Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_13.4668.840ON62262233630.0
YMR278W (PGM3)8.840ON62262229620.0
Smik_13.4918.840ON62262228800.0
Skud_13.4508.840ON62262228390.0
TDEL0B005708.840ON63062021320.0
SAKL0D01474g8.840ON62462321100.0
NCAS0C004108.840ON62562120970.0
Kpol_1068.88.840ON63262520910.0
ZYRO0G14190g8.840ON61061620720.0
KNAG0J002708.840ON62562020700.0
CAGL0M02981g8.840ON61761520320.0
NDAI0K004108.840ON62661920250.0
TPHA0I002508.840ON62962220220.0
TBLA0B032508.840ON64364020070.0
KAFR0B039208.840ON62461619500.0
Kwal_27.102588.840ON62062318820.0
KLTH0C03872g8.840ON62162318810.0
ABL126W8.840ON62462618330.0
KLLA0D01573g8.840ON60763118200.0
Ecym_46118.840ON63062818060.0
TDEL0E00210singletonON570300940.010
CAGL0B03597g6.11ON54030940.011
Kpol_1033.542.445ON570143910.024
NCAS0F002006.11ON54928900.029
TDEL0G046006.11ON52828900.030
TBLA0G009806.11ON55828890.036
NDAI0K028906.11ON56130890.043
KAFR0L003406.11ON54037890.043
Kpol_1032.26.11ON53928880.051
Smik_5.296.11ON55528860.090
Skud_5.316.11ON55728860.091
YEL058W (PCM1)6.11ON55728860.091
Suva_5.106.11ON55328860.094
KLTH0D04796g2.445ON570570850.12
TBLA0B090102.445ON569142850.13
ZYRO0F00506g6.11ON55024840.16
Suva_13.2822.445ON569249830.20
KNAG0E009406.11ON53821830.21
TDEL0H006307.508ON44959820.25
SAKL0E00902g6.11ON54419820.28
KLLA0D00858g6.11ON54119820.28
KAFR0D030102.445ON569295810.34
Kwal_56.223556.11ON54120810.34
KLTH0C11506g6.11ON54420810.35
NCAS0F014702.445ON569292800.41
ZYRO0G02508g2.445ON569599800.43
NDAI0H023502.445ON569292800.49
CAGL0K07480g2.445ON567128800.50
Smik_13.2912.445ON569291790.60
Kwal_26.76282.445ON57087790.64
ACR015W6.11ON55251790.64
YMR105C (PGM2)2.445ON569291780.76
KNAG0A062802.445ON570130780.90
TPHA0M002106.11ON54528770.97
KNAG0E023902.445ON569583761.4
CAGL0K03421g2.445ON568291761.4
Ecym_30146.11ON55119751.6
Skud_13.2632.445ON569292751.9
TDEL0A022102.445ON572307751.9
ABL029W2.445ON568128752.0
TPHA0G029002.445ON569295752.0
Kpol_543.598.314ON22883732.0
TBLA0I013802.445ON571292742.1
SAKL0E03630g2.445ON571127742.4
Smik_11.1122.445ON570127733.2
Skud_8.935.312ON588109724.2
Kpol_1018.1612.445ON569128724.5
Ecym_24752.445ON567128724.7
Suva_11.982.445ON570141714.9
NCAS0C039708.64ON62065715.1
Smik_4.7525.609ON87742707.1
NCAS0A043502.445ON569125707.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_13.466
         (622 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...  1300   0.0  
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...  1145   0.0  
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...  1113   0.0  
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...  1098   0.0  
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...   825   0.0  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...   817   0.0  
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...   812   0.0  
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...   810   0.0  
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...   802   0.0  
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...   801   0.0  
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...   787   0.0  
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...   784   0.0  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...   783   0.0  
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...   777   0.0  
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...   755   0.0  
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...   729   0.0  
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...   729   0.0  
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...   710   0.0  
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...   705   0.0  
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...   700   0.0  
TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445...    41   0.010
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...    41   0.011
Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON} (1362...    40   0.024
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...    39   0.029
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...    39   0.030
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...    39   0.036
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....    39   0.043
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...    39   0.043
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...    39   0.051
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)    38   0.090
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)    38   0.091
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...    38   0.091
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)    38   0.094
KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly...    37   0.12 
TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa] ...    37   0.13 
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...    37   0.16 
Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {...    37   0.20 
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...    37   0.21 
TDEL0H00630 Chr8 complement(109274..110623) [1350 bp, 449 aa] {O...    36   0.25 
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...    36   0.28 
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...    36   0.28 
KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.4...    36   0.34 
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...    36   0.34 
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...    36   0.35 
NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {O...    35   0.41 
ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly...    35   0.43 
NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {O...    35   0.49 
CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa] ...    35   0.50 
Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {...    35   0.60 
Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C...    35   0.64 
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...    35   0.64 
YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON} ...    35   0.76 
KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON}               35   0.90 
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...    34   0.97 
KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.4...    34   1.4  
CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa] ...    34   1.4  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...    33   1.6  
Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {...    33   1.9  
TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.4...    33   1.9  
ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic ho...    33   2.0  
TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON}               33   2.0  
Kpol_543.59 s543 complement(139666..140352) [687 bp, 228 aa] {ON...    33   2.0  
TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {O...    33   2.1  
SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {...    33   2.4  
Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127...    33   3.2  
Skud_8.93 Chr8 (158933..160699) [1767 bp, 588 aa] {ON} YHR035W (...    32   4.2  
Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON} (412...    32   4.5  
Ecym_2475 Chr2 complement(927999..929702) [1704 bp, 567 aa] {ON}...    32   4.7  
Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C...    32   4.9  
NCAS0C03970 Chr3 complement(801433..803295) [1863 bp, 620 aa] {O...    32   5.1  
Smik_4.752 Chr4 complement(1328812..1331445) [2634 bp, 877 aa] {...    32   7.1  
NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.4...    32   7.5  

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 1300 bits (3363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 622/622 (100%), Positives = 622/622 (100%)

Query: 1   MYQQLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGL 60
           MYQQLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGL
Sbjct: 1   MYQQLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGL 60

Query: 61  RSEMQAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLL 120
           RSEMQAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLL
Sbjct: 61  RSEMQAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLL 120

Query: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180
           KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP
Sbjct: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180

Query: 181 HDHAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPL 240
           HDHAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPL
Sbjct: 181 HDHAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPL 240

Query: 241 KLEIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNP 300
           KLEIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNP
Sbjct: 241 KLEIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNP 300

Query: 301 EEKGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEF 360
           EEKGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEF
Sbjct: 301 EEKGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEF 360

Query: 361 QRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEG 420
           QRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEG
Sbjct: 361 QRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEG 420

Query: 421 YYVPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVF 480
           YYVPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVF
Sbjct: 421 YYVPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVF 480

Query: 481 KEYNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDH 540
           KEYNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDH
Sbjct: 481 KEYNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDH 540

Query: 541 KPVLPVDPTSQMITLSGKPSDGNGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAK 600
           KPVLPVDPTSQMITLSGKPSDGNGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAK
Sbjct: 541 KPVLPVDPTSQMITLSGKPSDGNGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAK 600

Query: 601 LTWDVLRRGWFRPEIMNITTDF 622
           LTWDVLRRGWFRPEIMNITTDF
Sbjct: 601 LTWDVLRRGWFRPEIMNITTDF 622

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 1145 bits (2962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/622 (85%), Positives = 582/622 (93%)

Query: 1   MYQQLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGL 60
           M Q +LETVPSDLK PISLWF QDRNP+TIEEVT LCK SDW+ELHKRFD+RIQFGTAGL
Sbjct: 1   MLQGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGL 60

Query: 61  RSEMQAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLL 120
           RS+MQAGFSRMNTLV+IQA+QGLATY++QQFPDNLV VVGHDHRFHSKEFARATA AFLL
Sbjct: 61  RSQMQAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLL 120

Query: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180
           KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP
Sbjct: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180

Query: 181 HDHAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPL 240
           HDHAISDSID NLEPWANVW F DVLNKALKQGKLMYSREEML LY +EVSK LVE NPL
Sbjct: 181 HDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPL 240

Query: 241 KLEIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNP 300
           KLE+KAKPWFVYTPMHGVGF+IFSTIVKKT+ LVEG+DYLCVPEQQNPDPSFPTVGFPNP
Sbjct: 241 KLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300

Query: 301 EEKGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEF 360
           EEKGALDIG+ LAE+HDI+LLVANDPDADRFS+AVKD QS +WRQLTGNEIGFLFAF+E+
Sbjct: 301 EEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEY 360

Query: 361 QRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEG 420
           Q+YK+ D+EFQ  HPLAML+STVSSQMIKKMAE+EGF YEDTLTGFKWIGNRAI+LEK+G
Sbjct: 361 QKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKG 420

Query: 421 YYVPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVF 480
           YYVPFGFEEAIGYMFPAMEHDKDGISA++V LQAYCKWKID NLDP+++LENGF+KYGVF
Sbjct: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVF 480

Query: 481 KEYNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDH 540
           KEYNGYYVVP+P VT +IF+YIRNVYTP G  YP SIGEEIEV+YYRDLTTGYQSDT +H
Sbjct: 481 KEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINH 540

Query: 541 KPVLPVDPTSQMITLSGKPSDGNGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAK 600
           KP LPVDPTSQMIT+S +PS+G+ NEHIRFTIRGSGTEPKLKVYIEACA+ E+RAS+LAK
Sbjct: 541 KPTLPVDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAK 600

Query: 601 LTWDVLRRGWFRPEIMNITTDF 622
           LTW+VLRR WFRP+ MNI T F
Sbjct: 601 LTWNVLRREWFRPDEMNIVTKF 622

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 1113 bits (2880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/622 (83%), Positives = 571/622 (91%)

Query: 1   MYQQLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGL 60
           M  Q LE VPS+LK  ISLWF+QD+NPETIEEVT LCK SDW+ELH+RFD+RIQFGTAGL
Sbjct: 1   MSLQFLEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGL 60

Query: 61  RSEMQAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLL 120
           RS+MQAGF+RMNTLVIIQA+QGLATY KQQFP+NLV VVGHDHRFHSKEFARATATAFLL
Sbjct: 61  RSQMQAGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLL 120

Query: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180
           KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVM+TASHNPKMDNGYKVYYSNGCQIIPP
Sbjct: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPP 180

Query: 181 HDHAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPL 240
           HDHAISDSIDMNLEPWANVW F DVLNK LKQGKLMYSREE+L LY  EVSK LV T+PL
Sbjct: 181 HDHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPL 240

Query: 241 KLEIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNP 300
           K E+KAKPWFVYTPMHGVGF+IFSTIVKKTMSLVEG+DYLCVPEQQ PDPSFPTV FPNP
Sbjct: 241 KFEVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNP 300

Query: 301 EEKGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEF 360
           EEKGALD+G+ LAE H INLL+ANDPDADRFS+A+KD +S +WRQLTGNEIGFLFA FEF
Sbjct: 301 EEKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEF 360

Query: 361 QRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEG 420
           Q++K+ +++FQ +HPLAMLSSTVSSQMIKKMAEVEGF YE+TLTGFKWIGNRAI+LEKEG
Sbjct: 361 QKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEG 420

Query: 421 YYVPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVF 480
           YYVPFGFEEAIGYMFPAMEHDKDG+SA++V LQAYC+WKID NLDPI ILE+GF+KYGVF
Sbjct: 421 YYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVF 480

Query: 481 KEYNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDH 540
           KEYNGYY+V SP+VT EIF+YIRN YTP GV YP SIG+EIEV+ YRDLT GYQSDT +H
Sbjct: 481 KEYNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNH 540

Query: 541 KPVLPVDPTSQMITLSGKPSDGNGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAK 600
           KP LP+DP+SQMIT+S KPSDGN  EHIRFTIRGSGTEPK+KVYIEACAD E+RA++LAK
Sbjct: 541 KPTLPIDPSSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAK 600

Query: 601 LTWDVLRRGWFRPEIMNITTDF 622
           LTW+VL+R WFRPE M+I T F
Sbjct: 601 LTWNVLKREWFRPEKMDIVTHF 622

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 1098 bits (2839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/622 (83%), Positives = 577/622 (92%)

Query: 1   MYQQLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGL 60
           M QQ L T+PSDLKGPISLWFDQDR+PETIEEVT LCK SDWDELHKRFDTRIQFGTAGL
Sbjct: 1   MSQQFLGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGL 60

Query: 61  RSEMQAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLL 120
           RS+MQAGFSRMN LVIIQA+QGLATYI+QQFP+NLV VVGHDHRFHSK+FARATATAFLL
Sbjct: 61  RSQMQAGFSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLL 120

Query: 121 KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180
           KGFKVHYLNP  EFVHTPLVPFAVD+L ASVGVMITASHNPKMDNGYKVYYSNGCQIIPP
Sbjct: 121 KGFKVHYLNPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180

Query: 181 HDHAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPL 240
           HD AIS++IDMNLEPWAN W F D+L+K LKQGKLMYSREEML LY +++S  LVET PL
Sbjct: 181 HDQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPL 240

Query: 241 KLEIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNP 300
           KLE+++KPWFVYTPMHGVGF+IFSTIVKK+M LVEG+DYLCVPEQQNPDPSFPTVGFPNP
Sbjct: 241 KLEVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300

Query: 301 EEKGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEF 360
           EEKGAL+IGMRLAE+HDI+LL+ANDPDADRFS+A+KD QS  W+QLTGNEIGFLFAFFEF
Sbjct: 301 EEKGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGFLFAFFEF 360

