  S +    S
Sbjct: 443 DIGKRIVPSFFSTAFGSLGA---GYYMKRTGKYYWFLLAFCLVGV-LGQVQISYVTPSIS 498

Query: 425 FWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGAT 484
            W+  + +  I  FG  +    + + L   +P  +Q    S+     +  ++L + +G  
Sbjct: 499 TWR-QYCLYMIPGFGSAVLLTVTLLALIVAVPQRHQAATTSISYAFRSTGSTLGVSIGGA 557

Query: 485 V 485
           +
Sbjct: 558 I 558

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 77/184 (41%), Gaps = 33/184 (17%)

Query: 259 TNVHGFSMDWTGSVLAV--IGLILFNFVWNQAPTAGWGTAYIIALLIIS-VFFLVAFFVY 315
           T +  + +D+ G +LAV   GL+L  F         W TA II   ++  V    AF  +
Sbjct: 269 TEIFLWKLDFIGLLLAVAFFGLVLVPFTLAGGLNKKWKTARIIVPEVLGWVVAFPAFLTW 328

Query: 316 EVKYAKVPLLPHAVTKNRHMI-MILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGT 374
           E+K+AK PL P    K+R +   +++A+FL        T +YM                T
Sbjct: 329 EIKFAKYPLTPWKTVKDRGVFSALIIAIFLQ-------TAFYMQ--------------KT 367

Query: 375 YFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQ------SFWKL 428
           Y   ++   +A      S  R+   F    AL    +G ++  V   K+      + W L
Sbjct: 368 YMYTILL--VAVNQTKKSATRINSLFTFVTALSGTLLGLVIVKVRRTKEFIFFGIAVWFL 425

Query: 429 NFGM 432
           +FG+
Sbjct: 426 SFGL 429

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 93  IMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIG 142
           IMN +++ F+ ESDK+ W+  SF L   +F  + GR  DI G K  L+I 
Sbjct: 67  IMNKIAEEFH-ESDKKQWMATSFLLTNAAFQPLYGRCSDIVGRKCALLIA 115

>Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 60/135 (44%), Gaps = 6/135 (4%)

Query: 272 VLAVIGLILFNFVWNQAPTAGWGTAYIIALLIIS-VFFLVAFFVYEVKYAKVPLLPHAVT 330
           V A  G +L  F         W  A+II   +I  V  L  + V+EVKY++ PL P  + 
Sbjct: 291 VTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLI 350

Query: 331 KNRHMIMILLAVF---LGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTY-FVFVIFGTIAA 386
           K+R ++  L   F     W   G + +  +   ++    S       Y FV VI GTI  
Sbjct: 351 KDRGVLFALFIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILG 410

Query: 387 FMVALSIKRVGPAFL 401
           F++ + ++R  P  L
Sbjct: 411 FIL-IKVRRTKPFIL 424

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 89/398 (22%), Positives = 141/398 (35%), Gaps = 78/398 (19%)

Query: 52  SNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWL 111
           SNDSP     Y       L+  +T +   ++         TI++V+++ F + S K  WL
Sbjct: 27  SNDSPMGLSLYLCLASLTLVLFITALDILIVG--------TIIDVVAEQFGNYS-KTGWL 77

Query: 112 MASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAF 171
           +  + L      LI GR   I G +  L++  +     SLI  L+   N     I  R  
Sbjct: 78  VTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSLIAALASSMN---MLIFGRVV 134

Query: 172 QGLG------IAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAXXXXXXXXXXXIVN 225
            G+G      + F++   M        VG   + LVIS + +CA A              
Sbjct: 135 AGVGGSGLQTLCFVIGCTM--------VGERSRPLVISIL-SCAFAVAAIVGPIIGGAFT 185

Query: 226 EDSEQWPWVFY------AFAIAFFL----------------------NMILAWYSIPNNI 257
                W W FY        AI  FL                      +   + +    N 
Sbjct: 186 THVT-WRWCFYINLPIGGLAIIMFLLTYKAENKGILQQIKDAIGTISSFTFSKFRHQVNF 244

Query: 258 PTNVHG--FSMDWTGSVLAVIGLILF----NFVWNQAPTAGWGTAYIIALLIISVFFLVA 311
              ++G  F  D+ G  L   GL+LF     F  N+     W +  +I  L++ V   + 
Sbjct: 245 KRLMNGIIFKFDFFGFALCSAGLVLFLLGLTFGGNKYS---WNSGQVITYLVLGVLLFIF 301

Query: 312 FFVYEV-----------KYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQ 360
             VY+              +  PLL   +     +I++ +  FL    +     Y + F 
Sbjct: 302 SLVYDFFLFDKFNPEPDNISYRPLLLRRLVAKPAIIIVNMVTFLLCTGYNGQMIYSVQF- 360

Query: 361 LNLRHYSPVWTGGTYFV-FVIFGTIAAFMVALSIKRVG 397
             L   S  W  G + +  VI   IAA    +  K++G
Sbjct: 361 FQLIFASSAWKAGLHLIPIVITNVIAAIASGVITKKLG 398

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 2/91 (2%)

Query: 52  SNDSPWQDPTYFSSFGRELMFIVTCM-LAQLLNQAGQTHALTIMNVLSKSFNSESDKQAW 110
           SN+ P  DP    +       I+T + L   L+    T    IMN +++ FN+ + KQ W
Sbjct: 47  SNNKPKLDPITKYNLSLSKGPILTSLWLGSFLSALDATIVAVIMNRVAEDFNASNQKQ-W 105

Query: 111 LMASFPLVAGSFILISGRLGDIYGLKKMLMI 141
           +  S+ L   +F  + GRL DI G K   +I
Sbjct: 106 IATSYLLTNTAFQPLYGRLSDIIGRKYTQLI 136

>Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 61/135 (45%), Gaps = 6/135 (4%)

Query: 272 VLAVIGLILFNFVWNQAPTAGWGTAYIIALLIIS-VFFLVAFFVYEVKYAKVPLLPHAVT 330
           + A  G +L  F         W TA+II   +I  V  L  + ++E+KY++ PL P  + 
Sbjct: 291 ITAFFGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLI 350

Query: 331 KNRHMIMILLAVF---LGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTY-FVFVIFGTIAA 386
           K+R +   LL  F     W   G + +  +   ++    S       Y FV VI GTI  
Sbjct: 351 KDRGIFFALLIAFFINFNWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILG 410

Query: 387 FMVALSIKRVGPAFL 401
           F++ + ++R  P  L
Sbjct: 411 FIL-IKVRRTKPFIL 424

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 3/69 (4%)

Query: 92  TIMNVLSKSFNSESD---KQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIV 148
           TI++  S    SE +   K +W+  S+ L + +F  + G++ DI+G K +L+   V  ++
Sbjct: 129 TIVSTTSAHVASEFNQLSKVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLI 188

Query: 149 WSLICGLSK 157
             L+CGLSK
Sbjct: 189 GCLMCGLSK 197

>Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON}
           YEL065W (REAL)
          Length = 637

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 9/77 (11%)

Query: 277 GLILFNFVWN---------QAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPH 327
           GLIL  F ++              GW    +IA+ +I   FL+++ ++EV +A  PLLP 
Sbjct: 306 GLILLGFAFSLILLPCSLYSYAEGGWKNPSMIAMEVIGGIFLISYVIFEVFFAPFPLLPK 365

Query: 328 AVTKNRHMIMILLAVFL 344
            V  NR  I  ++  F+
Sbjct: 366 RVLVNRTFICCVVIDFI 382

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 3/67 (4%)

Query: 109 AWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITC 168
            WL+  + L    F+L+ GRL +I G K+ LMI  +   + SLI  L   SN+ A  I+ 
Sbjct: 46  GWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISAL---SNSMATLISG 102

Query: 169 RAFQGLG 175
           R   G G
Sbjct: 103 RVVAGFG 109

>Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 46/99 (46%), Gaps = 14/99 (14%)

Query: 260 NVHGFSMDWTGSVLAVI-----GLILFNFVWN---------QAPTAGWGTAYIIALLIIS 305
            + GF + W    +++I     GLIL  F ++              GW    +IA+ ++ 
Sbjct: 283 RIRGFKVYWELLKVSLIEIDAFGLILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVG 342

Query: 306 VFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFL 344
              L+++ V+EV +A  PLLP  V  NR  I  ++  F+
Sbjct: 343 GILLISYVVFEVFFAPFPLLPKRVLMNRTFICCVIIDFI 381

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%)

Query: 276 IGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNR 333
           +G IL         ++ W  + II  L++ V  L    VYE+K+A+ P+LP  + K+R
Sbjct: 322 LGCILVPLTLAGGTSSKWDDSQIIGPLVLGVVLLPMLIVYELKWAREPILPWKLIKDR 379

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 53/103 (51%), Gaps = 2/103 (1%)

