Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_13.4658.839ON73273233340.0
Skud_13.4498.839ON73473530710.0
YMR277W (FCP1)8.839ON73273230680.0
Smik_13.4908.839ON73273330640.0
NCAS0C004208.839ON72565521450.0
TDEL0B005808.839ON71364521310.0
KAFR0B039108.839ON72465421220.0
CAGL0M02959g8.839ON75860721140.0
ZYRO0G14168g8.839ON76465121020.0
Kpol_1068.98.839ON74565719520.0
NDAI0K004208.839ON77858919480.0
TBLA0D032608.839ON76868019330.0
TPHA0I002408.839ON73266018940.0
KNAG0J002808.839ON74266818680.0
SAKL0D01496g8.839ON68865018370.0
Kwal_27.102638.839ON74365117970.0
KLTH0C03894g8.839ON74561417910.0
Ecym_46108.839ON75162017790.0
ABL127W8.839ON72861517600.0
KLLA0D01595g8.839ON71960816800.0
TPHA0E030705.202ON4941591020.001
NCAS0A068005.202ON4731311010.001
KAFR0E021405.94ON95190990.004
NDAI0D018605.202ON514140970.005
SAKL0G12870g5.202ON399132960.006
Kpol_1010.615.94ON93287960.008
TPHA0H010705.94ON1015106950.010
Ecym_20665.94ON880112950.011
Smik_12.825.202ON39245930.012
NDAI0C032305.94ON103496940.014
Kpol_1050.635.94ON105870940.015
YLR019W (PSR2)5.202ON39745920.018
Kpol_478.165.202ON35094910.021
ZYRO0B10428g5.202ON482112890.043
TBLA0C060905.202ON484127880.052
Suva_10.655.202ON415115880.058
Skud_12.875.202ON39245880.060
SAKL0G15620g5.94ON879109880.075
Skud_12.575.202ON415123860.10
Smik_12.535.202ON414112850.11
Ecym_50527.46ON873102860.12
Suva_10.995.202ON38542840.18
NDAI0I021705.202ON39145830.20
TPHA0N006705.202ON45241830.21
CAGL0D03234g5.202ON410112830.23
NCAS0D027405.202ON398118820.26
TDEL0E042705.202ON453112820.30
Kpol_2002.1005.202ON477127820.31
YLL010C (PSR1)5.202ON42740810.35
Suva_16.2498.527ON480127810.36
KAFR0J009905.202ON483113810.42
AAL158W5.202ON47840800.47
TBLA0I014602.530ON393112790.57
Smik_16.1728.527ON477100790.69
Smik_8.2385.94ON107572790.76
KNAG0E005705.94ON981102790.76
CAGL0D05610g5.202ON44745780.91
ADR369C7.46ON82797780.94
Ecym_72764.156ON59353780.98
ADL145C5.94ON875109781.0
KAFR0A065604.156ON55555771.1
KLLA0F15620g5.202ON414149771.1
Kwal_33.151405.202ON410132771.2
Ecym_71045.202ON49240771.3
KNAG0M017405.202ON48140771.4
KLLA0E23101g8.527ON480106761.4
SAKL0H20592g4.156ON50877761.5
KNAG0H032008.269ON56169761.5
YPL063W (TIM50)8.527ON476125761.6
Smik_12.3356.48ON678119761.8
Skud_12.3406.48ON68095761.8
NCAS0D015105.94ON90090762.1
NCAS0J008804.156ON56661752.3
SAKL0B06864g3.321ON141549752.4
CAGL0I01958g5.94ON1099161752.5
KLTH0C01584g5.94ON913113752.5
CAGL0H05159g8.527ON485127734.0
Skud_16.2188.527ON480106724.2
KLLA0E15621g5.94ON89167734.3
NDAI0I023706.48ON76095724.9
Suva_8.4007.46ON985123716.4
YHR154W (RTT107)5.94ON107072716.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_13.465
         (732 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...  1288   0.0  
Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...  1187   0.0  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...  1186   0.0  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...  1184   0.0  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...   830   0.0  
TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {O...   825   0.0  
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...   822   0.0  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...   818   0.0  
ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} simi...   814   0.0  
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...   756   0.0  
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...   754   0.0  
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...   749   0.0  
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...   734   0.0  
KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON...   724   0.0  
SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {...   712   0.0  
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...   696   0.0  
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...   694   0.0  
Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...   689   0.0  
ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...   682   0.0  
KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {...   651   0.0  
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    44   0.001
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    44   0.001
KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.9...    43   0.004
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     42   0.005
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    42   0.006
Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932...    42   0.008
TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5....    41   0.010
Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}...    41   0.011
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    40   0.012
NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5....    41   0.014
Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON} (138...    41   0.015
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    40   0.018
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    40   0.021
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    39   0.043
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    39   0.052
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    39   0.058
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    39   0.060
SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some...    39   0.075
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    38   0.10 
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    37   0.11 
Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar t...    38   0.12 
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    37   0.18 
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     37   0.20 
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    37   0.21 
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    37   0.23 
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    36   0.26 
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    36   0.30 
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    36   0.31 
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    36   0.35 
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    36   0.36 
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    36   0.42 
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    35   0.47 
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...    35   0.57 
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    35   0.69 
Smik_8.238 Chr8 (379729..382956) [3228 bp, 1075 aa] {ON} YHR154W...    35   0.76 
KNAG0E00570 Chr5 (95945..98890) [2946 bp, 981 aa] {ON} Anc_5.94 ...    35   0.76 
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    35   0.91 
ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}...    35   0.94 
Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}...    35   0.98 
ADL145C Chr4 complement(435983..438610) [2628 bp, 875 aa] {ON} S...    35   1.0  
KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa] ...    34   1.1  
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    34   1.1  
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    34   1.2  
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    34   1.3  
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    34   1.4  
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    34   1.4  
SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]...    34   1.5  
KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.2...    34   1.5  
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    34   1.6  
Smik_12.335 Chr12 (603893..605929) [2037 bp, 678 aa] {ON} YLR260...    34   1.8  
Skud_12.340 Chr12 (606790..608832) [2043 bp, 680 aa] {ON} YLR260...    34   1.8  
NCAS0D01510 Chr4 complement(282977..285679) [2703 bp, 900 aa] {O...    34   2.1  
NCAS0J00880 Chr10 complement(146472..148172) [1701 bp, 566 aa] {...    33   2.3  
SAKL0B06864g Chr2 (591422..595669) [4248 bp, 1415 aa] {ON} simil...    33   2.4  
CAGL0I01958g Chr9 (162266..165565) [3300 bp, 1099 aa] {ON} weakl...    33   2.5  
KLTH0C01584g Chr3 complement(139563..142304) [2742 bp, 913 aa] {...    33   2.5  
CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {...    33   4.0  
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    32   4.2  
KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]...    33   4.3  
NDAI0I02370 Chr9 (540379..542661) [2283 bp, 760 aa] {ON} Anc_6.4...    32   4.9  
Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W ...    32   6.4  
YHR154W Chr8 (402966..406178) [3213 bp, 1070 aa] {ON}  RTT107Pro...    32   6.7  