Query: 361 QRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEG 420
           +++K+ DE+FQ++HPLAMLSSTVSSQMIK+MAEVEGF YEDTLTGFKWIGNRAIILEKEG
Sbjct: 361 EKFKSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEG 420

Query: 421 YYVPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVF 480
           YYVPFGFEEAIGYMFPAMEHDKDGISA+VV LQAYCKWK+ +NLDPI++LENGF+KYGVF
Sbjct: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVF 480

Query: 481 KEYNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDH 540
           KEYNGYY+VP+P+VT EIF+YIR+VYTP  VPYPP IGEEI V+ YRDLTTGYQSDT DH
Sbjct: 481 KEYNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDH 540

Query: 541 KPVLPVDPTSQMITLSGKPSDGNGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAK 600
           KP LPVDPTSQMIT+  +P+D NGNEHIRFTIRGSGTEPKLKVYIE  A+ E+RAS+LAK
Sbjct: 541 KPTLPVDPTSQMITVFARPNDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAK 600

Query: 601 LTWDVLRRGWFRPEIMNITTDF 622
           LTWDVLRR WFRPE  NITT+F
Sbjct: 601 LTWDVLRREWFRPEKTNITTNF 622

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/620 (62%), Positives = 481/620 (77%)

Query: 3   QQLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRS 62
           ++++ +VP+DL   ++ W  QD N +T  E+  LCK  DW ELHKR DTRI FGTAGLRS
Sbjct: 11  KEVINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRS 70

Query: 63  EMQAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKG 122
            M+AGFSRMNTLV++QATQGLA +IK+QFPD L  VVGHDHRF+S+EFA AT   FL  G
Sbjct: 71  RMEAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAG 130

Query: 123 FKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 182
           FKV +LN   +FVHTP+VPF V+++ ASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD
Sbjct: 131 FKVIFLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 190

Query: 183 HAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLKL 242
             I+ SI+ NL  W   WK+ ++L + L    L+Y+ EEM+  Y+K++ ++LV+   +  
Sbjct: 191 SEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISA 250

Query: 243 EIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEE 302
           E + KPWFVYTP+HGVG++IF  I ++TM+L+ G DYLCV EQQ PDPSFPTV FPNPEE
Sbjct: 251 EKEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEE 310

Query: 303 KGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEFQR 362
           KGALD+ + +A+++ I+L++ANDPDADRFS AVKD ++  WRQLTGNEIG LFAF+EFQ+
Sbjct: 311 KGALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFYEFQK 370

Query: 363 YKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEGYY 422
           Y+ K+EE++  HPLAML+STVSSQ+I KMAE+E F Y DTLTGFKWIGNR + LE   YY
Sbjct: 371 YQKKNEEYKEKHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYY 430

Query: 423 VPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVFKE 482
           VPFGFEEAIGYMFP MEHDKDGISAA V LQ Y KW + S    + +LE+ F+KYGVFKE
Sbjct: 431 VPFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKE 490

Query: 483 YNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKP 542
           YNGYY V  P V  E+F++IRN Y+ T  PYP  IGEE++V  +RDLT GYQSDT + +P
Sbjct: 491 YNGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRP 550

Query: 543 VLPVDPTSQMITLSGKPSDGNGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAKLT 602
            LPVDP SQMIT   K +     E +RFTIRGSGTEPKLKVYIEAC+ +E+RAS LA+LT
Sbjct: 551 DLPVDPNSQMITAWTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERASELAQLT 610

Query: 603 WDVLRRGWFRPEIMNITTDF 622
           W VL+R WFRP++  +TT F
Sbjct: 611 WRVLKREWFRPDVTGLTTTF 630

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score =  817 bits (2110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/623 (62%), Positives = 469/623 (75%), Gaps = 13/623 (2%)

Query: 8   TVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSEMQAG 67
           TVP DLK  ++LW   D+NPET  E+  L +   W+ELH R D RI FGTAGLRS M+AG
Sbjct: 7   TVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAG 66

Query: 68  FSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGFKVHY 127
           FSRMNTL ++QA+QGLA+YIK QFP+NL V+VGHDHR+HS EFAR T TAFL  GFKV+Y
Sbjct: 67  FSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYY 126

Query: 128 LN-----PDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 182
           LN         FVHTP+VPF +++L AS G+MITASHNPKMDNGYKVYYSNGCQIIPPHD
Sbjct: 127 LNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHD 186

Query: 183 HAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLKL 242
             IS++ID NL PW   W   +V+  A++ G L   +E++ + Y K VS  LV    L  
Sbjct: 187 RLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPMLDC 246

Query: 243 EIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEE 302
           +   KPWFVYTPMHGVGF IF  I    + L EG+ Y+CVPEQ+ PDP+FPTV FPNPEE
Sbjct: 247 D---KPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEE 303

Query: 303 KGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEFQR 362
           KGALD+ + LAEE DI L++ANDPDADRFS+AVK+    +W QLTGNEIGFLFA++++Q 
Sbjct: 304 KGALDLSIALAEEQDIRLVIANDPDADRFSVAVKN--GDRWSQLTGNEIGFLFAYYQWQD 361

Query: 363 YKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEGYY 422
           Y+   E F++ HPLAM++STVSSQMIK +AE E F YEDTLTGFKW+GNRA  LE +GYY
Sbjct: 362 YQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYY 421

Query: 423 VPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVFKE 482
           VPF +EEAIGYMFP +EHDKDGISAAVV LQ YC+W     + P+ +L+ GF KYGVFKE
Sbjct: 422 VPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKE 481

Query: 483 YNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKP 542
           YNGYY+VP   +T E+F+YIR  YTP+G  YPP+IG E  V+ +RDLTTGYQSDT D+ P
Sbjct: 482 YNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVP 541

Query: 543 VLPVDPTSQMITLSGKPSDG---NGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLA 599
            LPVD +SQMIT + +PS+G      E +RFTIRGSGTEPKLKVYIEA + +EKRA +LA
Sbjct: 542 NLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLA 601

Query: 600 KLTWDVLRRGWFRPEIMNITTDF 622
           + TW VLRR WFRPE   + T F
Sbjct: 602 RETWQVLRREWFRPERTGLETKF 624

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/621 (61%), Positives = 473/621 (76%), Gaps = 1/621 (0%)

Query: 3   QQLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRS 62
           Q  L   P +L+ PI+LW   D+N ET +EV  LC+N +W ELH+RFDTRI FGTAGLRS
Sbjct: 5   QSSLSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRS 64

Query: 63  EMQAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKG 122
            M+AGFSRMN+L+I+Q+TQGLA YIK+QFP+NL  VVGHDHRFHSKEFA  TA+ FL  G
Sbjct: 65  RMEAGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAG 124

Query: 123 FKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 182
           FKV YL PD +FVHTPLVPF+V  LKASVGVMITASHNPKMDNGYKVYY N CQIIPPHD
Sbjct: 125 FKVFYLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHD 184

Query: 183 HAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLKL 242
             I++ I  NLEPW+  W +     K L+  KL++ ++ M   Y  ++ + L+ ++ L L
Sbjct: 185 KNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSL 244

Query: 243 EIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEE 302
           +    P+FVYTPMHGVG  IF+ +  + ++L E  DYL V EQ+ PDPSFPTV FPNPEE
Sbjct: 245 KDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEE 304

Query: 303 KGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEFQR 362
           KGAL + ++LA+E+ ++L++ANDPDADRFS AV + ++ KWRQLTGNEIGFL  ++EFQ 
Sbjct: 305 KGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQL 364

Query: 363 YKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEGYY 422
           Y+ +D  F+++HPLAM++STVSSQMIK+MA++ GF YEDTLTGFKWIGN+AI L +EGYY
Sbjct: 365 YEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYY 424

Query: 423 VPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVFKE 482
           VPFGFEEAIGYMFP ME DKDGISAA V LQAYC W     + P DI+E GF K+GVFKE
Sbjct: 425 VPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKE 484

Query: 483 YNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKP 542
           YNGYY++    +T  +F++IR+ Y  T   YP  IG E+ V  +RDLT GYQS+T D+ P
Sbjct: 485 YNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIP 544

Query: 543 VLPVDPTSQMITLSGKPSD-GNGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAKL 601
            LPVDPTSQMIT+  KPS+  N    +R T+RGSGTEPKLKVYIEAC+ +E+ A+ LA+ 
Sbjct: 545 NLPVDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLARS 604

Query: 602 TWDVLRRGWFRPEIMNITTDF 622
           TWD+L+R WFRPE+  +TT F
Sbjct: 605 TWDILKREWFRPEVTGLTTSF 625

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/625 (61%), Positives = 476/625 (76%), Gaps = 4/625 (0%)

Query: 2   YQQLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLR 61
           +  +LET+P DL+  +  W  QD+NPETI EV  LCK +  +ELHKRFD RI FGTAGLR
Sbjct: 8   FDSVLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLR 67

Query: 62  SEMQAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLK 121
           S+M+AGFSRMNTLV++QATQGLATYIKQQFP NL  V+GHDHR+HSKEFA    + FL  
Sbjct: 68  SKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSA 127

Query: 122 GFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPH 181
           GF V+ LNP   FVHTPLVPF VD++ ASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 
Sbjct: 128 GFTVYNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPV 187

Query: 182 DHAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLK 241
           D +I+  ID NLEPW+N W  S  +   L   KL+Y R EML  YS +V   +++   ++
Sbjct: 188 DASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIR 247

Query: 242 -LEIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNP 300
             +   KPWFVYTPMHGVG+ IF+++V + ++L E  DYL V EQ  PDP+FPT+ FPNP
Sbjct: 248 EFDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNP 307

Query: 301 EEKGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEF 360
           EEKGALD+ + LA+E+DI+L++ANDPDADRFS A+ ++ S +W+QLTGNEIGFLF ++ F
Sbjct: 308 EEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLF 367

Query: 361 QRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEG 420
            +Y N D EF+++HPLAML+STVSS+M+K MA+ E F + DTLTGFKWIGN+AI L+KEG
Sbjct: 368 NKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEG 427

Query: 421 YYVPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVF 480
           Y+V FG+EEAIGYMFPAMEHDKDGI+A+VV LQAY +W   S +  IDILE G +KYG F
Sbjct: 428 YHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAF 487

Query: 481 KEYNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDH 540
           KEYNGYYVV +P VT +IF YIRN Y   G  YP  IG  +EV  +RDLTTG+QSDT D+
Sbjct: 488 KEYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDN 547

Query: 541 KPVLPVDPTSQMITLSGKPSDG---NGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASY 597
            P LPVDP+SQMIT++ K  D      +  +RFT+RGSGTEPKLK+YIE  + +   AS 
Sbjct: 548 IPSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASK 607

Query: 598 LAKLTWDVLRRGWFRPEIMNITTDF 622
           +AKLTWDVL++ W RPE+  +TT +
Sbjct: 608 IAKLTWDVLKKEWIRPEVTGVTTSY 632

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/616 (62%), Positives = 469/616 (76%), Gaps = 12/616 (1%)

Query: 9   VPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSEMQAGF 68
           +P +LK PISLW  QDRN +T +E+  LC   +W ELH+R ++R+QFGTAGLR+ M+AGF
Sbjct: 5   IPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAGF 64

Query: 69  SRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGFKVHYL 128
           SRMNTLV+IQATQGLA YIK+QFPD+LV VVGHDHRF+S +FA+ATAT  L  GF+VHYL
Sbjct: 65  SRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVHYL 124

Query: 129 NPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISDS 188
           N    +VHTP+VPF VD++KASVGVMITASHNPK+DNGYKVYY+NGCQIIPPHD AI+ S
Sbjct: 125 NQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIARS 184

Query: 189 IDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLV-ETNPLKLEIKAK 247
           I+ NLEP   VW +   + +A  +GKL+Y R++ML  Y   V  + V E + L    K K
Sbjct: 185 IESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDSLP---KGK 241

Query: 248 PWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEEKGALD 307
           PWFVYTPMHGVG+ +F  I  K + L    D+L V EQ NPDP FPTV FPNPEEKGALD
Sbjct: 242 PWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGALD 301

Query: 308 IGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEFQRYKNKD 367
           + ++LAE H I L++A+DPDADRFS+A K      W+QL+GN+IGFLFA++E Q+Y+  D
Sbjct: 302 LAIKLAENHGIKLVIASDPDADRFSVAFKGPHG--WQQLSGNDIGFLFAYYELQKYRGFD 359

Query: 368 EEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEGYYVPFGF 427
            E+Q+SHPLAML+STVSSQMI  MA +EGF +EDTLTGFKWIGNRA+ LE  GYYVPFGF
Sbjct: 360 AEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFGF 419

Query: 428 EEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVFKEYNGYY 487
           EEAIGYMFPA EHDKDGISAAVV LQAY  W I     P+DIL+    KYGVF+EYNGYY
Sbjct: 420 EEAIGYMFPATEHDKDGISAAVVFLQAYHSW-ISQGKSPLDILDEASAKYGVFREYNGYY 478

Query: 488 VVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKPVLPVD 547
           +V  P +T + F YIR  YTP G  YP +IG +++V  +RDLTTGYQSDTP++ P L VD
Sbjct: 479 LVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLHVD 537

Query: 548 PTSQMITLSGKPSDGNGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAKLTWDVLR 607
           P+SQMIT+  +P  G   EH+RFT+RGSGTEPKLKVYIEA A ++ RA  LA+ TWD+LR
Sbjct: 538 PSSQMITIVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDILR 597