Query: 73  IVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDI 132
           ++  ++   L+    T   T++  ++   ++ S + +W+  ++ L   +F  + G+L DI
Sbjct: 44  VLALLMGSFLSALDTTIVATLLPTIASDLDASS-QMSWIATAYLLSCSAFQPLYGKLSDI 102

Query: 133 YGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLG 175
           +G K +L++  +T  +   ICG S ++NN     T R   G+G
Sbjct: 103 FGRKILLILSNLTFALGCAICG-SPWTNNVWVLSTGRFVAGIG 144

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 45/98 (45%), Gaps = 4/98 (4%)

Query: 73  IVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDI 132
           +V+  L   L+    T    IMN +++ F    +KQ W+  SF L   +F  + G+L DI
Sbjct: 37  LVSLWLGSFLSSIDSTIVANIMNKVAEEFQESQEKQ-WIATSFLLTNTAFQPLYGKLSDI 95

Query: 133 YGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRA 170
            G K  L+     +  + L C L+  S N   F   RA
Sbjct: 96  TGRKFALL---TALSFFGLGCFLTSLSTNIKQFAIARA 130

>TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 67/141 (47%), Gaps = 10/141 (7%)

Query: 266 MDWTGSVLAVI--GLILFNFVWNQAPTAGWGTAYIIALLIIS-VFFLVAFFVYEVKYAKV 322
           +D+ G ++  +  G IL  F       + W TA+II   +I     L  F ++E+K+++ 
Sbjct: 283 LDFIGLLMLCVTFGCILIPFTLAGGLQSEWQTAHIIVPEVIGWCLALPLFLLWEIKFSRH 342

Query: 323 PLLPHAVTKNRHMIMILLAVF---LGWGSFG--IWTFYYMSFQLNLRHYSPVWTGGTYFV 377
           PL P A+ K+R +I  +   F     W   G  ++T   +S   +++  + + T    FV
Sbjct: 343 PLTPWALIKDRGIIFAIFIAFHINFCWYMQGDYMYTVLIVSVHESVKSATRI-TSLYSFV 401

Query: 378 FVIFGTIAAFMVALSIKRVGP 398
            VI GTI    +   I+R  P
Sbjct: 402 SVITGTILGMFIT-KIRRTKP 421

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 4/85 (4%)

Query: 91  LTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWS 150
           +TI+N ++  FN+ S K  WL+  + L    F L+ GR   I+G K  LM+  +   + S
Sbjct: 41  VTILNTIADKFNAYS-KIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGS 99

Query: 151 LICGLSKYSNNDAFFITCRAFQGLG 175
           L+  +   SN+    I  R   G G
Sbjct: 100 LVIAV---SNSMDMIIGGRVIAGCG 121

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 57/124 (45%), Gaps = 11/124 (8%)

Query: 53  NDSPWQDPTYFSSFGRELM------FIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESD 106
           ND P  D      + R+ M       +++  L   ++    T    IMN ++  F +ESD
Sbjct: 20  NDLP-DDTKLEQEYHRDNMALPKGPILLSLWLGSFVSALDGTVVANIMNSIAAEF-AESD 77

Query: 107 KQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFI 166
           K+ W+  S+ L   +F  + G+L DI G K  ++  +     ++L C L+ ++ N   F 
Sbjct: 78  KKQWIATSYLLTNTAFQPLYGKLSDITGRKVAVITAH---FFFALGCLLTCFAQNVTQFS 134

Query: 167 TCRA 170
             RA
Sbjct: 135 IARA 138

>KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 624

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 41/81 (50%), Gaps = 3/81 (3%)

Query: 266 MDWTGSVLAV--IGLILFNFVWNQAPTAGWGTAYIIALLIIS-VFFLVAFFVYEVKYAKV 322
           +D  G +L V  +G +L  F      +  W TA II   +I     L  F ++E K+A+ 
Sbjct: 268 LDSVGLILVVGALGCVLVPFTLAGGLSDKWRTAQIIVPEVIGWCVALPLFVLWEAKFARF 327

Query: 323 PLLPHAVTKNRHMIMILLAVF 343
           PL P +V K+R +I  L+  F
Sbjct: 328 PLTPRSVLKDRGVIAALVIAF 348

>Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)
          Length = 628

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 64/141 (45%), Gaps = 8/141 (5%)

Query: 265 SMDWTGSVLAVI--GLILFNFVWNQAPTAGWGTAYIIALLIIS-VFFLVAFFVYEVKYAK 321
            +D  G +L  +  G +L  F         W +A+II   +I  V  L  + ++E+KY++
Sbjct: 282 KLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSR 341

Query: 322 VPLLPHAVTKNRHMIMILLAVF---LGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTY-FV 377
            PL P  + K+R +   LL  F     W   G + +  +   ++    S       Y FV
Sbjct: 342 HPLTPWDLIKDRGIFFALLIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSFV 401

Query: 378 FVIFGTIAAFMVALSIKRVGP 398
            VI GTI  F++ + ++R  P
Sbjct: 402 SVIVGTILGFIL-IKVRRTKP 421

>SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa]
           {ON} similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C
          Length = 580

 Score = 38.1 bits (87), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 67/134 (50%), Gaps = 17/134 (12%)

Query: 407 VAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSL 466
           V F +G+I+ +     +SFW++  G + ++ FG+ +    S + +S+  P EY+G     
Sbjct: 156 VMFLIGAILQAC---TRSFWQMAAG-RLLMGFGIGIGSLLSPLFISEIAPSEYRGRL--- 208

Query: 467 VNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLET- 525
             TV+N   S C+  G  + + I      +  G+R  + + V + S+  LISF +  +T 
Sbjct: 209 --TVVN---SACITGGQLIAYGIGAGTSKIDNGWRILVAISV-VPSMIQLISFYFFPDTP 262

Query: 526 ---FWNNRRDRQKD 536
                NN+ +R KD
Sbjct: 263 RFYIMNNQPERAKD 276

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 50/106 (47%), Gaps = 11/106 (10%)

Query: 91  LTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWS 150
           +T+ + + + FN  ++   WLMA + L    F+L+ GR+  + GLK  LM   V     S
Sbjct: 28  ITLYDTIGQEFNDYANV-GWLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAGS 86

Query: 151 LICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGST 196
           L+ G    +N+    I  R   G G +       G+   VY VG++
Sbjct: 87  LMAG---AANSMGMLIGARVISGFGGS-------GIESLVYGVGTS 122

>Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W
           (REAL)
          Length = 561

 Score = 37.7 bits (86), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 69/150 (46%), Gaps = 6/150 (4%)

Query: 43  ASSNKSTQVSNDSPWQ-DPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSF 101
           A SN  ++V N+S ++ +P    S  ++++ +V C      +    +    ++ V+ K F
Sbjct: 37  AVSNSQSEVGNESDFELEPYSRFSHTQKMLLVVQCAFTGFFSTVAGSIYYPVLTVIEKKF 96

Query: 102 NSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLIC-GLSKYSN 160
           N   +     +  + +  G    I G L D +G + +++     ++ +   C GL+  S+
Sbjct: 97  NITEELANVTIVVYFVFQGLAPSIMGGLADTFGRRPVVLWA---VLTYCCACIGLAS-SH 152

Query: 161 NDAFFITCRAFQGLGIAFILPNVMGLVGHV 190
           N A  +  R  Q  GI+ ++    G++G V
Sbjct: 153 NYAQILALRCLQAAGISPVIAINSGIMGDV 182

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 37.7 bits (86), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 50/106 (47%), Gaps = 11/106 (10%)

Query: 91  LTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWS 150
           +T+   + + FN  +D   WL+  + L +  F L+ GR+  + GLK  LM+  +   + S
Sbjct: 64  VTLYETIGEKFNDYNDV-GWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGS 122

Query: 151 LICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGST 196
           LI  +   SN+    I  R   G G +       G+   VY VG++
Sbjct: 123 LIAAV---SNSMGMLIAGRVVAGAGGS-------GIQSLVYIVGTS 158

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 37.7 bits (86), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 4/78 (5%)

Query: 93  IMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLI 152
           IMN +++ F  ESDK+ W+  SF L   +F  + G+L DI G +  L+  +     + L 
Sbjct: 56  IMNRVAEEFE-ESDKKQWIATSFLLTNTAFQPLYGKLSDITGRRFALLTAH---FFFGLG 111

Query: 153 CGLSKYSNNDAFFITCRA 170
           C L+ ++ +   F   RA
Sbjct: 112 CLLTCFAQSVEQFALARA 129

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 37.4 bits (85), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 92  TIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSL 151
           T++  ++  FN E    +W+  ++ L + +F  + G++ DI+G K +L+   V   +  L
Sbjct: 151 TLLAHIASEFN-EMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCL 209

Query: 152 ICGLS 156
           ICGLS
Sbjct: 210 ICGLS 214

>KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C
          Length = 632

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 10/78 (12%)