Query: 608 RGWF-RPEIMNITTDF 622
             WF RP    +TT F
Sbjct: 598 EEWFNRP---GLTTKF 610

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/620 (61%), Positives = 463/620 (74%), Gaps = 2/620 (0%)

Query: 4   QLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSE 63
            +L+  P  L+  I  W   D+N ET  EV  LC+  DW EL+ RF  RI FGTAGLRS 
Sbjct: 7   HILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSR 66

Query: 64  MQAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGF 123
           M+AG +R+N+LVI+QATQGLA YI  QFP N V VVGHDHRFHSKEFA  TA  FL  GF
Sbjct: 67  MEAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGF 126

Query: 124 KVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDH 183
           KV YLNP    VHTPLVPF VD L ASVGVMITASHNPKMDNGYKVY++NGCQIIPPHD 
Sbjct: 127 KVLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDL 186

Query: 184 AISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLKLE 243
            I+ SID NLEPW   W +  V+  A K+ +++Y +++M  LY+K     L+    +   
Sbjct: 187 NIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLRN 246

Query: 244 IKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEEK 303
             + PWFVYTPMHGVG  IFS I +  + + E EDYLCVPEQ++PDPSFPTV FPNPEEK
Sbjct: 247 PGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEEK 306

Query: 304 GALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEFQRY 363
           GALD  + LA ++ INL++ANDPDADRFS+AV D++++ WRQLTGNEIGFLFA+ +F+ Y
Sbjct: 307 GALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMY 366

Query: 364 KNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEGYYV 423
           K  D+ FQ+ HPL +L+STVSSQMIKKMAEVEGF YEDTLTGFKWIGNRA  LEK+G++ 
Sbjct: 367 KAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFA 426

Query: 424 PFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVFKEY 483
           PFG+EEAIGYMF  MEHDKDGISA+++ L +Y  W  D++  P+DILE+G++KYGVFKEY
Sbjct: 427 PFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEY 486

Query: 484 NGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKPV 543
           NGYY+V +P +  E F+YIRN   P G  YP +IG E +VV +RDLT G+QSDT DH P 
Sbjct: 487 NGYYIVDNPKIMKETFDYIRNDRKP-GTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIPT 545

Query: 544 LPVDPTSQMITLSGKPSDGN-GNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAKLT 602
           LPVDP SQMIT+  KP+  N   +H+RFTIRGSGTEPKLKVYIEAC+ +E  A  LAK  
Sbjct: 546 LPVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQM 605

Query: 603 WDVLRRGWFRPEIMNITTDF 622
           WD L+  WFRP+   + TDF
Sbjct: 606 WDTLQEVWFRPQTTGLVTDF 625

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/615 (59%), Positives = 466/615 (75%), Gaps = 4/615 (0%)

Query: 9   VPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSEMQAGF 68
           +P +L+  I  W   D+N ET  EV  LC + +WDELHKRFD+RI FGTAGLR+ M+AG 
Sbjct: 6   IPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAGT 65

Query: 69  SRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGFKVHYL 128
           +R+N LVI+QA+QGLATYIK +FP NL  VVGHDHR+HS+EFA+ TA  F+  GFKV+YL
Sbjct: 66  NRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYYL 125

Query: 129 NPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISDS 188
           NP  EFVHTP+VP++VD L ASVGVMITASHNPKMDNGYKVYY+NGCQIIPPHDH I+++
Sbjct: 126 NPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAET 185

Query: 189 IDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLKLEIKAKP 248
           I+ NLEPW+  W F+ +L+ A   GK+ Y R+ ML  Y   V   L++ +    +   KP
Sbjct: 186 INNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFAAPD--EKP 243

Query: 249 WFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEEKGALDI 308
           WFVYTPMHGVG  IFSTI+ ++++L +  DY+ VPEQ++PDPSF TV FPNPEEKGAL++
Sbjct: 244 WFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALNL 303

Query: 309 GMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEFQRYKNKDE 368
            + LAE + I L++ANDP+ADRFS+AV+D   ++W+QLTGNEIG LFAF+EF+ Y+   +
Sbjct: 304 AITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKAAD 363

Query: 369 EFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEGYYVPFGFE 428
           +  ++ PLAML+STVS+Q+IK+MAE EGFLY+DTLTGFKWIGN A  LE++GY+VPFG+E
Sbjct: 364 KGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPFGYE 423

Query: 429 EAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVFKEYNGYYV 488
           EAIGYMFPAMEHDKDG+SAA+V LQAY  W + S+ +PIDI+   + KYGV  EYNGYY+
Sbjct: 424 EAIGYMFPAMEHDKDGVSAAIVFLQAYANW-LQSSSNPIDIIHECYDKYGVSAEYNGYYI 482

Query: 489 VPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKPVLPVDP 548
           V  P  T ++FE IR+ YT  G+ +P SIGE   V  +RDLT G+ S T D KP+LPVD 
Sbjct: 483 VSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPVDK 542

Query: 549 TSQMITLSGKPSDG-NGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAKLTWDVLR 607
            SQMIT++  PS   N  E +RFTIRGSGTEPKLKVYIE  +  E RA  LAK  W+ L+
Sbjct: 543 NSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWETLK 602

Query: 608 RGWFRPEIMNITTDF 622
             WF+P    ++TDF
Sbjct: 603 HEWFKPSSNGLSTDF 617

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/619 (61%), Positives = 471/619 (76%), Gaps = 1/619 (0%)

Query: 5   LLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSEM 64
           + +  P++L+  I LW  QD+  ET  EV  LCK+S+W ELHKRFD+RI FGTAGLRS M
Sbjct: 8   ICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRM 67

Query: 65  QAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGFK 124
           +AGFSRMN LVI+QA+QGLA YIK QFP NL  VVGHDHRFHSK+FA  TA+ FL  GFK
Sbjct: 68  EAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFK 127

Query: 125 VHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHA 184
           V+YLNP+  FVHTPLVPF+V+ L AS+GVMITASHNPKMDNGYKVYYSNGCQIIPPHD  
Sbjct: 128 VYYLNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKN 187

Query: 185 ISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLKLEI 244
           I+ +ID NLEPW++ W +     K LK+ KL+Y REEM N Y + +   LV ++  +   
Sbjct: 188 IAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNN 247

Query: 245 KAK-PWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEEK 303
             K PWFVYTPMHGVG+NIF+ I K  +   E  DY  V EQ  PDP+FPTV FPNPEEK
Sbjct: 248 NGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEK 307

Query: 304 GALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEFQRY 363
           GAL +  +LAEE++I+L++ANDPDADRFS+A K+ ++ +W+QL+GNEIGFLFA FE ++Y
Sbjct: 308 GALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKY 367

Query: 364 KNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEGYYV 423
            ++D E++R+HPLAM++STVSSQMIKKMA+VE F YEDTLTGFKWIGNRA+ L+ +GYYV
Sbjct: 368 MSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYYV 427

Query: 424 PFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVFKEY 483
           PFGFEEAIGYMFP M  DKDG+SAAVV L AY  W  +    P DILE GF+K+G FKEY
Sbjct: 428 PFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEKGFKKFGFFKEY 487

Query: 484 NGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKPV 543
           NGYY+   P  T +IF+++R  Y  +G PYP +IG+E ++  +RDLTTGYQS+T D+ P 
Sbjct: 488 NGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPN 547

Query: 544 LPVDPTSQMITLSGKPSDGNGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAKLTW 603
           LPVDP S+MIT+   P    G   +RFT+RGSGTEPKLK+YIEA ADNEK A  LA   W
Sbjct: 548 LPVDPHSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEMW 607

Query: 604 DVLRRGWFRPEIMNITTDF 622
           +VL++ W RP++  +TT F
Sbjct: 608 NVLKKEWIRPDVTGLTTTF 626

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/622 (61%), Positives = 470/622 (75%), Gaps = 3/622 (0%)

Query: 3   QQLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRS 62
           + LL ++P DLK  I +WF  D N ET++EV  LC N   DELHKRFD RI FGTAGLRS
Sbjct: 9   ENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRS 68

Query: 63  EMQAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKG 122
            M+AGF+RMN L ++Q+TQGLA+YIK QFP NL  VVGHDHR+HSKEFA+ TA  FL  G
Sbjct: 69  RMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAG 128

Query: 123 FKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 182
           FKV+YLNP+ EFVHTP+VPF ++   AS+GVMITASHNP+MDNGYKVYY+NGCQIIPPHD
Sbjct: 129 FKVYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPHD 188

Query: 183 HAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETN-PLK 241
             I++ I+ NLEP ++ W    V++KA++  KL+YS+E++L  Y   + K ++  N  L 
Sbjct: 189 KNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISLG 248

Query: 242 LEIKAK-PWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNP 300
             IK K PWFVYTPMHGVG+ IF  I    ++LVE  DY+CV EQ  PDPSFPTV FPNP
Sbjct: 249 TTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPNP 308

Query: 301 EEKGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEF 360
           EEKGALD+G++ A++H+I+L+VANDPDADRFS+AV++  + +++QLTGNEIGFLFA+F +
Sbjct: 309 EEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFLW 368

Query: 361 QRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEG 420
           ++Y     +F+   PLAM++STVSSQMIKKMAEVEGF YEDTLTGFKWIGN+A  LEKEG
Sbjct: 369 EQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELEKEG 428

Query: 421 YYVPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVF 480
           YYVPFGFEEAIGYMFP ME DKDGI+A VV LQAY  W +++     DI+E GF+KYGVF
Sbjct: 429 YYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKYGVF 488

Query: 481 KEYNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDH 540
           KEYNGYY+V    +T  IF+ IR         Y   IG E +V+ +RDLT GYQSDT  +
Sbjct: 489 KEYNGYYIVNDLSLTKIIFDNIRENKNDKE-KYVSHIGTEFKVITFRDLTLGYQSDTIGN 547

Query: 541 KPVLPVDPTSQMITLSGKPSDGNGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAK 600
            P LPVDP+SQMIT++  P+    N  +RFTIRGSGTEPKLKVYIEA A  E  A+ LAK
Sbjct: 548 VPTLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEANRLAK 607

Query: 601 LTWDVLRRGWFRPEIMNITTDF 622
           LTWDVL+R WF  E   +TT+F
Sbjct: 608 LTWDVLKREWFSSEKTGLTTNF 629

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/640 (58%), Positives = 476/640 (74%), Gaps = 22/640 (3%)

Query: 2   YQQLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLR 61
           +  L++  P DL+  + LW +QD++  T +E+  LCK+++  ELH+RFD+RI FGTAGLR
Sbjct: 7   FNALIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLR 66

Query: 62  SEMQAGFSRMNTLVIIQATQGLATYIKQQFPDN---LVVVVGHDHRFHSKEFARATATAF 118
           S M+AGFSRMNTL ++QA+QGLATY+K    +    L+ V+GHDHR+HSKEFA+  AT F
Sbjct: 67  STMEAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVF 126

Query: 119 LLKGFKVHYLNPD-------HEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYY 171
           L+ GFKV+YLN D       ++FVHTP+VPF V  LKASVGVM+TASHNPKMDNGYKVYY
Sbjct: 127 LIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYY 186

Query: 172 SNGCQIIPPHDHAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVS 231
           SNGCQIIPPHD  IS  ID NLEPW N W + +++  A  +G L+Y R+ MLN Y  ++ 
Sbjct: 187 SNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLE 246

Query: 232 KTLVETNPL----KLEIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQN 287
           + L   + +    K+++K+KPWFVYTPMHGVG+ IF+ I  + + + EGED++ V EQ++
Sbjct: 247 EKLTSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKH 306

Query: 288 PDPSFPTVGFPNPEEKGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQS-SKWRQL 346
           PDP FPTV FPNPEEKGA+D+G++LAE++ I+L++ANDPDADRFSIAVK   S   W Q 
Sbjct: 307 PDPGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQF 366

Query: 347 TGNEIGFLFAFFEFQRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGF 406
           TGNEIG+LFA+FEFQ+YK   ++  R   L M++STVSSQMIKKMAE+EGF YE+TLTGF
Sbjct: 367 TGNEIGYLFAYFEFQKYKISKQDLHR---LYMVNSTVSSQMIKKMAEIEGFNYEETLTGF 423

Query: 407 KWIGNRAIILEKEGYYVPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDP 466
           KWIGNRAI L  +G  VPFG+EEAIGYMFP ME DKDGI+A V+ +QA+  W     +DP
Sbjct: 424 KWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDP 483

Query: 467 IDILENGFQKYGVFKEYNGYYVVPSPLVTTEIFEYIRNVY----TPTGVPYPPSIGEEIE 522
            +I++ GF+KYGVF EYNGYY      +T +IF+Y+R  Y    +     YP  IGEE +
Sbjct: 484 YEIIQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEFK 543

Query: 523 VVYYRDLTTGYQSDTPDHKPVLPVDPTSQMITLSGKPSDGNGNEHIRFTIRGSGTEPKLK 582
           ++ YRDLTTGYQSDTPD+KP+LPVDP+SQMIT+   P+D   +  IR TIRGSGTEPKLK
Sbjct: 544 IIKYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGTEPKLK 603

Query: 583 VYIEACADNEKRASYLAKLTWDVLRRGWFRPEIMNITTDF 622
           VYIEAC+ +   AS+LAK  W+VL+R W RPE   ITT F
Sbjct: 604 VYIEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/616 (59%), Positives = 445/616 (72%), Gaps = 4/616 (0%)

Query: 7   ETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSEMQA 66
           E VP  LK     W   D+N ET  E+ T+    DW EL  R + RI FGTAGLR  M+A
Sbjct: 13  EYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEA 72