Query: 274 AVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNR 333
           A +G IL         ++ W  + II + ++    +  FF++E K+A  P++P+ + K+R
Sbjct: 292 ASLGCILVPLTLAGGTSSKWRDSRIIGVFVLGFVLIPIFFIWEKKFATDPIVPYKLVKDR 351

Query: 334 HMIMILLAVFLGWGSFGI 351
            +          W S GI
Sbjct: 352 GV----------WASLGI 359

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 78/179 (43%), Gaps = 19/179 (10%)

Query: 94  MNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWS--L 151
           +  L K FN + +K    +  + L  G    +SG L D++G + +++ G V  +V S  L
Sbjct: 125 LRQLEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASIGL 184

Query: 152 ICGLSKYSNNDAFFITC--RAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACA 209
            C  S       + + C  R  Q +GI+  +    G+VG       T K+   +F+GA +
Sbjct: 185 ACAPS-------YGVICFLRCIQSIGISPTIAISSGVVGDF-----TLKHERGTFVGATS 232

Query: 210 PAXXXXXXXXXXXIVNEDSEQWPW--VFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSM 266
                        I    + +W W  +F+  AI   + +I+A +++P    T V   S+
Sbjct: 233 -GLVLLGQCFGSLIGAVLTARWDWRAIFWFLAIGSGVALIVAAFTLPETKRTIVGNLSI 290

>Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)
          Length = 534

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 34/67 (50%)

Query: 278 LILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIM 337
           L+L         T+ W   YIIA++++  F    F ++E+++AK P +P     +  + +
Sbjct: 287 LVLLPLTIAGGATSKWREGYIIAMIVVGGFLGFIFLIWELRFAKNPFIPRVYLGDPTIYV 346

Query: 338 ILLAVFL 344
            LL  F+
Sbjct: 347 ALLMEFV 353

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 4/84 (4%)

Query: 92  TIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSL 151
           TI+  +S+ FN E  K  WL+  + L      L+ GR   I G K  +++  +   V SL
Sbjct: 65  TIIETVSRDFN-EYSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEVGSL 123

Query: 152 ICGLSKYSNNDAFFITCRAFQGLG 175
           +  L+   N     I  R   G+G
Sbjct: 124 VSALANSMN---MLIGGRVISGVG 144

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 109 AWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITC 168
            WL+  + L    F+L+ GRL +I G  + LMI  +   V SLI  L   SN+    I+ 
Sbjct: 46  GWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVGSLISAL---SNSMGTLISG 102

Query: 169 RAFQGLG 175
           R   G G
Sbjct: 103 RLIAGFG 109

>TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {ON} 
          Length = 601

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 62/137 (45%), Gaps = 8/137 (5%)

Query: 266 MDWTGSVLAVI--GLILFNFVWNQAPTAGWGTAYIIALLIIS-VFFLVAFFVYEVKYAKV 322
           +D+ G +L  +  G IL  F         W TA II   +I  V  L  + ++E KYA+ 
Sbjct: 264 LDFPGLILICVTFGCILIPFTLGGGLNEKWKTAGIIVPEVIGWVVALPLYMIWESKYARH 323

Query: 323 PLLPHAVTKNRHMIMILLAVF---LGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTY-FVF 378
           PL P  + K+R +   L+  F     W   G + F  +   +N  + S       Y FV 
Sbjct: 324 PLTPWKLIKDRGIFSALIIAFHINFIWYMQGDYMFTVLRVAVNESNSSAQRITSLYSFVS 383

Query: 379 VIFGTIAAFMVALSIKR 395
           VI GT+   +V + ++R
Sbjct: 384 VITGTLLG-LVIVKVRR 399

>Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 bp,
           602 aa] {ON} ANNOTATED BY YGOB -
          Length = 602

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 63/154 (40%), Gaps = 8/154 (5%)

Query: 44  SSNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNS 103
           +S KS    +  P+   T FS   + L  +V C L+   +   QT     ++++ K FN 
Sbjct: 62  NSTKSETNFDGIPY---TRFSKHDK-LFLVVICALSGFYSTIAQTIYFPALSIIEKEFNV 117

Query: 104 ESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDA 163
                   +  + L  G F +I G L D  G + + M     I+V+   C          
Sbjct: 118 SVSLVNVTVVVYSLCQGIFPVIMGGLADRLGRRPVAMF---CIMVYFCACIGIACCRTFG 174

Query: 164 FFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTR 197
             I  R  QG GI+ I+    GL+G +  V S R
Sbjct: 175 EMIFLRCLQGGGISPIIAINNGLMGDI-TVKSER 207

>TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432
          Length = 649

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 43/95 (45%), Gaps = 15/95 (15%)

Query: 124 LISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFIL--- 180
           L+S  + D  G K  L   +V+ I+W + CG+   S   A  +  R   G+GI F +   
Sbjct: 83  LLSPSVSDALGRKCSL---HVSCILWCIGCGIQSGSTGVAMLVVGRVIAGVGIGFGVAAA 139

Query: 181 ---------PNVMGLVGHVYKVGSTRKNLVISFIG 206
                    P V G V  ++++  T   LV+ FIG
Sbjct: 140 PMYCVELAPPRVRGTVVGIFQLAVTAGILVLFFIG 174

>TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.242
           YNL065W
          Length = 529

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 60/145 (41%), Gaps = 7/145 (4%)

Query: 45  SNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSE 104
            N  T   N++P+       S+G++   +    +    +  G       +  L K FN +
Sbjct: 42  ENNGTISRNEAPYT----LLSYGQKWGMVALLTMCTFWSSLGSPIYYPALRQLEKEFNID 97

Query: 105 SDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAF 164
            DK    +  + L  G     SG L DIYG + +++IG +  +  S+  GL+  SN+   
Sbjct: 98  EDKVNVTVVVYLLFQGIAPTFSGGLADIYGRRPVIVIGMIIYVAVSV--GLA-CSNSYGV 154

Query: 165 FITCRAFQGLGIAFILPNVMGLVGH 189
            +  R  Q   I+  +    G VG 
Sbjct: 155 LVFLRILQSACISPTIAISSGFVGD 179

>SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {ON}
           similar to uniprot|P38358 Saccharomyces cerevisiae
           YBR293W VBA2 Permease of basic amino acids in the
           vacuolar membrane
          Length = 573

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 86/190 (45%), Gaps = 11/190 (5%)

Query: 266 MDWTGSVLAVIGL---ILFNFVWNQAPTAG--WGTAYIIALLIISVFFLVAFFVYEVKYA 320
           +D  GS+L ++GL   +++  V +   ++G  W +   I L++++V  LV F   E    
Sbjct: 244 IDLKGSLLLIVGLASQLMYLTVNSSMASSGSQWLSKESIGLILLTVLSLVMFIHTERTTQ 303

Query: 321 KVPLLPHAVTKNRHMIMIL-LAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFV 379
             P++P  +    H  M+L ++V +G+ S+       + FQ+ +   S    G    +  
Sbjct: 304 ANPIIPTKLLSQSHSTMVLVISVLVGFVSYAYLFTLPLFFQIVVGD-SAARAGFRLAIPS 362

Query: 380 IFGTIAAFMVALSIK--RVGPAFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILC 437
               I   +  LS++  +  P FLL F +V   +G+  F +L      W +   +     
Sbjct: 363 FCTPIGGLITGLSMRIPKTLP-FLLSFGMVLMMIGNAFFLLLKTTTPEWLVCLLLTPA-N 420

Query: 438 FGMDLSFPAS 447
            G  ++FPA+
Sbjct: 421 VGQGVTFPAT 430

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 49/107 (45%), Gaps = 7/107 (6%)

Query: 51  VSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAW 110
           + ND     PT      R  + + +  L   L+    T   T++  +   FN E  + +W
Sbjct: 82  LDNDKNNLSPT------RLRLAMSSMYLGIFLSALDNTIVSTLLARIGSEFN-ELPRISW 134

Query: 111 LMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSK 157
           +  ++ L + +F  + G++ DI+G K +L    V   +  LICG +K
Sbjct: 135 IATAYLLSSATFQPLYGKISDIFGRKIVLTFCNVNFFIGCLICGTAK 181

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 109/244 (44%), Gaps = 32/244 (13%)

Query: 265 SMDWTGSVLAVIGLILFNFVWNQAPTA-GWGTAYIIALLIISVFFLVAFFVYEVKYAKVP 323
           ++DW G++  VI L+ F  + +   +     +   + L +ISV   ++F   E+K+AK P
Sbjct: 305 TIDWYGAMSLVIFLLSFMILSSAGGSDISVKSNTFLYLTLISVTSFISFIYIELKFAKDP 364

Query: 324 LLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTY-------- 375
           +LP    K+R    +L +    W  F +     +S+ L + +++ V   G Y        
Sbjct: 365 ILPLVFLKDRS---VLGSSLSNW--FTMMLLMTISYYLPI-YFTSVMGIGAYDVGKRTLP 418

Query: 376 -FVFVIFGTIAAFMVALSIKRVGPA--FLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGM 432
            F  V FG++ A      +K+ G    F+  F LV   +G +   ++    S W+     
Sbjct: 419 NFFSVAFGSLGA---GYYMKKTGKYYWFVTFFCLVVV-IGCLQIYLINDGISVWR----- 469

Query: 433 QAILCF--GMDLSFPASSIILS--DGLPMEYQGMAGSLVNTVINYSASLCLGMGATV-EH 487
           Q +L F  G+  +   +  +LS    +P EYQ +  S+     +   +L + +GA +   
Sbjct: 470 QYLLSFVPGLGAAVLITIALLSMIVAVPHEYQAVTTSISYAFRSTGCTLGVSIGAALFRD 529

Query: 488 QINK 491
            +NK
Sbjct: 530 SLNK 533

>KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 639

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 31/61 (50%)

Query: 273 LAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKN 332
           +A +G IL         ++ W    I+   I+    + AF ++E KYA++P+ P  + K+
Sbjct: 305 VAFLGCILVPLTLAGGVSSQWSNGKILGPFILGFCLVPAFILWETKYARLPIAPFKMLKD 364

Query: 333 R 333
           R
Sbjct: 365 R 365

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 42/92 (45%), Gaps = 3/92 (3%)

Query: 71  MFIVTCM--LAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGR 128
           M I+ C   L   L     T   T+M  +   FN +  K  W+  S+ L +  F  + G+
Sbjct: 396 MNIIMCSMYLGVFLAALDNTVVSTLMAHIGSEFN-QIPKVPWVATSYLLSSAVFQPLYGK 454

Query: 129 LGDIYGLKKMLMIGYVTIIVWSLICGLSKYSN 160
           L DI+G K +L+   +      +ICG+S   N
Sbjct: 455 LSDIFGRKALLIFSNLIFFFGCIICGMSNSLN 486

>KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 277 GLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVY-EVKYAKVPLLPHAVTKNRHM 335
           G IL         +  W +A +IA L++    LV FF+Y E K A VPL P  + K+R +
Sbjct: 299 GCILIPLTIAGGASTHWRSAKVIAPLVLGSL-LVPFFIYWESKLALVPLAPFKMLKDRGI 357

Query: 336 IMILLAVFL 344
              LL  FL
Sbjct: 358 WAPLLITFL 366

>KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 620

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 277 GLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVY-EVKYAKVPLLPHAVTKNRHM 335
           G IL         +  W +A +IA L++    LV FF+Y E K A VPL P  + K+R +
Sbjct: 299 GCILIPLTIAGGASTHWRSAKVIAPLVLGSL-LVPFFIYWESKLALVPLAPFKMLKDRGI 357

Query: 336 IMILLAVFL 344
              LL  FL
Sbjct: 358 WAPLLITFL 366

>Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106W
           (REAL)
          Length = 440

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 43/108 (39%), Gaps = 12/108 (11%)

Query: 264 FSMDWTGSVLAVI--GLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAK 321
           + +D  G VL  +  G IL         +  W ++ II  L+      + F  +E  YA 
Sbjct: 137 WELDVIGIVLITVSTGCILVPLTLAAGASEKWRSSKIIGTLVSGGVLFLIFMFWEASYAH 196

Query: 322 VPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPV 369
            PLLP  + K+R +          W   G+  F Y +F +      PV
Sbjct: 197 NPLLPFKLLKDRGI----------WAPLGVAFFNYFTFYIACDFLYPV 234

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 3/83 (3%)

Query: 93  IMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLI 152
           +MN +++ F  ESDK+ W+  SF L   +F  + G+L D+   +K+  +         LI
Sbjct: 63  VMNRIAEEFQ-ESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRKLATLIAQFFFFLGLI 121

Query: 153 CGLSKYSNNDAFFITCRAFQGLG 175
             +S ++ N   F   RA  G+G
Sbjct: 122 --ISCFAQNVTQFAIGRAVCGIG 142

>SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%)

Query: 277 GLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMI 336
           G IL         +  W +A +IA +++    + AF  +E K A VPL P  + K+R + 
Sbjct: 299 GCILIPLTVAGGASTHWRSAKVIAPIVLGSVLVPAFIYWESKLALVPLAPFKMLKDRGIW 358

Query: 337 MILLAVFL 344
             LL  FL
Sbjct: 359 APLLITFL 366

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 59/142 (41%), Gaps = 17/142 (11%)

Query: 44  SSNKSTQVSNDSPWQDPTYFSSFGRE----------LMFIVTCMLAQLLNQAGQTHALTI 93
           +   ++ VS  S  ++P   ++FG+           L  +V C+    L+    +   TI
Sbjct: 10  TRGDASSVSTGSVKEEPVRTNAFGQRFPTGVELWAPLGSLVLCLFLAALDVMTVS---TI 66

Query: 94  MNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLIC 153
           +  +S+ F   S K  WL   + L     +LI GR+  + G K   +   V   V SL+ 
Sbjct: 67  IEEVSQKFGDYS-KVGWLFTGYSLPNALLVLIWGRIATLVGFKTSTLAAIVIFEVGSLVS 125

Query: 154 GLSKYSNNDAFFITCRAFQGLG 175
            L   +N+    I  R   G+G
Sbjct: 126 AL---ANSMDMLIGGRVIAGIG 144

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 31/67 (46%), Gaps = 3/67 (4%)

Query: 109 AWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITC 168
            WL+  + L    F+L+ GRL +I G  + LMI  V   + SLI  L   SN     I  
Sbjct: 46  GWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIFEIGSLISAL---SNTMGTLIGG 102

Query: 169 RAFQGLG 175
           R   G G
Sbjct: 103 RVIAGFG 109

>Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL065W
           (SIT1) - Ferrioxamine B permease [contig 8] FULL
          Length = 591

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 39/78 (50%), Gaps = 3/78 (3%)

Query: 259 TNVHGFSMDWTGSVLA--VIGLILFNFVWNQAPTAGWGTAYIIALLIIS-VFFLVAFFVY 315
           T V  + +D  G ++   V G IL  F    +    W TA II   +I     L  F ++
Sbjct: 249 TEVFFWRLDAVGLIMVCVVFGCILIPFTLAGSLKDKWQTAEIIVPEVIGWCVALPLFLLW 308

Query: 316 EVKYAKVPLLPHAVTKNR 333
           E+K+AK PL+P  V K+R
Sbjct: 309 EMKFAKHPLVPWNVIKDR 326

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 34.7 bits (78), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 58/144 (40%), Gaps = 17/144 (11%)

Query: 44  SSNKSTQVSNDSPWQDPTYFSSFGRELM--------FIVTCMLAQLLNQAGQTHAL---- 91
            S    +VSN    + P + S +G+  M         + TC  +  L        +    
Sbjct: 41  ESGTDAEVSNHVE-KKPNFNSKYGKNAMGEDLPSGIVLYTCAFSLALAIFLAALDIMIVS 99

Query: 92  TIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSL 151
           TI+  ++K F + S K  W+ A + L      L+ GR+  I G K  ++   +   + SL
Sbjct: 100 TIIEDVAKKFGAYS-KTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSL 158

Query: 152 ICGLSKYSNNDAFFITCRAFQGLG 175
           I G++   N     I  R   G+G
Sbjct: 159 ISGVANSMN---MLIGGRVIAGVG 179

>SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 34.7 bits (78), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%)

Query: 277 GLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMI 336
           G IL         +  W +A IIA +++    ++ F  +E K A VPL P  + K+R + 
Sbjct: 299 GCILVPLTIAGGVSTQWRSAKIIAPIVLGSVLVLVFIYWESKLALVPLAPFKMLKDRGIW 358

Query: 337 MILLAVFL 344
             LL +FL
Sbjct: 359 APLLLMFL 366

>SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} similar
           to uniprot|P39980 Saccharomyces cerevisiae YEL065W SIT1
           Ferrioxamine B transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 611

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 58/130 (44%), Gaps = 6/130 (4%)

Query: 277 GLILFNFVWNQAPTAGWGTAYIIALLIIS-VFFLVAFFVYEVKYAKVPLLPHAVTKNRHM 335
           GL+L  F         W +A II   ++     L  F ++E KYA+ PL P  + K+R +
Sbjct: 277 GLVLIPFTLAGGLQTKWKSASIIVPEVLGWCLALPLFLLWEGKYARNPLTPWDLIKDRGI 336

Query: 336 IMILLAVFL---GWGSFGIWTFYYMSFQLNLRHYSPVWTGGTY-FVFVIFGTIAAFMVAL 391
              L+  FL    W   G + +  +   ++    S       Y FV VI GT+  F++ +
Sbjct: 337 FSALIIAFLINFIWYMQGDYMYTVLIVAVHESIKSATRIVSLYSFVSVITGTLLGFVI-V 395