Query: 67  GFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGFKVH 126
           GF+RMN+LVI+Q +QGLA YI ++FP NL VVVGHDHR+HSKEFA  T   FL  GFKV 
Sbjct: 73  GFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVF 132

Query: 127 YLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAIS 186
           YLN ++EFVHTPLVP++VDKL+++ GVMITASHNPK DNGYKVYYSNGCQIIPPHD  I+
Sbjct: 133 YLNTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIA 192

Query: 187 DSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLKLEIKA 246
            +I+ NL PW+  W + D+ +   + G L ++  +M   Y +++++  V TN   +    
Sbjct: 193 LTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITR-YVFTNGSPMLKTG 251

Query: 247 KPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEEKGAL 306
           KPWFVYTPMHGVG  IF  I K+ + L E  DY  VPEQ  PDPSFPTV FPNPEEKGAL
Sbjct: 252 KPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKGAL 311

Query: 307 DIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEFQRYKNK 366
           D+ ++LAE   + L++ANDPDADRFS AVKD +S +WRQL+GNEIG LFA F+ Q +K  
Sbjct: 312 DMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKLQEHK-- 369

Query: 367 DEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEGYYVPFG 426
            E+     PLAML+STVSSQM+KKMA+VEGF YE+TLTGFKWIGNRA+ LE++GY V FG
Sbjct: 370 -EKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVCFG 428

Query: 427 FEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVFKEYNGY 486
           +EEAIGYMFP MEHDKDGI A+VV L  Y KW     L P+D+L+  F+KYGVF EYNGY
Sbjct: 429 YEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYNGY 488

Query: 487 YVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKPVLPV 546
           Y V  P +   +F YIR+ Y P   PYP  +G E  +  +RDLT GYQSDT D KP LPV
Sbjct: 489 YTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTLPV 548

Query: 547 DPTSQMITLSGKPSDGNGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAKLTWDVL 606
           D +SQMIT + KP    G+E IRFTIRGSGTEPKLKVYIE+ A N++ A+ LA LTW+VL
Sbjct: 549 DASSQMITATLKPERTVGHEEIRFTIRGSGTEPKLKVYIESHAANKEAAANLAHLTWNVL 608

Query: 607 RRGWFRPEIMNITTDF 622
           RR WFRPEI  + T F
Sbjct: 609 RREWFRPEITGLKTSF 624

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/623 (57%), Positives = 449/623 (72%), Gaps = 19/623 (3%)

Query: 9   VPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSEMQAGF 68
           +P+DLK  +  WF+ D+N ET  E+  L    +W+ELHKR D RI FGTAGLRS+M+AGF
Sbjct: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67

Query: 69  SRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGFKVHYL 128
           SRMNTL ++QA+QGLA YI ++FP+N  V VGHDHRF+S++FA  T+ AFL   FKV+ L
Sbjct: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127

Query: 129 --NPD---HEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDH 183
             N D     FVHTP+VPFA+D+L AS GVMITASHNPKMDNGYKVYYSNGCQIIPPHD 
Sbjct: 128 GFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187

Query: 184 AISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLKLE 243
            I+ SI  NL PW   W    V+ +A ++G  +  ++ M++ Y KE+S  LV ++   + 
Sbjct: 188 LIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSD---IG 244

Query: 244 IKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEEK 303
            ++KPWFVYTP+HGVGF IF  I  + + LVEG DY CV E + PDP+FPTV FPNPEE 
Sbjct: 245 DRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEA 304

Query: 304 GALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEFQRY 363
           GALD+ + LA+++ I+ ++ NDPDADRFS AVK     KWRQLTGNEIGFLFA F +++Y
Sbjct: 305 GALDLAIALADKNGISFVLGNDPDADRFSAAVK--HQGKWRQLTGNEIGFLFAQFVWEKY 362

Query: 364 KNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEGYYV 423
           + +  EF+  +PLA+++STVSSQMIKK+A VE F YEDTLTGFKW+GNRA  LE  GYYV
Sbjct: 363 QKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYV 422

Query: 424 PFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVFKEY 483
           PF +EEAIG+MF  + HDKDG+SAAVV LQ    WK  + L PID+L++ F KYGVFKEY
Sbjct: 423 PFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQA-LSPIDVLQSAFGKYGVFKEY 481

Query: 484 NGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKPV 543
           NGYY VP   +T  IF  IR+ Y      YP  IG + +VV + DLT G+QSDT D+ P 
Sbjct: 482 NGYYTVPDLSLTDRIFSDIRSSYD----SYPKHIGNQFDVVSFTDLTKGFQSDTADNTPR 537

Query: 544 LPVDPTSQMITLSGKPSDGNGN----EHIRFTIRGSGTEPKLKVYIEACADNEKRASYLA 599
           LPVDP+SQMI  +  PS   G+    E +RFT RGSGTEPKLKVYIEA +  E RAS LA
Sbjct: 538 LPVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLA 597

Query: 600 KLTWDVLRRGWFRPEIMNITTDF 622
           + TW+VLR  WF+P+   ++T F
Sbjct: 598 RTTWNVLRDEWFKPKETGLSTKF 620

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/623 (57%), Positives = 448/623 (71%), Gaps = 19/623 (3%)

Query: 9   VPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSEMQAGF 68
           VP DLK  +  W   D+N +T +++  L ++  W EL  R + RI FGTAGLRS M+AGF
Sbjct: 9   VPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRMEAGF 68

Query: 69  SRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGFKVHYL 128
           +RMNTL ++QA+QGLA YI   FPDNL VVVGHDHRF+SK+FA  T  AFL  GFKV+ L
Sbjct: 69  NRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKVYDL 128

Query: 129 NPDHE-----FVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDH 183
               +      VHTP+VPF +D L+AS G+MITASHNPKMDNGYKVYYSNGCQIIPPHD 
Sbjct: 129 GFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQIIPPHDQ 188

Query: 184 AISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLKLE 243
            IS SI  NLEPW   W  + V  +A++   L+ +++ +++ Y   V ++LV TN   + 
Sbjct: 189 RISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVITN---VN 245

Query: 244 IKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEEK 303
               PWFVYTP+HGVGF IF  I+     L +G DYLCV EQ+ PDP+FPTV FPNPEEK
Sbjct: 246 HTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEK 305

Query: 304 GALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEFQRY 363
           GALD  + LAE+HDI  ++ NDPDADRFS+A K   + +WRQLTGNEIGFLFA ++++ Y
Sbjct: 306 GALDKAIELAEKHDITFVLGNDPDADRFSVAAK--HNGQWRQLTGNEIGFLFAQYKWETY 363

Query: 364 KNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEGYYV 423
           + + ++F+ ++PLAM++STVSSQMIKKMAEVEGF YEDTLTGFKW+GNRA  LE  GY+V
Sbjct: 364 RLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGYFV 423

Query: 424 PFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVFKEY 483
           PF +EEAIGYMF  + HDKDGISAAVV LQ    WK  + L P D+L+  +QKYGVFKEY
Sbjct: 424 PFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQA-LTPFDVLQRAYQKYGVFKEY 482

Query: 484 NGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKPV 543
           NGYY+VP   +T ++F  IR+ ++      P  IG+E  V  Y DLTTGYQS+TPD +P 
Sbjct: 483 NGYYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQSNTPDSEPR 538

Query: 544 LPVDPTSQMITLSGKPSDGNG----NEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLA 599
           LPVDP+SQMIT +  P+   G    +E +RFT RGSGTEPKLKVYIEA + +E+ AS LA
Sbjct: 539 LPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVSSSEELASALA 598

Query: 600 KLTWDVLRRGWFRPEIMNITTDF 622
           K  WDVLRR WF+PE   + T+F
Sbjct: 599 KKAWDVLRREWFKPEQTGLATNF 621

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/626 (56%), Positives = 435/626 (69%), Gaps = 17/626 (2%)

Query: 7   ETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSEMQA 66
           + VPS LK  +  W   D+N ET  E+  L  N  WDEL KR   RI FGTAGLR+ M+A
Sbjct: 6   DAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEA 65

Query: 67  GFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGFKVH 126
           GFSRMNTL +IQA+QGLA YIK QFPD+L VV+GHDHRFHS+EFA AT  AFL   + ++
Sbjct: 66  GFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIY 125

Query: 127 YLN------PDHEFVHTPLVPFAVDKLKA---SVGVMITASHNPKMDNGYKVYYSNGCQI 177
           YLN       +  FVHTP+VPFA++ ++    S GVMITASHNPKMDNGYKVYY+NGCQI
Sbjct: 126 YLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQI 185

Query: 178 IPPHDHAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVET 237
           IPPHD  I   ID NLEPW   W    ++ +A+K GKL   R+EML  Y   +   LV+ 
Sbjct: 186 IPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQ 245

Query: 238 NPLKLEIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGF 297
           + LK      PWFVYTPMHGVG+  F   V   + + E +DY+ VPEQ+ PDP FPTV F
Sbjct: 246 SNLKF--AGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSF 303

Query: 298 PNPEEKGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAF 357
           PNPEE+GALD+ M++A+ + I +++ANDPDADRFS+AVK     +W QLTGN+IG LFA 
Sbjct: 304 PNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVK--YHGEWNQLTGNQIGILFAQ 361

Query: 358 FEFQRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILE 417
            E Q Y  K+ +  R   LAML+S VSSQ+++KMAE EGFL  +TLTGFKW+GNRA  LE
Sbjct: 362 AEMQSY-FKEPKLDRKQ-LAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELE 419

Query: 418 KEGYYVPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKY 477
            EGYYVPF +EEAIGYMF  + HDKDGI+AA V LQ   +WK  +     ++L+  ++KY
Sbjct: 420 LEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAK-SSQEVLQECYEKY 478

Query: 478 GVFKEYNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDT 537
           G F +YNGYY+  +P VT E+F+Y RN YTP G PYP  IG E EV Y RDLT GYQSDT
Sbjct: 479 GYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDT 538

Query: 538 PDHKPVLPVDPTSQMITLSGKPSDGNGN-EHIRFTIRGSGTEPKLKVYIEACADNEKRAS 596
             + P LPVD  SQMIT   KP     + E +RFT RGSGTEPKLKVYIE+CA N +RAS
Sbjct: 539 ATNIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQRAS 598

Query: 597 YLAKLTWDVLRRGWFRPEIMNITTDF 622
           +L+ L WDVL+R WFRP    + T+F
Sbjct: 599 HLSHLAWDVLKREWFRPTETGLQTNF 624

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/631 (56%), Positives = 450/631 (71%), Gaps = 41/631 (6%)

Query: 4   QLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSE 63
           +++E++PSDL+G +  W   D+  ET  E+  LC   D  ELHKR DT I FGTAGLR  
Sbjct: 5   EVIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGR 64

Query: 64  MQAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGF 123
           M+AGF+RMN L + QA+QGLA YIK+QFP+NL VVVGHDHR +S+ F + T   FL  GF
Sbjct: 65  MEAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGF 124

Query: 124 KVHYLNPDHE--FVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPH 181
           KV +LN ++E   VHTPLVPF V+   ASVG+MITASHNPKMDNGYKVYY+NGCQIIPPH
Sbjct: 125 KVFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPH 184

Query: 182 DHAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLK 241
           D  I++SI  NLEP++           + + G ++  +E+M   Y   +  TL++    K
Sbjct: 185 DKLIAESIIHNLEPFS-----------SPQTGTIIDCKEKMTKKYIDAIGSTLIDGAVNK 233

Query: 242 LEIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPE 301
                +PWFVYTPMHGVGF IF +I K+ +SL EG+DYL V EQ+ PD  FPTV FPNPE
Sbjct: 234 K--TNEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPE 291

Query: 302 EKGALDIGMRLAEEHD-INLLVANDPDADRFSIAVKDTQ---SSKWRQLTGNEIGFLFAF 357
           EKGALD+ +    ++D ++L++ANDPDADRFS+AV+D     ++ WRQLTGNEIGFLFA+
Sbjct: 292 EKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAY 351

Query: 358 FEFQRYKNK--DEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAII 415
           +E++RYK+   DE      PLAML+STVSSQMIK+MAE+EGF YEDTLTGFKW+GNRA+ 
Sbjct: 352 YEWERYKHSPIDE------PLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALE 405

Query: 416 LEKEGYYVPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQ 475
           LE+EGYY PF +EEAIGYMF ++ HDKDGISAA+V LQAY KW+  S    +DIL     
Sbjct: 406 LEQEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRA-SGQTVLDILATASL 464

Query: 476 KYGVFKEYNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQS 535
           KYG FKE+NGYY+VP   +T ++F+ IR++ +    PYP  +G   E++ +RDLT GYQS
Sbjct: 465 KYGHFKEFNGYYIVPDLAITKQVFDAIRSIES----PYPKKLGSSFEIIKFRDLTNGYQS 520

Query: 536 DTPDHKPVLPVDPTSQMIT----LSGKPSDGNGNEHIRFTIRGSGTEPKLKVYIEACADN 591
           DTPDH P L  DP+SQMIT    L  +P+       +RFTIRGSGTEPKLKVYIEA  + 
Sbjct: 521 DTPDHIPELASDPSSQMITCEMLLVEQPTS-----RVRFTIRGSGTEPKLKVYIEARTNT 575

Query: 592 EKRASYLAKLTWDVLRRGWFRPEIMNITTDF 622
           E  +  LAK TWDVLR+ WF+PE+  + T F
Sbjct: 576 EPNSIALAKFTWDVLRQEWFKPELTGLLTPF 606

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/628 (54%), Positives = 437/628 (69%), Gaps = 20/628 (3%)

Query: 7   ETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSEMQA 66
           E +P DL+  I  WF  D+NP+T  E+ +L  + +W+EL  R   RI FGTAGLR+ M+A
Sbjct: 11  ELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEA 70

Query: 67  GFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGFKVH 126
           GF+RMNTL +IQA+QGLATYIK QFP+NL VVVGHDHR++SK FA     AFL  GF+V+
Sbjct: 71  GFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVY 130

Query: 127 YLN--PDHE----FVHTPLVPFAVDKLK--ASVGVMITASHNPKMDNGYKVYYSNGCQII 178
           YLN  P ++    +VHTP+VPF V  ++  AS G+MITASHNPKMDNGYKVYYSNGCQI 
Sbjct: 131 YLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQIT 190

Query: 179 PPHDHAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETN 238
           PPHD  I+  ID NL PW   W    ++  A    +L   ++E++  Y + +  +LV TN
Sbjct: 191 PPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTN 250

Query: 239 PLKLEIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFP 298
              L    K WFVYTPMHGVG+ IF+ IV  T+ L E E YL V  Q+ PDP F TV FP
Sbjct: 251 --SLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFP 308

Query: 299 NPEEKGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFF 358
           NPEE+GAL++ + LA      L++ANDPDADRFS AVKD   +KW+QLTGN++G+LFA  
Sbjct: 309 NPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKD--GNKWKQLTGNQLGYLFAVG 366

Query: 359 EFQRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEK 418
           + +++ N++E      PLAML STVSSQMI KMA+VEGF + +TLTGFKW+ NRAI LE 
Sbjct: 367 QLEKFSNQNE---NKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLEN 423

Query: 419 EGYYVPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYG 478
           +G+YVPF +EEAIGYMF ++ HDKDG+SAA   LQ   +WK +    P+D+L  G++KYG
Sbjct: 424 DGFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKT-PLDVLNAGYEKYG 482

Query: 479 VFKEYNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTP 538
            F EYNGYY V    +  ++F+YIRN      VPYP +IG E  V  +RDLT GYQSDT 
Sbjct: 483 NFVEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTG 542

Query: 539 DHKPVLPVDPTSQMITLSGKP----SDGNGNEHIRFTIRGSGTEPKLKVYIEACADNEKR 594
           +H P LPV P S MIT   KP    +    ++++RFTIRGSGTEPKLKVYIE+ A +++ 
Sbjct: 543 NHIPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEY 602

Query: 595 ASYLAKLTWDVLRRGWFRPEIMNITTDF 622
           A+ LAKLTWDVL+R WFRPE+  + T F
Sbjct: 603 ATKLAKLTWDVLKREWFRPEVTGLQTKF 630

>TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445
           YKL127W
          Length = 570

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 125/300 (41%), Gaps = 45/300 (15%)

Query: 56  GTAGLRSEMQAGFSRMNTLVIIQATQGLATYIKQQFPD---NLVVVVGHDHRFHSKEFAR 112
           GT+GLR +       MN    +  T+     I    P+   + ++VVG D R+++ +  +
Sbjct: 17  GTSGLRKKTAV---FMNN---VHYTENFIQSILDAIPESSKDAILVVGGDGRYYNDKILQ 70

Query: 113 ATATAFLLKGFKVHYLNPDHEFVHTPLVPFAV------DKLKASVGVMITASHN---PKM 163
             A      G +   +   H  + TP     +      D  K + G+++TASHN   P+ 
Sbjct: 71  IIAAISAANGVRKLVIG-QHGLLSTPAASHIIRSYQDKDGKKVTGGIILTASHNPGGPEN 129

Query: 164 DNGYKVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWKFSDVLNKALKQGK--------L 215
           D G K   SNG        +AI D I   L  +  V  F ++ N ++K  K        +
Sbjct: 130 DIGIKYNLSNGGPAPESVTNAIWD-ISKKLTHYKIVKGFPEI-NLSVKGEKSYGSLVIDV 187

Query: 216 MYSREEMLN----LYSKEVSKTLVETNPLKLEIKAKPW-FVYTPMHGVGFNIFSTIVKKT 270
           + + +E ++    ++  ++ K  V+T     +   K W  ++  ++GV       I    
Sbjct: 188 VDTTQEYVDFLKGIFDFDLIKKFVDT-----QRSTKNWKLLFDGLNGVTGPYGRAIFVDE 242

Query: 271 MSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGMRLAEEHDINLLVANDPDADR 330
           + L E E    V +  +P P F  +  P+P    A  +  R+ +E  I    A+D D DR
Sbjct: 243 LGLPENE----VLQNCHPKPDFGGI-HPDPNLTYARTLVDRVDKEK-IEFGAASDGDGDR 296

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%)

Query: 149 ASVGVMITASHNPKMDNGYKVYYSNGCQII 178
           A VGVMITASHNP  DNG K+  S+G  ++
Sbjct: 52  APVGVMITASHNPPRDNGVKIVESDGSMLL 81

>Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON}
           (136243..137955) [1713 nt, 571 aa]
          Length = 570

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 59/143 (41%), Gaps = 20/143 (13%)

Query: 56  GTAGLRSEMQAGFSRMNTLVIIQATQGLATYIKQQFPD---NLVVVVGHDHRFHSKEFAR 112
           GT+GLR + +   S  N       T+     I    P+   N  +VVG D RF++     
Sbjct: 19  GTSGLRKKTKIFMSEKN------YTENFIQSILNSIPNGVKNSTIVVGGDGRFYNDIILD 72

Query: 113 ATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKLKASV---GVMITASHN---PKMDNG 166
                    G +   +   +  + TP   + +   K S    G+++TASHN   P+ D G
Sbjct: 73  KIMQISAANGVRKLVIG-QNGILSTPAASYIIRNYKESCNGGGIILTASHNPGGPENDIG 131

Query: 167 YKVYYSNGCQIIPPHDHAISDSI 189
            K   SNG     P   +I+D I
Sbjct: 132 IKYNLSNGG----PAPESITDEI 150

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178
           VGVM+TASHNP +DNG KV    G  +I
Sbjct: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLI 87

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178
           VGVMITASHNP  DNG KV   +G  +I
Sbjct: 57  VGVMITASHNPSGDNGVKVVEPDGSMLI 84

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%)

Query: 150 SVGVMITASHNPKMDNGYKVYYSNGCQI 177
           +VGVM+TASHNP +DNG K+   NG  +
Sbjct: 61  AVGVMVTASHNPPVDNGVKIVEPNGSML 88

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 149 ASVGVMITASHNPKMDNGYKVYYSNGCQII 178
           +++GVM+TASHNP  DNG K+   NG  ++
Sbjct: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISD 187
           +GVMITASHNP  DNG K+   +G  +I   +   +D
Sbjct: 59  IGVMITASHNPPQDNGVKIVEPSGAMLIESWEQIATD 95

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score = 38.5 bits (88), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 150 SVGVMITASHNPKMDNGYKVYYSNGCQI 177
           +VGVMITASHNP  DNG K+   NG  +
Sbjct: 53  AVGVMITASHNPPEDNGVKIVEPNGAML 80

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 37.7 bits (86), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 37.7 bits (86), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 37.7 bits (86), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 37.7 bits (86), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 570

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 128/570 (22%), Positives = 228/570 (40%), Gaps = 80/570 (14%)

Query: 56  GTAGLRSEMQAGFSRMN-TLVIIQATQGLATYIKQQFPD---NLVVVVGHDHRFHSKEFA 111
           GT+GLR + +   +  + T   IQA       I +  P+   + V+VVG D R+++ E  
Sbjct: 19  GTSGLRKKTKVFMNEPHYTENFIQA-------IMEAIPEGSQDAVLVVGGDGRYYNNEVL 71

Query: 112 RATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMITASHN---PKMDNG 166
           +         G K   +   +  + TP     +     K++ G+++TASHN   P+ D G
Sbjct: 72  QKIGEIGAANGVK-KLIVGQNGLLSTPAASHIIRSYPEKSTGGIILTASHNPGGPENDFG 130

Query: 167 YKVYYSNGCQIIPPHDHAISDSI---DMNLEPWANVWKFSDV----LNKALKQGKLMYSR 219
            K   SNG     P   ++++SI      L  +  V  F  +    + K  + G L+   
Sbjct: 131 IKYNLSNGG----PAPESVTNSIFEKSKQLASYKTVKNFPKINLSKIGKNQEYGSLLVDV 186

Query: 220 EEMLNLYSKEVSKTLVETNPLKLEI---KAKPWF--VYTPMHGVGFNIFSTIVKKTMSLV 274
            ++   Y K + K + + + +K  I   ++   F  ++  ++G+       I    + L 
Sbjct: 187 IDVTAEYVK-LMKEIFDFDLIKKFIDHQRSTKGFKILFDALNGITGPYGKAIFADELGLP 245

Query: 275 EGEDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGMRLAEEHDINLLVANDPDADRFSIA 334
             E    V +   P P F  +  P+P    A  +  R+ +E  I    A+D D DR  I 
Sbjct: 246 AEE----VLQNYEPKPDFGGL-HPDPNLTYAHTLVERVDKEQ-IAFGAASDGDGDRNMI- 298

Query: 335 VKDTQSSKWRQLTGNEIGFLFAFFEFQRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEV 394
                        G+ +  +        Y ++   F++     +  S  +S  I ++A+ 
Sbjct: 299 ---YGCGPAFVSPGDSVAII------AEYASEIPYFKKQGIYGLARSFPTSAAIDRVAKA 349

Query: 395 EGFLYEDTLTGFKWIGNRAIILEKEGYYVPFGFEEAIGYMFPAMEHDKDGISAAVV---L 451
           +G    +  TG+K+    A+   K+   +    EE+ G     +  +KDG+ A V    +
Sbjct: 350 QGLNCYEVPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHV-REKDGVWAIVAWLNI 403

Query: 452 LQAYCKWKIDSNLDPIDILENGFQKYG--VFKEYNGYYVVPSPLVTTEIFEYIRNVYTPT 509
           L  Y +   DS++    +L+  + KYG   F  Y+         V+ E    +  V    
Sbjct: 404 LAIYNREHPDSDVSIKVVLDEFWAKYGRTFFTRYD------FEQVSGEAAAKVLRVLEDL 457

Query: 510 GVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKPVLPVDPTSQMITLSGKPSDGNGNEHIR 569
            V    +IG+ +      DLT    +D  D          S+   L  K S+G      R
Sbjct: 458 VVSKESAIGKLLPG--NTDLTV---TDCGDFSYTDLDGSVSEHQGLYAKLSNG-----CR 507

Query: 570 FTIRGSGTEPK---LKVYIEACADNEKRAS 596
           F +R SGT      +++Y+E   D+  + S
Sbjct: 508 FVVRLSGTGSSGATIRLYLERYTDDASKYS 537

>TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa]
           {ON} Anc_2.445 YKL127W
          Length = 569

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 57/142 (40%), Gaps = 19/142 (13%)

Query: 56  GTAGLRSEMQAGFSRMNTLVIIQATQGLATYIKQQFPD---NLVVVVGHDHRFHSKEFAR 112
           GT+GLR + +      N       T+     I    P+   +  +VVG D RF++     
Sbjct: 19  GTSGLRKKTKVFMDEPNY------TENFIQAIMDAIPEGSKDATLVVGGDGRFYNDVIMN 72

Query: 113 ATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKLKASV--GVMITASHN---PKMDNGY 167
             A      G K   +   +  + TP     +   K  V  G+++TASHN   P  D G 
Sbjct: 73  KIAAIGAANGVKKLIIG-QNGILSTPAASHIIRTYKDKVTGGIILTASHNPGGPTNDLGI 131

Query: 168 KVYYSNGCQIIPPHDHAISDSI 189
           K    NG     P   A++D+I
Sbjct: 132 KYNLGNGA----PAPEAVTDAI 149

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/24 (62%), Positives = 19/24 (79%)

Query: 151 VGVMITASHNPKMDNGYKVYYSNG 174
           +GVM+TASHNP +DNG KV   +G
Sbjct: 59  IGVMVTASHNPPVDNGVKVVEPDG 82

>Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 99/249 (39%), Gaps = 23/249 (9%)

Query: 96  VVVVGHDHRFHSKEFARATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGV 153
            +VVG D R+++       A      G K   +   H  + TP     +     K + G+
Sbjct: 56  TLVVGGDGRYYNDVILHKIAAISAANGVKKLVIG-QHGLLSTPAASHIMRTYEDKCTGGI 114

Query: 154 MITASHN---PKMDNGYKVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWKFSDV----L 206
           ++TASHN   P+ D G K   SNG        +AI + I   L  +  V  F ++    +
Sbjct: 115 ILTASHNPGGPENDMGIKYNLSNGGPAPESVTNAIWE-ISKKLTSYKIVKDFPELDLQTI 173

Query: 207 NKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLKLEI----KAKPW-FVYTPMHGVGFN 261
            K  K G L+    ++   Y  E+ + + + N +K  I      K W  ++  M+GV   
Sbjct: 174 GKDRKYGPLLIDIIDVTKAYV-ELMEEIFDFNLIKKFIDNQRSTKNWKLLFDSMNGVTGP 232

Query: 262 IFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGMRLAEEHDINLL 321
               I      L   E    V +  +P P F  +  P+P    A  +  R+  E  I   
Sbjct: 233 YGKAIFVDKFGLPAEE----VLQNWHPSPDFGGM-HPDPNLTYASSLVKRVDREQ-IEFG 286