Query: 392 SIKRVGPAFL 401
            ++R  P  L
Sbjct: 396 KVRRTKPFIL 405

>NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score = 34.3 bits (77), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 3/73 (4%)

Query: 264 FSMDWTGSVLAVI--GLILFNFVWNQAPTAGWGTAYIIALLIIS-VFFLVAFFVYEVKYA 320
           + +D  G +L V   G +L  F       + W TA+II   +I  V  L  + ++E+K++
Sbjct: 269 WKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFS 328

Query: 321 KVPLLPHAVTKNR 333
           K PL P A+ K+R
Sbjct: 329 KHPLTPWALLKDR 341

>KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]
           {ON} similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 607

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 34/75 (45%), Gaps = 10/75 (13%)

Query: 276 IGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHM 335
           +G IL          + W   ++I  L++    L  F ++E K AK P++P+ + K+R +
Sbjct: 281 VGCILAPLTLAGGVKSKWSNPHLIGPLVLGFVLLPLFMIWESKAAKYPVVPYGLIKDRAV 340

Query: 336 IMILLAVFLGWGSFG 350
                     WG+ G
Sbjct: 341 ----------WGALG 345

>NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 49/102 (48%), Gaps = 8/102 (7%)

Query: 251 YSIPNNIPT-----NVHGFSMDWTGSVLAVI--GLILFNFVWNQAPTAGWGTAYIIALLI 303
           ++IP ++       +V  + +D  G +L V   G +L  F         W TA+II   +
Sbjct: 259 FTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEV 318

Query: 304 IS-VFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFL 344
           I     L  + ++E+K+++ PL P  + K+R +   L+  FL
Sbjct: 319 IGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFL 360

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 70/163 (42%), Gaps = 8/163 (4%)

Query: 47  KSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESD 106
           +S+ V++  P   P    S G++   +     A   +  G       +  L K FN   +
Sbjct: 63  ESSGVNSKLPQGAPFTLLSHGQKWFMVALLTSAGFWSSLGSPIYYPALKQLEKKFNVSEE 122

Query: 107 KQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFI 166
                +  + +  G    ISG L D+YG + ++++G +  +  S+  GL+  S +    +
Sbjct: 123 MVNITVVVYLIFQGIAPTISGGLADVYGRRPVILMGMLIYVCASI--GLA-CSQSYGVIV 179

Query: 167 TCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACA 209
             R  Q  GI+ I+    G+VG       T K+   +F+GA +
Sbjct: 180 FLRCLQSAGISPIIAINSGVVGDF-----TLKHERGTFVGAVS 217

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 81/354 (22%), Positives = 131/354 (37%), Gaps = 62/354 (17%)

Query: 92  TIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSL 151
           TI++V+++ F + S K  WL+  + L      L+ GR   I G +  L++  +     SL
Sbjct: 57  TIIDVVAEQFGNYS-KTGWLVTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAGSL 115

Query: 152 ICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPA 211
           +  L+   N     +             L  +  ++G    V    + LVIS + +CA A
Sbjct: 116 VAALANSMN----MLIVGRVVAGVGGSGLQTLCFVIGCTM-VNERSRPLVISIL-SCAFA 169

Query: 212 XXXXXXXXXXXIVNEDSEQWPWVFY------AFAIAFFL--------NMI---------- 247
                              W W FY       FA+  FL        N++          
Sbjct: 170 VAAIVGPIIGGAFTTHV-TWRWCFYINLPIGGFAVIMFLLTYKTKSENILQQTRNILGRI 228

Query: 248 ----LAWYSIPNNIPTNVHG--FSMDWTGSVLAVIGLILF----NFVWNQAPTAGWGTAY 297
               L   + P N+   + G  F  D+ G  L+  GL+LF     F  N+     W +  
Sbjct: 229 SKFELRRLTEPGNLRKALIGILFKFDFLGFALSSAGLVLFLLGLTFGGNKYS---WNSGQ 285

Query: 298 IIALLIISVFFLV-----AFFVYEVKYAKVP--------LLPHAVTKNRHMIMILLAVFL 344
           II  L++ +   V      FF+++ K+   P         L   V K   +I+ ++   L
Sbjct: 286 IITYLVLGILLFVFSLIYDFFIFQ-KFNPEPDNTSYRPLFLKRLVAKPAVIIVNMVTFLL 344

Query: 345 GWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFV-FVIFGTIAAFMVALSIKRVG 397
             G  G   +    FQL     S  W  G + +  VI   IAA    +  K++G
Sbjct: 345 CIGYNGQMIYSVQFFQLIFA--SSAWKAGLHLIPIVITNVIAAIASGVITKKLG 396

>YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}
           GEX2Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; expressed at a very low
           level; almost identical to paralog Gex1p; potential role
           in resistance to oxidative stress and modulation of the
           PKA pathway
          Length = 615

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 26/58 (44%)

Query: 276 IGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNR 333
           +G IL         +  W  + IIA L+        F  +E K+AK PLLP  +  +R
Sbjct: 286 LGCILVPLTLANETSQKWHNSKIIATLVSGGCLFFIFLYWEAKFAKSPLLPFKLLSDR 343

>TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON} 
          Length = 732

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%)

Query: 274 AVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNR 333
           A IGLIL          + W    +IA  +I    +  F ++E  +AK P++P  + K+R
Sbjct: 338 AFIGLILIPLTLAGGTKSRWSEGKLIAPFVIGCVMVPCFAIWEKWFAKHPIMPWRLIKDR 397

Query: 334 HM 335
            +
Sbjct: 398 SI 399

>SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 629

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%)

Query: 271 SVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVT 330
           S++ ++GLIL         TA W TA +I  LI+   ++  F  +E + A  P+ P  + 
Sbjct: 296 SLMIILGLILTPLTLAGGETAEWRTAKVIVPLILGFCWIPVFAFWENRIATHPIAPTDMF 355

Query: 331 KNR 333
           ++R
Sbjct: 356 RDR 358

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 60/135 (44%), Gaps = 15/135 (11%)

Query: 231 WPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSM-----------DWTGSVLAVIGLI 279
           W W F        ++ IL  Y +PN    N    S+           D  GS+L + GL 
Sbjct: 120 WRWCFLIQVPISVISSILMNYYVPNQKEYNRQNSSIFQNPGKILRDIDVMGSILIITGLT 179

Query: 280 LFNFVWNQAPTAG---WGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMI 336
           L     +   +     W +  ++ LL+ SV  L+ F ++E K +   ++P  +  + + +
Sbjct: 180 LQLLYLSLGCSTSKLSWTSPSVLLLLVGSVIILLLFILHERKTSARAIIPMELVNSSYSV 239

Query: 337 MIL-LAVFLGWGSFG 350
           ++L +++ +G+ S+ 
Sbjct: 240 VVLSISILVGFASYA 254

>YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}
           GEX1Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; imports glutathione from
           the vacuole and exports it through the plasma membrane;
           has a role in resistance to oxidative stress and
           modulation of the PKA pathway
          Length = 615

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 26/58 (44%)

Query: 276 IGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNR 333
           +G IL         +  W  + IIA L+        F  +E K+AK PLLP  +  +R
Sbjct: 286 LGCILVPLTLANETSQKWHNSKIIATLVSGGCLFFIFLYWEAKFAKSPLLPFKLLSDR 343

>NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 77/360 (21%), Positives = 139/360 (38%), Gaps = 69/360 (19%)

Query: 44  SSNKSTQVSNDSPWQD----PTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSK 99
           SS + +Q++ D+   +      Y+S+  R L+F  +  L         T+  T+   +  
Sbjct: 29  SSTEESQINYDTGVINIEVYSEYYSTTQRRLLFFFSIFLT--------TYCYTLDKRVRS 80

Query: 100 SFNSE---SDKQAWLMASFP----LVAGSFILISGRLGDIYGLKKMLMIG----YVTIIV 148
           +F +E   S K   LM++      +++ +  +   R  DI+G   ++        +  +V
Sbjct: 81  TFQTEATSSYKNHSLMSTVTCITTVISAAGQIAYARAADIFGRTSLVFTAIFFYVIGTVV 140

Query: 149 WSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGAC 208
            S    +++Y+    F+        LG A I+  +  L            NL    + + 
Sbjct: 141 ESQATNITRYAVGACFY-------SLGHAAIVLALEVLAADF-------SNLNYRILASA 186

Query: 209 APAXXXXXXXXXXXIVNED-SEQWPWVFYAFAIAF-----------FLNMILAWY----- 251
           AP             +  D  + W W    +AI F           F    LA Y     
Sbjct: 187 APMLPNVINTWISGNITSDIGDHWQWGIGMWAIIFPVCCIPLLFCLFHMRYLAQYKHNRR 246