Query: 322 VANDPDADR 330
            A+D D DR
Sbjct: 287 AASDGDGDR 295

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 17/21 (80%)

Query: 149 ASVGVMITASHNPKMDNGYKV 169
           A VGVM+TASHNP  DNG KV
Sbjct: 56  AQVGVMVTASHNPPEDNGVKV 76

>TDEL0H00630 Chr8 complement(109274..110623) [1350 bp, 449 aa] {ON}
           Anc_7.508 YJR122W
          Length = 449

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 5/59 (8%)

Query: 493 LVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRD--LTTGYQSDTPDHKP--VLPVD 547
           +VTT   + +  ++ P G+PYP SI EE++  ++R+     G+   T D KP  +LP++
Sbjct: 251 VVTTSDTQNVSKIFNPVGLPYPCSI-EEVDQSFFRESRFEAGFVDSTSDFKPESLLPLE 308

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 15/19 (78%), Positives = 16/19 (84%)

Query: 151 VGVMITASHNPKMDNGYKV 169
           VGVMITASHNP  DNG K+
Sbjct: 58  VGVMITASHNPPQDNGVKI 76

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 16/19 (84%)

Query: 151 VGVMITASHNPKMDNGYKV 169
           VGVMITASHNP  DNG KV
Sbjct: 54  VGVMITASHNPPEDNGVKV 72

>KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 115/295 (38%), Gaps = 38/295 (12%)

Query: 56  GTAGLRSEMQAGFSRMN-TLVIIQATQGLATYIKQQFP---DNLVVVVGHDHRFHSKEFA 111
           GT+GLR +        N T   IQA       I +  P   D   +VVG D R+++    
Sbjct: 19  GTSGLRKKTVIFKDEPNYTENFIQA-------IMESIPEGSDGATLVVGGDGRYYNDVIL 71

Query: 112 RATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMITASHN---PKMDNG 166
              A      G K   +   +  + TP     +     K + G+++TASHN   PK D G
Sbjct: 72  EKIAKIGAANGVKKLVVG-QNGLLSTPAASHIIRSYHEKVTGGIILTASHNPGGPKNDMG 130

Query: 167 YKVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWKFSDV-------LNKALKQGKLMYSR 219
            K   +NG     P   +++D I  N +   +     D+       + +  K G ++   
Sbjct: 131 IKYNLANGG----PAPESVTDKIWENSKKLTSYKIIKDLPTLDTSKIGENQKYGPILIDV 186

Query: 220 EEMLNLYS---KEVSKTLVETNPLKLEIKAKPW-FVYTPMHGVGFNIFSTIVKKTMSLVE 275
            ++   Y    KE+    +    +  + K K W  ++  ++G+       I      L E
Sbjct: 187 IDVTKAYVEFLKEIFDFELIKKFIHTQRKTKNWKLLFDGLNGITGPYGKAIFVDEFELPE 246

Query: 276 GEDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGMRLAEEHDINLLVANDPDADR 330
            E    V +  +P P F  +  P+P    A  +  R+ +E  I    A+D D DR
Sbjct: 247 NE----VLQNYHPQPDFGGL-HPDPNLTYARSLVDRVDKEK-IEFGAASDGDGDR 295

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 17/20 (85%)

Query: 150 SVGVMITASHNPKMDNGYKV 169
           +VGVMITASHNP  DNG K+
Sbjct: 57  TVGVMITASHNPPEDNGVKI 76

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 17/20 (85%)

Query: 150 SVGVMITASHNPKMDNGYKV 169
           +VGVMITASHNP  DNG K+
Sbjct: 57  TVGVMITASHNPPEDNGVKI 76

>NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 112/292 (38%), Gaps = 32/292 (10%)

Query: 56  GTAGLRSEMQAGFSRMNTLVIIQATQGLATYIKQQFPDN---LVVVVGHDHRFHSKEFAR 112
           GT+GLR + +      N       T+     I    P+      +VVG D R+++     
Sbjct: 19  GTSGLRKKTKIFKDTPNY------TENFIQAIMDAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 113 ATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMITASHNP---KMDNGY 167
             A      G K   +      + TP     +     K   G+++TASHNP   K D G 
Sbjct: 73  KIAAIGAANGVKKLVIG-QRGLLSTPAASHIMRTYEEKTQGGIILTASHNPGGIKNDMGI 131

Query: 168 KVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWKFSDV----LNKALKQGKLMYSREEML 223
           K   SNG     P  + I + I   +  +  +  F ++    L K  K G L+    +  
Sbjct: 132 KFNLSNGGPAPEPVTNKIWE-ISKKMTSFKIIKDFPELELETLGKNKKYGPLLVDVIDTT 190

Query: 224 NLYSKEVSKTLVETNPLKLEIK----AKPW-FVYTPMHGVGFNIFSTIVKKTMSLVEGED 278
             Y  E  K + + + +K  +      K W  ++  M+GV       I    + L   E 
Sbjct: 191 KAYV-EFVKQIFDFDLIKKFVHKQRDTKHWKLLFDGMNGVTGPYGKAIFVDELGLPADE- 248

Query: 279 YLCVPEQQNPDPSFPTVGFPNPEEKGALDIGMRLAEEHDINLLVANDPDADR 330
              V +Q +P P F  V  P+P    A  +  R+  E +I    A+D D DR
Sbjct: 249 ---VLQQWHPSPDFGGV-HPDPNLTYAKALVDRVDRE-NIEFGAASDGDGDR 295

>ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 569

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 134/599 (22%), Positives = 237/599 (39%), Gaps = 95/599 (15%)

Query: 56  GTAGLRSEMQAGFSRMN-TLVIIQATQGLATYIKQQFPDNL---VVVVGHDHRFHSKEFA 111
           GT+GLR   +      N T   IQA       I +  P+ +   V++VG D R+++    
Sbjct: 19  GTSGLRKRTKVFAEEPNYTENFIQA-------ILEAIPEGVKDSVLLVGGDGRYYNDVVL 71

Query: 112 RATATAFLLKGFKVHYLNPDHEFVHTPLVPFAV---DKLKASVGVMITASHNPKMDN--- 165
           +  A      G K   +   +  + TP     +    K K + G+++TASHNP   N   
Sbjct: 72  QKIAAIGAANGVK-RLVVGQNGILSTPAASHVIRSYSKAKVTGGIILTASHNPGGPNNDF 130

Query: 166 GYKVYYSNGCQIIPPHDHAISDSI---DMNLEPWANVWKFSDVLNKALKQ---GKLMYSR 219
           G K   +NG     P    +++++      L  +  V  F  V   AL +   G L    
Sbjct: 131 GIKYNLANGG----PAPENVTNAMWEASKRLTSYKIVTDFPHVDLSALGEKQYGSLTVDV 186

Query: 220 EEMLNLYSKEVSKTLVETNPLKLEI----KAKPW-FVYTPMHGVGFNIFSTIVKKTMSLV 274
            +    Y  +  KT+ +   +K  +    + K W  ++  ++GV       I    + L 
Sbjct: 187 IDSTKAYV-DFLKTIFDFPLIKSFVNHQRETKNWKLLFDGLNGVTGPYGRAIFADELGLP 245

Query: 275 EGEDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGMRLAEEHDINLLVANDPDADRFSIA 334
           E E    V +  +P P F  +  P+P    A  +  R+  E +I    A+D D DR  I 
Sbjct: 246 EDE----VLQNCHPKPDFGGL-HPDPNLTYARTLVDRVDRE-NIAFGAASDGDGDRNMI- 298

Query: 335 VKDTQSSKWRQLTGNEIGFLFAFFEFQRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEV 394
                +       G+ +  +        Y ++   FQR     +  S  +SQ I  +A+ 
Sbjct: 299 ---YGAGPAFVSPGDSVAII------AEYASEIPYFQREGIYGLARSFPTSQAIDLVAKH 349

Query: 395 EGFLYEDTLTGFKWIGNRAIILEKEGYYVPFGFEEAIGYMFPAMEHDKDGISAAVV---L 451
                 +  TG+K+    A+   K+   +    EE+ G     +  +KDG+ A +    +
Sbjct: 350 HNLSCYEVPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHI-REKDGLWAIIAWLNI 403

Query: 452 LQAYCKWKIDSNLDPIDILENGFQKYG--VFKEYNGYYVVPSPLVTTEIFEYIRNVYTPT 509
           L  Y K   + ++    I +  + KYG   F  Y+  Y   S      + E+ +N  +  
Sbjct: 404 LAIYHKRNPEKDVSIKTIQDEFWDKYGRTFFTRYD--YENVSGEAANRVIEFFQNFVSQP 461

Query: 510 GVP---YPPSIGEEIEVVYYRDLTTGYQSDTPDHKPVLPVDPTSQMITLSGKPSDGNGNE 566
           GV    +P  + E ++VV   D          ++K +     ++Q + L  K S+G    
Sbjct: 462 GVKGSNFP--LDESLKVVDAGDF---------EYKDLDGSVSSNQGLFL--KLSNG---- 504

Query: 567 HIRFTIRGSGTEPK---LKVYIEACADNEKRASYLAKLTWDVLRRGWFRPEIMNITTDF 622
            +R  +R SGT      +++Y+E  +D+  +    A+         + RP I  + + F
Sbjct: 505 -VRTVLRLSGTGSAGATIRLYVEQYSDDASKYGLTAEE--------FLRPAIQQLVSFF 554

>NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 115/292 (39%), Gaps = 32/292 (10%)

Query: 56  GTAGLRSEMQAGFSRMN-TLVIIQATQGLATYIKQQFPDNL---VVVVGHDHRFHSKEFA 111
           GT+GLR + +    + + T   IQA       I    P+      +VVG D R+++    
Sbjct: 19  GTSGLRKKTRVFKDKPHYTENFIQA-------IMDAIPEGAKGATLVVGGDGRYYNDVIL 71

Query: 112 RATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMITASHNP---KMDNG 166
              A      G K   +   H  + TP     +     K + G+++TASHNP   + D G
Sbjct: 72  HKIAAIGAANGVKKLVVG-QHGLLSTPAASHIMRTYEEKTTGGIILTASHNPGGLENDMG 130

Query: 167 YKVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWKFSDV----LNKALKQGKLMYSREEM 222
            K   SNG     P  + I + I   +  +  +  F ++    L K  K G L+    ++
Sbjct: 131 IKYNLSNGGPAPEPVTNKIWE-ISKKMTHYKIIKDFPELELETLGKNKKYGPLLVDVIDI 189

Query: 223 LNLYS---KEVSKTLVETNPLKLEIKAKPW-FVYTPMHGVGFNIFSTIVKKTMSLVEGED 278
              Y    KE+    +    +  + + K W  ++  M+GV       I      L   E 
Sbjct: 190 TKAYVDFLKEIFDFELIKKFIHNQREKKHWKLLFDGMNGVTGPYGKAIFVDEFGLPADE- 248

Query: 279 YLCVPEQQNPDPSFPTVGFPNPEEKGALDIGMRLAEEHDINLLVANDPDADR 330
              V +Q +P P F  V  P+P    A  +  R+  E  I    A+D D DR
Sbjct: 249 ---VLQQWHPQPDFGGV-HPDPNLTYAKALVDRVNREK-IEFGAASDGDGDR 295

>CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c PGM2 phosphoglucomutase
          Length = 567

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 56/128 (43%), Gaps = 17/128 (13%)

Query: 56  GTAGLRSEMQAGFSRMN-TLVIIQATQGLATYIKQQFPD---NLVVVVGHDHRFHSKEFA 111
           GT+GLR + +      N T   IQA       I    P+   + V+VVG D RF++    
Sbjct: 17  GTSGLRKKTKVFMEEPNYTENFIQA-------IMDAIPEGAKDAVLVVGGDGRFYNDVIM 69

Query: 112 RATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMITASHN---PKMDNG 166
           +  A      G +   +   +  + TP     +     K + G+++TASHN   P+ D G
Sbjct: 70  QKIAAIGAANGVRKLIIG-QNGLLSTPAASHVIRSYAEKCTGGIILTASHNPGGPENDLG 128

Query: 167 YKVYYSNG 174
            K   +NG
Sbjct: 129 IKYNLANG 136

>Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 69/291 (23%), Positives = 111/291 (38%), Gaps = 30/291 (10%)

Query: 56  GTAGLRSEMQAGFSRMNTLVIIQATQGLATYIKQQFPDN---LVVVVGHDHRFHSKEFAR 112
           GT+GLR + +    + N       T+     I +  P+      +VVG D R+++     
Sbjct: 19  GTSGLRKKTKVFKDQPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 113 ATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMITASHN---PKMDNGY 167
             A      G K   +   H  + TP     +     K + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGAANGVKKLVIG-QHGLLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGI 131

Query: 168 KVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWKFSDV----LNKALKQGKLMYSREEML 223
           K   SNG        + I D I   L  +  +  F ++    + K  K G L+    ++ 
Sbjct: 132 KYNLSNGGPAPESVTNVIWD-ISKKLTSYKIIKDFPELDLATIGKNKKYGPLLVDIIDIT 190

Query: 224 NLYS---KEVSKTLVETNPLKLEIKAKPW-FVYTPMHGVGFNIFSTIVKKTMSLVEGEDY 279
             Y    KE+    +    +  +   K W  ++  M+GV       I      L   E  
Sbjct: 191 KDYVDFLKEIFDFKLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPADE-- 248