Query: 252 ------SIPNNIPT-----NVHGFSMDWTGSVLAVI--GLILFNFVWNQAPTAGWGTAYI 298
                 +IP N+       +V  + +D  G +L VI    +L  F      T  W +A I
Sbjct: 247 ELRSFSTIPPNMTRMEYFIDVFFWRLDILGLLLGVIFFACVLIPFTLAAKATDKWKSASI 306

Query: 299 IALLIISVFFLVAFFVY-EVKYAKVPLLPHAVTKNRHMI-MILLAVFLGWGSFGIWTFYY 356
           I   +I     +  +++ E K+AK PL P  + K+R +   +L+A+FL +  +   T+ Y
Sbjct: 307 IVPEVIGWLVALPLYIFWEWKFAKFPLTPWNLVKDRGVYGGLLIALFLDFAYYVQSTYKY 366

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 63/138 (45%), Gaps = 15/138 (10%)

Query: 76  CMLAQLLNQAGQTHAL------TIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRL 129
           CM+A LL  AG   +L        +  L K F+   +     +  + +  G    ISG L
Sbjct: 87  CMVA-LLTSAGFWSSLGSPIYYPALKQLEKQFSVSEELVNITVVVYLIFQGVAPTISGGL 145

Query: 130 GDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGH 189
            D+YG + +++IG +  +  S+  GL+  SN+    +  R  Q  GI+ I+    G+VG 
Sbjct: 146 ADVYGRRPVILIGMLIYVCASI--GLA-CSNSYGVIVFLRCLQSAGISPIIAINSGVVGD 202

Query: 190 VYKVGSTRKNLVISFIGA 207
                 T K    +F+GA
Sbjct: 203 F-----TVKQERGTFVGA 215

>Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C
           (REAL)
          Length = 610

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 41/107 (38%), Gaps = 12/107 (11%)

Query: 265 SMDWTGSVLAVI--GLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKV 322
            +D  G +L  +  G +L         +  W ++ II  L+        F  +E  YAK 
Sbjct: 268 ELDSIGIILITVSLGCVLVPLTLANGVSQKWHSSKIIGTLVFGGVLFCIFVFWETAYAKN 327

Query: 323 PLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPV 369
           PLLP  +  +R +          W   G+  F Y +F +      PV
Sbjct: 328 PLLPFKLLGDRGI----------WAPLGVAFFNYFTFFIACDFLYPV 364

>Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C -
           1:1 [contig 55] FULL
          Length = 559

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 93  IMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKK 137
           +MN +++ F  ESDK+ W+  SF L   +F  + G+L D+   +K
Sbjct: 63  VMNRIAEEFQ-ESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRK 106

>Ecym_4506 Chr4 complement(1013521..1015467) [1947 bp, 648 aa] {ON}
           similar to Ashbya gossypii ACL172C
          Length = 648

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/60 (20%), Positives = 29/60 (48%)

Query: 376 FVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAI 435
            V ++   +A F+    + ++GP + L    +   VG +   +L  +  +W+ N+ +Q +
Sbjct: 584 LVRMLLAAVAVFVTEPMLNKIGPGWALTILEIIISVGGLSLIILKSRSDYWRANYDLQRL 643

>Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)
          Length = 605

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 30/55 (54%)

Query: 290 TAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFL 344
           T+ W   YIIA++++       F ++E+++AK P +P     +  + + LL  F+
Sbjct: 303 TSKWREGYIIAMIVVGGCLGFIFLIWELRFAKNPFIPRVYLGDPTIYVALLMEFV 357

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 44/83 (53%), Gaps = 8/83 (9%)

Query: 125 ISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVM 184
           ISG L D+YG + +++ G +  +V S+  GL+  SN+    +  R  Q  GI+ ++    
Sbjct: 152 ISGGLADVYGRRPIILAGMLIYVVASI--GLA-CSNSYGVIVFLRCVQSAGISPLIAISS 208

Query: 185 GLVGHVYKVGSTRKNLVISFIGA 207
           G+VG       T K+   SF+GA
Sbjct: 209 GVVGDF-----TTKSERGSFVGA 226

>CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040c ARN1
           or uniprot|P38724 Saccharomyces cerevisiae YHL047c TAF1
          Length = 645

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/91 (18%), Positives = 40/91 (43%), Gaps = 16/91 (17%)

Query: 276 IGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHM 335
           +G IL          + W  +++I   ++    +    ++E K+A+ P++P+ + K+R  
Sbjct: 318 LGCILVPLTLAGGTKSKWNNSHVIGPFVLGFVLIPILVLWEYKFARDPIIPYKLVKDR-- 375

Query: 336 IMILLAVFLGWGSFGIWTFYYMSFQLNLRHY 366
                         G+W  + +SF ++  +Y
Sbjct: 376 --------------GVWASFAISFLIDFIYY 392

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 4/84 (4%)

Query: 92  TIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSL 151
           TI+  +++ F   S K  W+ A + L +    LI GR+  + G K  ++   +   V SL
Sbjct: 77  TIIENVAREFGDYS-KTGWIYAGYSLPSALLTLIWGRIAAVCGFKSSMLTAIIIFEVGSL 135

Query: 152 ICGLSKYSNNDAFFITCRAFQGLG 175
           +  L   +N+    I  R   GLG
Sbjct: 136 VAAL---ANSMDMLIGGRVIAGLG 156

>SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 617

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 276 IGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVY-EVKYAKVPLLPHAVTKNR 333
           +G IL         ++ W  + II  L++  F LV  F+Y E K+AK PL P  + K+R
Sbjct: 290 LGCILVPLTLAGGSSSKWQNSEIIGPLVLG-FVLVPVFIYWESKWAKDPLAPFELLKDR 347

>Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C
           (ARN1) - Product of gene unknown [contig 187] FULL
          Length = 610

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 35/71 (49%)

Query: 274 AVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNR 333
           A IG +L          + W    +I+  ++    L  F ++E K+A+ P++P+ + K+R
Sbjct: 282 ASIGCVLAPLTLAGGTGSKWQNPRVISPFVLGFVLLPIFLIWEKKWARDPIIPYDLIKDR 341

Query: 334 HMIMILLAVFL 344
            +   L + FL
Sbjct: 342 AVWASLNSQFL 352

>YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}
           ENB1Endosomal ferric enterobactin transporter, expressed
           under conditions of iron deprivation; member of the
           major facilitator superfamily; expression is regulated
           by Rcs1p and affected by chloroquine treatment
          Length = 606

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 33/67 (49%)

Query: 278 LILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIM 337
           L+L         T+ W   +IIA++++       F ++E+K+AK P +P     +  + +
Sbjct: 292 LVLLPLTIAGGATSKWREGHIIAMIVVGGCLGFIFLIWELKFAKNPFIPRVYLGDPTIYV 351

Query: 338 ILLAVFL 344
            LL  F+
Sbjct: 352 ALLMEFV 358

>Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C
           (ARN2) - 1:1 [contig 275] FULL
          Length = 618

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 34/69 (49%), Gaps = 2/69 (2%)

Query: 277 GLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVY-EVKYAKVPLLPHAVTKNRHM 335
           G IL         +  W +A +IA  ++  F LV  F+Y E K A VPL P  + K+R +
Sbjct: 297 GCILVPLTLAGGASTQWRSAKVIAPFVLG-FLLVPVFIYWESKLALVPLAPFKMLKDRGI 355

Query: 336 IMILLAVFL 344
              L+  FL
Sbjct: 356 WAPLVITFL 364

>NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON} 
          Length = 452

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 36/72 (50%), Gaps = 2/72 (2%)

Query: 264 FSMDWTGSVL--AVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAK 321
           + +D  G++L  A +G IL          + W  + +I   ++    +    V+E K+A+
Sbjct: 278 WKLDIIGTLLFTACLGCILVPLTLAGGTNSKWNNSRVIGPFVLGFVLIPILGVWEYKWAR 337

Query: 322 VPLLPHAVTKNR 333
            PL+P+ + ++R
Sbjct: 338 DPLIPYKLVRDR 349

>KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 634

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 2/71 (2%)

Query: 275 VIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFV-YEVKYAKVPLLPHAVTKNR 333
           ++G IL         +  W   +IIA  I+  F L+ FF+ +E K+A+ P+ P  + ++R
Sbjct: 306 ILGCILVPLTLAGGISNKWNNPHIIAPFILG-FVLIPFFIAWESKWAREPIAPFKLLRDR 364

Query: 334 HMIMILLAVFL 344
            +   L   FL
Sbjct: 365 GIWAALCIAFL 375

>KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 615

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 83/215 (38%), Gaps = 47/215 (21%)

Query: 272 VLAVIGLILFNFVWNQAPTAGWGTAYIIALLIIS-VFFLVAFFVYEVKYAKVPLLPHAVT 330
           V  V G IL  F    +  + W  A II   +I     L  F ++E KY++ PL+P ++ 
Sbjct: 284 VCVVFGCILVPFTLAGSLQSKWKRAEIIVPEVIGWCVALPLFLLWEGKYSRHPLVPWSLV 343

Query: 331 KNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVW-TGGTYFVFVIFGTIAAFMV 389
           K+R                GIW+   ++  +N      VW   G Y   V+   +A    
Sbjct: 344 KDR----------------GIWSALIIAIHINF-----VWYMQGDYMYTVLM--VAVNET 380

Query: 390 ALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSI 449
           A S  R+   +     +  F +G ++      K+            + FG+   F A   
Sbjct: 381 AKSAARITSLYSFVSVITGFLLGGVIVYARRTKK-----------FILFGIACWFVAF-- 427

Query: 450 ILSDGLPMEYQGMAGSLVNTVINYSASLC-LGMGA 483
               GL + Y+G + S    V     SLC LG GA
Sbjct: 428 ----GLLVHYRGDSSSHSGIV----GSLCLLGFGA 454

>Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W
           (REAL)
          Length = 560

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 59/135 (43%), Gaps = 15/135 (11%)

Query: 231 WPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSM-----------DWTGSVLAVIGLI 279
           W W F        ++ +L  Y +PN    N    ++           D TGS+L + GL 
Sbjct: 206 WRWCFLIQVPISIISSVLMNYYVPNQKEYNHENSNIFRNSKRILTDIDITGSILIITGLT 265

Query: 280 LFNFVWNQAPTAG---WGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLP-HAVTKNRHM 335
           L     +   +     W +  ++ LL+ S+  L+ F  +E K     ++P   V+ +   
Sbjct: 266 LQLLYLSLGCSGSKLSWTSPSVLLLLVGSIAILLLFISHEKKTTARAIIPMELVSSSYSF 325

Query: 336 IMILLAVFLGWGSFG 350
           +++L+++ +G+ S+ 
Sbjct: 326 VVLLISILVGFASYA 340

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 46/94 (48%), Gaps = 2/94 (2%)

Query: 68  RELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISG 127
           +  + ++   L   L+    T   T++  ++   ++ S + +W+  S+ L   +F  + G
Sbjct: 39  KTRIIVIALFLGSFLSALDTTIVSTLLPTIASDLDASS-QMSWIATSYLLSCSAFQPLYG 97

Query: 128 RLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNN 161
           +L DI+G K +L+   +   +   +CG S ++ N
Sbjct: 98  KLSDIFGRKILLVWSNLVFAIGCALCG-SPWTTN 130

>KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 38/80 (47%)

Query: 272 VLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTK 331
           ++A +G IL          + W   +II   ++    +     +E+++A+ PL+P+ + K
Sbjct: 285 LIATLGCILVPLTLAGGYNSKWNNPHIIGPFVLGFVLVPILMFWEMRWARDPLVPYGLIK 344

Query: 332 NRHMIMILLAVFLGWGSFGI 351
           +R +   L   FL +  F +
Sbjct: 345 DRGVWSALAISFLNYFIFAL 364

>ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKL217W
           (JEN1)
          Length = 478

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 3/81 (3%)

Query: 97  LSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLS 156
           +++  N   +K  W M    +      ++ G +GD +G K   MI    I +  L+ G  
Sbjct: 71  IAEDLNVNDEKVTWGMTIALMTRTIGAVLYGYIGDQFGQKASFMINIGMISILQLLTG-- 128

Query: 157 KYSNNDAFFITCRAFQGLGIA 177
            ++    +FI CRA+ G+ + 
Sbjct: 129 -FATTFPYFIACRAYFGVELG 148

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 11/65 (16%)

Query: 92  TIMNVLSKSFNSE---SDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIV 148
           TI+  L  +  SE   S++ +W+  S+ L   +F  + G+L D++G K +L        +
Sbjct: 50  TIVTTLLPTIASELDASNQMSWIATSYLLSCSAFQPLYGKLSDVFGRKPLL--------I 101

Query: 149 WSLIC 153
           WS +C
Sbjct: 102 WSNLC 106

>Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C
           (ARN2) - Triacetylfusarinine C transporter [contig 246]
           FULL
          Length = 619

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 2/83 (2%)

Query: 264 FSMDWTGSVL--AVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAK 321
           + +D  G +L  A  G IL         +A W +A +IA  ++    +  F  +E + A 
Sbjct: 282 WKLDVAGVLLLTACTGCILVPLTIAGGVSAQWRSAKVIAPFVLGFALVPVFLYWESRIAL 341

Query: 322 VPLLPHAVTKNRHMIMILLAVFL 344
           VPL P  + K+R +   L  +FL
Sbjct: 342 VPLAPFKMLKDRGIWAPLAIMFL 364

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 61/151 (40%), Gaps = 18/151 (11%)

Query: 91  LTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWS 150
           +T+   + + F  +  +  WL+  + L    F L+ GRL  I GLK  L    V   + S
Sbjct: 28  ITLYETIGEKFK-DYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGS 86

Query: 151 LICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGST-----RKNLVISFI 205
           LI  +   SN+    I  R   G G +       G+   V+ VG++      + +VI+ +
Sbjct: 87  LIVAV---SNSMGMIIGGRVVAGCGGS-------GIQSLVFVVGTSLVEERNRGMVITVL 136

Query: 206 GACAPAXXXXXXXXXXXIVNEDSEQWPWVFY 236
           G  A A              E+   W W FY
Sbjct: 137 G-LAFAVAFAVGPVIGGAFTENVS-WRWCFY 165

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 70/176 (39%), Gaps = 31/176 (17%)

Query: 266 MDWTGSVL--AVIGLILFNFVWNQAPTAGWGTA-YIIALLIISVFFLVAFFVYEVKYAKV 322
           +D  G +L  A   LIL      +    GWG+A +I+  ++     L  F  +E+K+A  
Sbjct: 267 LDMLGLILLVAFFALILVPLTLAKGLHEGWGSAKFIVPEVLGWALALPLFLTWELKFASN 326

Query: 323 PLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFG 382
           P+ P  + K+R +          +G  G+  F    + +          G TY   V+  
Sbjct: 327 PITPLDLIKDRGI----------YGGIGVSLFLEFVYDI----------GSTYLYTVL-- 364

Query: 383 TIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQ------SFWKLNFGM 432
            +A      S  R+   F     L AF +G ++  V   K+      + W + +G+
Sbjct: 365 VVAVNESTKSATRITSLFTFVSVLTAFFLGFVVVKVRRTKEFIIFGIAMWYIAYGL 420

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%)

Query: 109 AWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICG 154
           +W+ AS+ L A  F  + G+L DI+G K +L+   +   +  L+CG
Sbjct: 190 SWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCG 235

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 8/83 (9%)

Query: 125 ISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVM 184
           ISG L D+YG + ++++G +  ++ S+    SK      F    R  Q  GI+ I+    
Sbjct: 137 ISGGLADVYGRRPIILLGMLIYVIASIGLACSKSYGAVVFL---RCLQSAGISPIIAINS 193

Query: 185 GLVGHVYKVGSTRKNLVISFIGA 207
           G+ G  + V S R     +F+GA
Sbjct: 194 GVAGD-FTVKSERG----TFVGA 211

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 4/84 (4%)

Query: 92  TIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSL 151
           TI+  ++K F S S+   WL   + L      LI GR+    G K+ ++   V   + SL
Sbjct: 89  TIIEEVAKQFGSYSEI-GWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIGSL 147

Query: 152 ICGLSKYSNNDAFFITCRAFQGLG 175
           I  L   +N+ +  I  R   G+G
Sbjct: 148 ISAL---ANSMSMLIGGRVIAGVG 168

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 37/84 (44%), Gaps = 4/84 (4%)

Query: 92  TIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSL 151
           TI+  ++K F S S+   WL   + L      LI GR+    G K+ ++   V   V SL
Sbjct: 98  TIIEEVAKQFGSYSEI-GWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIFEVGSL 156

Query: 152 ICGLSKYSNNDAFFITCRAFQGLG 175
           I  L+   N     I  R   G+G
Sbjct: 157 ISALANSMN---VLIGGRVIAGVG 177

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 49/114 (42%), Gaps = 8/114 (7%)

Query: 94  MNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLIC 153
           +  L K F+ + +     +  + L  G    + G L DIYG + +++ G +  IV S+  
Sbjct: 126 LRQLEKQFDIDENLVNVTVVVYLLFQGISPTVCGGLADIYGRRPVILFGMLVYIVASIAL 185

Query: 154 GLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGA 207
                +N+    I  R  Q  GI+ I+    G VG       T K    +F+GA
Sbjct: 186 AC---ANSYGVIIFLRCLQSCGISPIIAISSGCVGDF-----TMKAERGTFVGA 231