Query: 280 LCVPEQQNPDPSFPTVGFPNPEEKGALDIGMRLAEEHDINLLVANDPDADR 330
             V +  +P P F  +  P+P    A  +  R+  E  I    A+D D DR
Sbjct: 249 --VLQNWHPSPDFGGM-HPDPNLTYASTLVKRVDREK-IEFGAASDGDGDR 295

>Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C
           (PGM2) - Phosphoglucomutase [contig 55] FULL
          Length = 570

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 6/87 (6%)

Query: 93  DNLVVVVGHDHRFHSKEFARATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KAS 150
           +N  +VVG D R+++ E  +         G +   L   +  + TP     +     K +
Sbjct: 53  ENATLVVGGDGRYYNNEVMQIIGAIAAANGVRKMILG-QNGILSTPAASHIIRSYPEKCT 111

Query: 151 VGVMITASHN---PKMDNGYKVYYSNG 174
            G+++TASHN   P+ D G K   SNG
Sbjct: 112 GGIILTASHNPGGPENDFGIKYNLSNG 138

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 8/51 (15%)

Query: 149 ASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISDSIDMNLEPWANV 199
           A VGVM+TASHNP  DNG K        ++ PH   ++   + +    AN 
Sbjct: 56  AYVGVMLTASHNPPEDNGVK--------LVDPHGEMLAAEWEKHATALANC 98

>YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON}
           PGM2Phosphoglucomutase, catalyzes the conversion from
           glucose-1-phosphate to glucose-6-phosphate, which is a
           key step in hexose metabolism; functions as the acceptor
           for a Glc-phosphotransferase
          Length = 569

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 69/291 (23%), Positives = 111/291 (38%), Gaps = 30/291 (10%)

Query: 56  GTAGLRSEMQAGFSRMNTLVIIQATQGLATYIKQQFPDN---LVVVVGHDHRFHSKEFAR 112
           GT+GLR + +      N       T+     I +  P+      +VVG D R+++     
Sbjct: 19  GTSGLRKKTKVFKDEPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 113 ATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMITASHN---PKMDNGY 167
             A      G K   +   H  + TP     +     K + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGAANGIKKLVIG-QHGLLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGI 131

Query: 168 KVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWKFSDV----LNKALKQGKLMYSREEML 223
           K   SNG        +AI + I   L  +  +  F ++    + K  K G L+    ++ 
Sbjct: 132 KYNLSNGGPAPESVTNAIWE-ISKKLTSYKIIKDFPELDLGTIGKNKKYGPLLVDIIDIT 190

Query: 224 NLYS---KEVSKTLVETNPLKLEIKAKPW-FVYTPMHGVGFNIFSTIVKKTMSLVEGEDY 279
             Y    KE+    +    +  +   K W  ++  M+GV       I      L   E  
Sbjct: 191 KDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPADE-- 248

Query: 280 LCVPEQQNPDPSFPTVGFPNPEEKGALDIGMRLAEEHDINLLVANDPDADR 330
             V +  +P P F  +  P+P    A  +  R+  E  I    A+D D DR
Sbjct: 249 --VLQNWHPSPDFGGM-HPDPNLTYASSLVKRVDREK-IEFGAASDGDGDR 295

>KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 34.7 bits (78), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 58/130 (44%), Gaps = 21/130 (16%)

Query: 56  GTAGLRSEMQAGFSRMNTLVIIQA---TQGLATYIKQQFPD---NLVVVVGHDHRFHSKE 109
           GT+GLR +         T V ++    T+     I +  P+   +  +V+G D RF++  
Sbjct: 20  GTSGLRKK---------TAVFMKEPHYTENFIQAILEAIPEGCKDATLVIGGDGRFYNDV 70

Query: 110 FARATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVD--KLKASVGVMITASHN---PKMD 164
                A      G +   +   +  + TP   + +   K KA+ G+++TASHN   P+ D
Sbjct: 71  VINKIAAISAANGVRKLVIG-QNGLLSTPATSYIIRSYKDKATGGIILTASHNPGGPEND 129

Query: 165 NGYKVYYSNG 174
            G K   +NG
Sbjct: 130 MGIKYNLANG 139

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score = 34.3 bits (77), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 150 SVGVMITASHNPKMDNGYKVYYSNGCQI 177
           +VGVMITASHN   DNG K+   +G  +
Sbjct: 57  AVGVMITASHNQPCDNGVKIVEPDGSML 84

>KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 126/583 (21%), Positives = 222/583 (38%), Gaps = 99/583 (16%)

Query: 56  GTAGLRSEMQAGFSRMNTLVIIQATQGLATYIKQQFPDNL---VVVVGHDHRFHSKEFAR 112
           GT+GLR +  A F+          T+     + +  P+      +VVG D R+++     
Sbjct: 19  GTSGLRKKT-AVFTNEP-----HYTENFIQAVMEAIPEGCKGATLVVGGDGRYYNDVILH 72

Query: 113 ATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVD--KLKASVGVMITASHN---PKMDNGY 167
             A      G +   +   +  + TP     +   K K + G+++TASHN   PK D G 
Sbjct: 73  KIAAIGAANGVRKLVIG-QNGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPKNDMGI 131

Query: 168 KVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWKFS----DVLNKALKQGKLMYSREEML 223
           K   SNG     P  + I + +   L+ +  +        D L + ++ G L+    +  
Sbjct: 132 KYNLSNGGPAPEPVTNKIWE-VSKQLDHYKIIPDLPELALDTLAENVQYGPLLVDVVDTT 190

Query: 224 NLYS---KEVSKTLVETNPLKLEIKAKPW-FVYTPMHGVGFNIFSTIVKKTMSLVEGEDY 279
             Y    KE+    +  + +  +   K W  ++  M+GV       I      L   E  
Sbjct: 191 RDYVEFLKEIFDFPLIKSFIHKQRSQKHWKLLFDGMNGVTGPYGKAIFVDEFELPAEE-- 248

Query: 280 LCVPEQQNPDPSFPTVGFPNPEEKGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQ 339
             V +  +P P F  +  P+P    A  +  R+  E +I    A+D D DR  I      
Sbjct: 249 --VLQNWHPQPDFGGI-HPDPNLTYARSLVDRVDRE-NIEFGAASDGDGDRNMI----YG 300

Query: 340 SSKWRQLTGNEIGFLFAFFEFQRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLY 399
           +       G+ +  +        Y  +   F +     +  S  ++  I ++AE  G   
Sbjct: 301 AGPAFVSPGDSVAII------AEYAAEIPYFAKQGIYGLARSFPTASAIDRVAEKHGLKC 354

Query: 400 EDTLTGFKWIGNRAIILEKEGYYVPFGFEEAIGYMFPAMEHDKDGISAAVV---LLQAYC 456
            +  TG+K+    A+   K+   +    EE+ G     +  +KDG+ A +    LL  Y 
Sbjct: 355 YEVPTGWKFFC--ALFDAKK---LSICGEESFGTGSNHV-REKDGVWAIIAWLNLLAIYN 408

Query: 457 KWKIDSNLDPIDILENGFQKYG--VFKEYNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYP 514
           +   D ++    I E  ++KYG   F  Y+  +V  +     ++ + +R+     GV   
Sbjct: 409 RRHPDRDVSIKIIQEEFWKKYGRVFFTRYDYEHVDSNS--AKKVIDNLRSYTEKPGV--- 463

Query: 515 PSIGEEIEVVYYRDLTTGYQSDTPDHKPVLPVDPTSQMITLSG----KPSDGNGNEH--- 567
             +G +                        P D T+  +T SG    K  DG+ +EH   
Sbjct: 464 --VGSK-----------------------FPTD-TTLTVTESGDFSYKDLDGSVSEHQGL 497

Query: 568 -------IRFTIRGSGTEPK---LKVYIEACADNEKRASYLAK 600
                   RF +R SGT      +++Y+E   D+E +    A+
Sbjct: 498 YVRLSNGARFVVRLSGTGSSGATIRLYLEKYCDDESKYGLTAE 540

>CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c Phosphoglucomutase 2
          Length = 568

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 116/291 (39%), Gaps = 30/291 (10%)

Query: 56  GTAGLRSEMQAGFSRMNTLVIIQATQGLATYIKQQFPDNL---VVVVGHDHRFHSKEFAR 112
           GT+GLR + +    + N +      +     + +  P+     V+VVG D R+++    +
Sbjct: 18  GTSGLRKKTKVFEDQPNYV------ENFIQSVMEAIPEGAKGAVLVVGGDGRYYNDVILQ 71

Query: 113 ATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVD--KLKASVGVMITASHN---PKMDNGY 167
             A      G K   +   +  + TP     +   K K + G+++TASHN   P+ D G 
Sbjct: 72  KIAAIGAANGVKKLVIG-QNGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPENDMGI 130

Query: 168 KVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWKFSDV----LNKALKQGKLMYSREEML 223
           K   SNG     P  + I + I   L  +  V  F ++    L +  K G L+    +  
Sbjct: 131 KYNLSNGGPAPEPVTNKIWE-ISKKLTHYKIVKDFPELDLTKLVENKKYGPLLVDVIDTT 189

Query: 224 NLYS---KEVSKTLVETNPLKLEIKAKPW-FVYTPMHGVGFNIFSTIVKKTMSLVEGEDY 279
           + Y    KE+    +    +  + K K W  +   M+GV       I      L   E  
Sbjct: 190 DAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEFGLDSKE-- 247

Query: 280 LCVPEQQNPDPSFPTVGFPNPEEKGALDIGMRLAEEHDINLLVANDPDADR 330
             V +  +P P F  +  P+P    A  +  R+ +E  I    A+D D DR
Sbjct: 248 --VLQNWHPQPDFGGL-HPDPNLTYAHTLVERVNKEK-IEFGAASDGDGDR 294

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 15/19 (78%)

Query: 151 VGVMITASHNPKMDNGYKV 169
           VG MITASHNP  DNG K+
Sbjct: 58  VGAMITASHNPPQDNGVKL 76

>Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 70/292 (23%), Positives = 114/292 (39%), Gaps = 32/292 (10%)

Query: 56  GTAGLRSEMQAGFSRMNTLVIIQATQGLATYIKQQFPDN---LVVVVGHDHRFHSKEFAR 112
           GT+GLR + +    + N       T+     I +  P+      +VVG D R+++     
Sbjct: 19  GTSGLRKKTKVFKDQPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILN 72

Query: 113 ATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKLK--ASVGVMITASHN---PKMDNGY 167
             A      G K   +   +  + TP     +   +   + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGSANGIKKLVIG-QYGLLSTPAASHIMRTYEEECTGGIILTASHNPGGPENDMGI 131

Query: 168 KVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWKFSDV----LNKALKQGKLMYSREEML 223
           K   SNG        +AI D I   L  +  V  F ++    + K  K G L+    ++ 
Sbjct: 132 KYNLSNGGPAPESVTNAIWD-ISKKLTNYKIVKDFPELDLKTIGKNKKYGPLLIDVIDIT 190

Query: 224 NLYSKEVSKTLVETNPLKLEI----KAKPW-FVYTPMHGVGFNIFSTIVKKTMSLVEGED 278
             Y  +  K + + + +K  I      K W  ++  M+GV       I      L   E 
Sbjct: 191 KAYV-DFLKKIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPAEE- 248

Query: 279 YLCVPEQQNPDPSFPTVGFPNPEEKGALDIGMRLAEEHDINLLVANDPDADR 330
              V +  +P P F  +  P+P    A  +  R+  E  I    A+D D DR
Sbjct: 249 ---VLQNWHPSPDFGGM-HPDPNLTYASSLVKRVDREK-IEFGAASDGDGDR 295

>TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.445
           YKL127W
          Length = 572

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 74/307 (24%), Positives = 117/307 (38%), Gaps = 59/307 (19%)

Query: 56  GTAGLRSEMQAGFSRMNTLVIIQATQGLATYIKQQFPD---NLVVVVGHDHRFHSKEFAR 112
           GT+GLR + +    + +       T+     I    P+   +  +VVG D R+++ +  +
Sbjct: 19  GTSGLRKKTKVFMEKPHY------TENFIQSILDAIPEGSKDATLVVGGDGRYYNDKILQ 72

Query: 113 ATATAFLLKGFKVHYLNPDHEFVHTPLVPFAV----DKL--KASVGVMITASHN---PKM 163
             A+     G     +   H  + TP     +    DK   K + G+++TASHN   P  
Sbjct: 73  IIASISAANGVGKLVIG-QHGLLSTPAASHIIRTYQDKSGKKVTGGIILTASHNPGGPDN 131

Query: 164 DNGYKVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWKFSDVLN-----KALKQGKLMYS 218
           D G K   SNG     P   +++++I          W+ S  L      K L Q  L   
Sbjct: 132 DIGIKYNLSNGG----PAPESVTNAI----------WEISKKLTSYKIIKNLPQLDLSTK 177

Query: 219 REEML-NLYSKEVSKTLVETNPLK-------------LEIKAKPW-FVYTPMHGVGFNIF 263
            E+ L NL    V  T      LK              +   K W  ++  ++GV     
Sbjct: 178 GEKKLGNLEIDVVDVTQAYVEFLKEIFDFDLIKKFVDTQRSTKHWKLLFDGLNGVTGPYG 237

Query: 264 STIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGMRLAEEHDINLLVA 323
             I    + L E E    V +  +P P F  +  P+P    A  +  R+ +E  I    A
Sbjct: 238 KAIFVDELGLPENE----VLQNCHPKPDFGGI-HPDPNLTYARTLVERVDKEK-IEFGAA 291

Query: 324 NDPDADR 330
           +D D DR
Sbjct: 292 SDGDGDR 298

>ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL127W (PGM1) and
           YMR105C (PGM2)
          Length = 568