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 62/158 (39%), Gaps = 22/158 (13%)

Query: 18  VIDKISMKAEDKXXXXXXXXXXXXXASSNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCM 77
           VI+ + +  ED+             A    S  V +  P      +++ G   + +    
Sbjct: 7   VIESMGVIVEDRSS-----------AQDESSGHVGDPQPLSGFKLYANMGSLTLVLFLAA 55

Query: 78  LAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKK 137
           L  L+  A        + V+S+ FN  S K  W+++ + L      L+ GR   I+G K 
Sbjct: 56  LDILIMSAS-------IEVISEQFNDYS-KSGWIVSGYSLPEALLTLLWGRFATIFGFKL 107

Query: 138 MLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLG 175
            L++  +     SLI   S  SN+    I  R   G+G
Sbjct: 108 SLLLSILIFETGSLI---SAVSNSMNVLIGGRVVAGIG 142

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 71/170 (41%), Gaps = 14/170 (8%)

Query: 44  SSNKSTQVSNDSPWQ------DPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVL 97
           +S+ S  V  DS  Q       P    S+G++   +    +    +  G       +  L
Sbjct: 67  TSSHSGDVKGDSTQQITTEIGAPYTLLSYGQKWGMVAILTMCGFWSSLGSPIYYPALRQL 126

Query: 98  SKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSK 157
            K FN + +     +  + L  G    +SG L D +G + +++ G +  +V S+  GL+ 
Sbjct: 127 EKQFNVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRRPIILAGMLIYVVASI--GLA- 183

Query: 158 YSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGA 207
            + +    I  R  Q +GI+  +    G+VG       T K+   +F+GA
Sbjct: 184 CAPSYGVIIFLRCIQSIGISPTIAISSGVVGDF-----TLKHERGTFVGA 228

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 53/118 (44%), Gaps = 12/118 (10%)

Query: 94  MNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWS--L 151
           +  L K F  + +K    +  + L  G    ISG L D++G + +++IG +  +V S  L
Sbjct: 114 LRQLEKQFGLDENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVILIGMLIYVVASIGL 173

Query: 152 ICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACA 209
            C  S         +  R  Q +GI+  +    G+VG       T K+   +F+GA +
Sbjct: 174 ACAPSY-----GVIVFLRIIQSIGISPTIAISSGVVGDF-----TLKHERGTFVGATS 221

>Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {ON}
           YEL065W (SIT1) - Ferrioxamine B permease [contig 5] FULL
          Length = 603

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 272 VLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFV-YEVKYAKVPLLPHAVT 330
           + A +G +L  F      +  W +A+II   +I        FV +E KYA+ PL P  + 
Sbjct: 267 ITAGLGCVLIPFTLAGGLSDKWKSAHIIVPEVIGWCVAFPLFVLWEKKYARHPLTPWRLL 326

Query: 331 KNRHMI 336
           K+R +I
Sbjct: 327 KDRGVI 332

>Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL040C
           (REAL)
          Length = 631

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/91 (20%), Positives = 38/91 (41%), Gaps = 16/91 (17%)

Query: 276 IGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHM 335
           +G IL            W  + +I   ++    +   +V+E  YA+ P+LP+ + K+R  
Sbjct: 305 LGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLIPILWVWEYSYARDPILPYKLVKDR-- 362

Query: 336 IMILLAVFLGWGSFGIWTFYYMSFQLNLRHY 366
                         G+W+   +SF ++  +Y
Sbjct: 363 --------------GVWSSMGISFLIDFIYY 379

>TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON} 
          Length = 621

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 68/151 (45%), Gaps = 11/151 (7%)

Query: 264 FSMDWTGSVLAVIG--LILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVY-EVKYA 320
           + +D  G +L  +G   IL         +  W +A +IA  ++  F L+A F+Y E K A
Sbjct: 283 WKLDVVGIILLTVGTGCILVPLTLAGGVSTQWQSAKLIAPFVLG-FVLIAIFIYWESKLA 341

Query: 321 KVPLLPHAVTKNRHM-----IMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTY 375
             P+ P  + K+R +     IM L+A      +  ++T   ++        + + T    
Sbjct: 342 LAPIAPFKMLKDRGIWAPLWIMFLIAFVYQMAAGYLYTILMVAVDETDLSATRI-TSLYS 400

Query: 376 FVFVIFGTIAAFMVALSIKRVGPAFLLCFAL 406
           FV  IF  +  F+VA S  R+ P  +L  +L
Sbjct: 401 FVSAIFAPVLGFIVARS-SRLKPYMVLGCSL 430

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 54/114 (47%), Gaps = 8/114 (7%)

Query: 94  MNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLIC 153
           +  L K FN + +     +  + +  G    +SG L DIYG + +++ G +  +V S+  
Sbjct: 122 LKQLEKKFNVDENLVNVSVVVYLIFQGFAPAVSGGLADIYGRRPVILFGMLVYVVASI-- 179

Query: 154 GLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGA 207
           G++   N+    I  R  Q  GI+ ++    G VG  + V + R     +F+GA
Sbjct: 180 GIAA-CNSYGVIIFLRCLQSTGISPLIAISSGAVGD-FTVKAERG----TFVGA 227

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 4/82 (4%)

Query: 94  MNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLIC 153
           + V+++ F   S K  W+++ + L      L+ GR   I G K  L++  +     SLI 
Sbjct: 142 IEVIAEQFKDYS-KSGWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGSLI- 199

Query: 154 GLSKYSNNDAFFITCRAFQGLG 175
             S  SN+    I  R   G+G
Sbjct: 200 --SAISNSMNMLIGGRVVAGIG 219

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 54/114 (47%), Gaps = 8/114 (7%)

Query: 94  MNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLIC 153
           +  L + FN + +K    +  + L  G    ISG L D+YG + +++ G +  +V S+  
Sbjct: 114 LKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVASI-- 171

Query: 154 GLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGA 207
           G++K + +    +  R  Q +GI+  +    G+V        T K    +F+GA
Sbjct: 172 GIAK-APSYGVIVFLRCIQSIGISPTIAISSGVVSDF-----TVKRERGTFVGA 219

>TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON} 
          Length = 669

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%)

Query: 274 AVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNR 333
           A +G IL         ++ W    IIA   +    +  F  +E K++K PL+P  + K+R
Sbjct: 337 ASLGCILVPLTLAGGTSSKWNHGNIIAPFALGFVLIPIFTFWEWKFSKSPLIPSKLVKDR 396

>Skud_8.8 Chr8 (14282..15922) [1641 bp, 546 aa] {ON} YHL036W (REAL)
          Length = 546

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 62/125 (49%), Gaps = 9/125 (7%)

Query: 228 SEQWPWVFYAFAIAFFLNMILAW-YSIPNNIPTNVHGFSMDWTGS----VLAVIGLILFN 282
           S+ WP+     AI+    + +AW   +P    +  +  SMD  G+    +L  IGL ++ 
Sbjct: 387 SKNWPFDAPLPAISLCGFITIAWILVLPKEGESFNYLVSMDGYGNQFFLLLVAIGLFIWR 446

Query: 283 FVW-NQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLA 341
           F   ++AP     T  ++A++ +S++ LVA F+ +    +V  LP     +   ++++LA
Sbjct: 447 FKHKHEAPEIRAPTFGVLAIITLSLYMLVAPFLADASLNRVGFLPPYQIMS---LLVILA 503

Query: 342 VFLGW 346
            F  W
Sbjct: 504 CFFFW 508

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%)

Query: 106 DKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLS 156
           D  +W+ AS+ + + SF  + G   D+ G +K L    +   +  L CG+S
Sbjct: 102 DLSSWITASYLITSTSFQPLYGSFSDVLGRRKCLFFASMIFSIGCLGCGIS 152

>KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 624

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 27/60 (45%)

Query: 274 AVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNR 333
           A +G IL         +  W    II  L++ VF +     +E  +AKVP  P  + K+R
Sbjct: 298 ASMGCILVPLTIAGGISEQWNNGKIIGPLVLGVFLVPLTIYWESNWAKVPFAPFLLLKDR 357

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 92  TIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSL 151
           TI++V++K F + S K  WL+  + L      L+ GR   I G +  L++  +     SL
Sbjct: 67  TIIDVVAKQFGNYS-KTGWLVTGYSLPNAVLSLLWGRFASIIGFQHSLILAVLIFEAGSL 125

Query: 152 ICGLSKYSN 160
           +  L+   N
Sbjct: 126 VAALANSMN 134

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.140    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,218,620
Number of extensions: 2086566
Number of successful extensions: 6774
Number of sequences better than 10.0: 229
Number of HSP's gapped: 6822
Number of HSP's successfully gapped: 254
Length of query: 543
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 428
Effective length of database: 40,294,809
Effective search space: 17246178252
Effective search space used: 17246178252
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)