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 57/128 (44%), Gaps = 15/128 (11%)

Query: 56  GTAGLRSEMQAGFSRMNTLVIIQATQGLATYIKQQFPD---NLVVVVGHDHRFHSKEFAR 112
           GT+GLR + +  F +         T+     I +  P+   N V+V+G D R+++    +
Sbjct: 19  GTSGLRKKTKV-FEQTE-----HYTENFIQAIMESIPEGSENAVLVIGGDGRYYNDAVMQ 72

Query: 113 ATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMITASHNPKM-DNGYKV 169
             A      G +   +   +  + TP     +     K + G+++TASHNP   DN + +
Sbjct: 73  KIAEVGSANGVRKLIIG-QNGLLSTPAASHIIRTYHDKVTGGIILTASHNPGGPDNDFGI 131

Query: 170 YY--SNGC 175
            Y  +NG 
Sbjct: 132 KYNLANGA 139

>TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 119/295 (40%), Gaps = 38/295 (12%)

Query: 56  GTAGLRSEMQAGFSRMNTLVIIQATQGLATYIKQQFPD---NLVVVVGHDHRFHSKEFAR 112
           GT+GLR + +   +  N       T+     I    P+   N  +VVG D RF++    +
Sbjct: 19  GTSGLRKKSKVFMNEPNY------TENFIQAILDAIPEGSENSTLVVGGDGRFYNDVILQ 72

Query: 113 ATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKLKASV--GVMITASHN---PKMDNGY 167
             A      G +   +      + TP     +      V  G+++TASHN   P+ D G 
Sbjct: 73  LIAEIGAANGVRKLIIG-QAGILSTPAASHIIRTYHEEVTGGIILTASHNPGGPENDIGI 131

Query: 168 KVYYSNGCQIIPPHDHAISDSI---DMNLEPWANVWKFSDV----LNKALKQGKLMY--- 217
           K   +NG     P   +++++I     NL  +  +  F  +    +++ +K G L+    
Sbjct: 132 KYNLANGG----PAPESVTNAIWEASKNLTTYKTMKDFPKIDINTISENVKYGPLLIDII 187

Query: 218 -SREEMLNLYSKEVSKTLVETNPLKLEIKAKPW-FVYTPMHGVGFNIFSTIVKKTMSLVE 275
            S E+ +  + KE+    +    ++ + K   W  ++  ++GV       I      L  
Sbjct: 188 DSTEDYVK-FLKEIFDFPLIKKFIETQRKTNNWKLLFDSLNGVTGPYGKAIFVDEFGLPA 246

Query: 276 GEDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGMRLAEEHDINLLVANDPDADR 330
            E    V +  +P P F  +  P+P    A  +  R+ +E  I    A+D D DR
Sbjct: 247 DE----VLQNWHPQPDFGGL-HPDPNLTYARTLVDRVDKEK-IEFGAASDGDGDR 295

>Kpol_543.59 s543 complement(139666..140352) [687 bp, 228 aa] {ON}
           complement(139666..140352) [687 nt, 229 aa]
          Length = 228

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 39/83 (46%), Gaps = 18/83 (21%)

Query: 441 DKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQ---------------KYGVFKEYNG 485
           D  G   ++ L++++ K ++D+ +DP  I+  GF                K G F   +G
Sbjct: 86  DSTGFLKSLKLVESFVKQEVDAGMDPSQIIVGGFSQGAALSLASSVTLPYKIGGFVSLSG 145

Query: 486 YYVVPSPLVTTEIFEYIRNVYTP 508
           + ++PS L+     +  +N+ TP
Sbjct: 146 FCIIPSILLN---MKNDKNLSTP 165

>TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {ON}
           Anc_2.445 YKL127W
          Length = 571

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 113/292 (38%), Gaps = 31/292 (10%)

Query: 56  GTAGLRSEMQAGFSRMNTLVIIQATQGLATYIKQQFPDNL---VVVVGHDHRFHSKEFAR 112
           GT+GLR +  A F +         T+     I +  P+      +VVG D R+++     
Sbjct: 20  GTSGLRKKT-AIFEKEPNY-----TENFIQAIMEAIPEGCKGATLVVGGDGRYYNDAILH 73

Query: 113 ATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL---KASVGVMITASHN---PKMDNG 166
             A      G K   +   +  + TP     +      + + G+++TASHN   PK D G
Sbjct: 74  NIAAIGAANGVK-KLIVGQNGLLSTPAASHIIRTYAPGEITGGIILTASHNPGGPKNDMG 132

Query: 167 YKVYYSNGCQIIPPHDHAISDSIDMNLEPWANVWKFSDV----LNKALKQGKLMYSREEM 222
            K    NG     P   AI ++    L+ +  +  F ++    L K  + G L+    + 
Sbjct: 133 IKYNIQNGAPAPEPVTEAIWEA-SKKLQNYKIIKDFPELELKTLGKNKQYGPLLVDVIDT 191

Query: 223 LNLYS---KEVSKTLVETNPLKLEIKAKPW-FVYTPMHGVGFNIFSTIVKKTMSLVEGED 278
              Y    KE+    +    +  + K K W  ++  M+GV       I    + L   E 
Sbjct: 192 CEAYVQFIKEIFDFPLIKKFVDTQRKTKNWKLLFDGMNGVTGPYGKAIFVDELGLPADE- 250

Query: 279 YLCVPEQQNPDPSFPTVGFPNPEEKGALDIGMRLAEEHDINLLVANDPDADR 330
              V +  +P P F     P+P    A  +  R+ +E  I    A+D D DR
Sbjct: 251 ---VLKDWHPSPDFGG-HHPDPNLTYAKSLVDRVDKEK-IEFGAASDGDGDR 297

>SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate which is a key step in hexose
           metabolism functions as the acceptor for a
           Glc-phosphotransferase and to YKL127W uniprot|P33401
           Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 571

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 54/127 (42%), Gaps = 14/127 (11%)

Query: 56  GTAGLRSEMQAGFSRMN-TLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARAT 114
           GT+GLR + +      N T   IQA         Q    +  +VVG D RF++    +  
Sbjct: 19  GTSGLRKKTKVFMEEPNYTENFIQAVMDAIPEGSQ----DATLVVGGDGRFYNDVVVQKI 74

Query: 115 ATAFLLKGFKVHYLN-PDHEFVHTPLVPFAVDK---LKASVGVMITASHNP---KMDNGY 167
           A      G  VH L    +  + TP     +      K + G+++TASHNP   K D G 
Sbjct: 75  AAIGAANG--VHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTASHNPGGAKNDFGI 132

Query: 168 KVYYSNG 174
           K   SNG
Sbjct: 133 KYNLSNG 139

>Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127W
           (REAL)
          Length = 570

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 52/127 (40%), Gaps = 14/127 (11%)

Query: 56  GTAGLRSEMQAGFSRMN-TLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARAT 114
           GT+GLR + +     ++ T   IQAT           P  + +VVG D RF++       
Sbjct: 19  GTSGLRKKTRVFMDELHYTENFIQAT----IESIPNGPGGVTLVVGGDGRFYNDVIMNKI 74

Query: 115 ATAFLLKGFKVHYLNPDHEFVHTPLVPFAV----DKLKASVGVMITASHN---PKMDNGY 167
           A      G +   +      + TP     +    DK     G+++TASHN   P+ D G 
Sbjct: 75  AAVGAANGVRKLVIG-QGGLLSTPAASHVIRTYEDKCSGG-GIILTASHNPGGPENDLGI 132

Query: 168 KVYYSNG 174
           K    NG
Sbjct: 133 KYNLPNG 139

>Skud_8.93 Chr8 (158933..160699) [1767 bp, 588 aa] {ON} YHR035W
           (REAL)
          Length = 588

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 46/109 (42%), Gaps = 6/109 (5%)

Query: 425 FGFEEAIGYMFPAMEHDKDGI-SAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVFKEY 483
           FG E  I Y F     D+ G+   A ++  +    + DS  D  D  +  FQKY   +  
Sbjct: 239 FGRENLI-YEFFISSLDQIGVLEMAPLISSSIAVSQFDSFND--DRFDKSFQKYLSLRNQ 295

Query: 484 NGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTG 532
           N  Y   S L+TT     I  V  PT +  P  I   +++  +R  T+ 
Sbjct: 296 NAIYNCQSKLITTRNTSIINGV--PTNILNPKHISLPVKIPLHRSSTSN 342

>Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON}
           (412372..414081) [1710 nt, 570 aa]
          Length = 569

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 54/128 (42%), Gaps = 17/128 (13%)

Query: 56  GTAGLRSEMQAGFSRMN-TLVIIQATQGLATYIKQQFPDNL---VVVVGHDHRFHSKEFA 111
           GT+GLR + +      N T   IQAT           P+      +VVG D R+++    
Sbjct: 19  GTSGLRKKTKVFAEEPNYTENFIQATM-------DAIPEGCKGATLVVGGDGRYYNDVIM 71

Query: 112 RATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVD--KLKASVGVMITASHN---PKMDNG 166
               +     G +   +   +  + TP     +   K K + G+++TASHN   PK D G
Sbjct: 72  NKIVSIAGANGVRKLIIG-HNGILSTPAASHVIRSYKEKCTGGIILTASHNPGGPKNDIG 130

Query: 167 YKVYYSNG 174
            K   +NG
Sbjct: 131 IKYNLANG 138

>Ecym_2475 Chr2 complement(927999..929702) [1704 bp, 567 aa] {ON}
           similar to Ashbya gossypii ABL029W
          Length = 567

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 16/128 (12%)

Query: 56  GTAGLRSEMQAGFSRMNTLVIIQATQGLATYIKQQFPD---NLVVVVGHDHRFHSKEFAR 112
           GT+GLR + +       T   IQA       I +  P+   + ++VVG D R+++    +
Sbjct: 19  GTSGLRKKTKVFQQEHYTENFIQA-------ILEAIPEGCQDAILVVGGDGRYYNDVVMQ 71

Query: 113 ATATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMITASHN---PKMDNGY 167
             A      G K   +   +  + TP     +     K + G+++TASHN   P  D G 
Sbjct: 72  KIAEVGSANGVKKLIIG-QNGLMSTPAASHLIRTYAEKVTGGIILTASHNPGGPDNDLGI 130

Query: 168 KVYYSNGC 175
           K   +NG 
Sbjct: 131 KYNLANGA 138

>Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C
           (REAL)
          Length = 570

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 58/141 (41%), Gaps = 16/141 (11%)

Query: 56  GTAGLRSEMQAGFSRMN-TLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARAT 114
           GT+GLR + +   +  + T   IQA          + P    +VVG D RF++       
Sbjct: 19  GTSGLRKKTKVFMNEPHYTENFIQAMMECI----PEGPSGATLVVGGDGRFYNDVIMNKI 74

Query: 115 ATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKLKASV---GVMITASHN---PKMDNGYK 168
           A      G K   +      + TP     +   + +    G+++TASHN   P+ D G K
Sbjct: 75  AAVGAANGIKKLVIG-QAGLLSTPAASHIIRTYEDNCNGGGIILTASHNPGGPENDLGIK 133

Query: 169 VYYSNGCQIIPPHDHAISDSI 189
               NG     P   +++D+I
Sbjct: 134 YNLPNGG----PAPESVTDAI 150

>NCAS0C03970 Chr3 complement(801433..803295) [1863 bp, 620 aa] {ON}
           Anc_8.64 YFL013C
          Length = 620

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 14/65 (21%)

Query: 311 RLAEEHDINLLVANDPDADRFSI-----AVKDTQ---------SSKWRQLTGNEIGFLFA 356
           ++A+++ +NL +AN  D DR +I     +VK TQ         S K+ +L  +++G L  
Sbjct: 495 KIAKQNVLNLKIANMVDVDRNTIVLDNGSVKKTQEELSHDLRESHKYVKLKRDDVGLLKI 554

Query: 357 FFEFQ 361
           F+E++
Sbjct: 555 FYEYE 559

>Smik_4.752 Chr4 complement(1328812..1331445) [2634 bp, 877 aa] {ON}
           YDR475C (REAL)
          Length = 877

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 22/42 (52%)

Query: 126 HYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGY 167
           H L   HEF + P + F  ++ K S G   T   NP +++G+
Sbjct: 209 HRLEQKHEFFNYPTILFPPNRKKWSTGAASTIKFNPPLEDGF 250

>NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 54/125 (43%), Gaps = 11/125 (8%)

Query: 56  GTAGLRSEMQAGFSRMN-TLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARAT 114
           GT+GLR +     +  N T   IQA   +   I +   D   +VVG D RF++       
Sbjct: 19  GTSGLRKKTAIFMNEPNYTENFIQA---MLDAIPEGSQD-ATLVVGGDGRFYNDVIMNKI 74

Query: 115 ATAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKLKASV--GVMITASHN---PKMDNGYKV 169
           A      G K   +   +  + TP     +   +  V  G+++TASHN   P+ D G K 
Sbjct: 75  AAISAANGVKKLIIG-QNGLLSTPAASHIIRSYEEKVTGGIILTASHNPGGPENDLGIKY 133

Query: 170 YYSNG 174
             +NG
Sbjct: 134 NLANG 138

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,845,197
Number of extensions: 3262732
Number of successful extensions: 7667
Number of sequences better than 10.0: 76
Number of HSP's gapped: 7756
Number of HSP's successfully gapped: 76
Length of query: 622
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 506
Effective length of database: 40,180,143
Effective search space: 20331152358
Effective search space used: 20331152358
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)