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score = 1288 bits (3334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/732 (87%), Positives = 637/732 (87%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERXXXXXXXXXXXXXXX 60
           MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVER               
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERPSDAGDDDNDHDSSP 60

Query: 61  XXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120
                      TKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV
Sbjct: 61  GGGGGGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120

Query: 121 YGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGRALKEHLRRDKKLILVVDL 180
           YGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGRALKEHLRRDKKLILVVDL
Sbjct: 121 YGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGRALKEHLRRDKKLILVVDL 180

Query: 181 DQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPPPVR 240
           DQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPPPVR
Sbjct: 181 DQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPPPVR 240

Query: 241 KCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDEN 300
           KCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDEN
Sbjct: 241 KCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDEN 300

Query: 301 GSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQST 360
           GSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQST
Sbjct: 301 GSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQST 360

Query: 361 GMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEEPSANES 420
           GMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEEPSANES
Sbjct: 361 GMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEEPSANES 420

Query: 421 KEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXVDDDDELHYLMSTLLNIHKTYYQM 480
           KEELTKKLEYSASLEVQQQNRP              VDDDDELHYLMSTLLNIHKTYYQM
Sbjct: 421 KEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELHYLMSTLLNIHKTYYQM 480

Query: 481 LSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDI 540
           LSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDI
Sbjct: 481 LSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDI 540

Query: 541 NYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDSPISD 600
           NYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDSPISD
Sbjct: 541 NYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDSPISD 600

Query: 601 DELQSFXXXXXXXXEYLDEHHEQQHMLMPQENINLFAAGTSWLXXXXXXXXXXXXXXXXX 660
           DELQSF        EYLDEHHEQQHMLMPQENINLFAAGTSWL                 
Sbjct: 601 DELQSFQKQLQKKQEYLDEHHEQQHMLMPQENINLFAAGTSWLNDDDDEDIPDTASDDDD 660

Query: 661 XXXXXXXXXXXXXXXXXXRKRSIEDGQDEAPQKKTKAEHSQEDGPAQHXXXXXXXXXXXX 720
                             RKRSIEDGQDEAPQKKTKAEHSQEDGPAQH            
Sbjct: 661 DNDDNSESDDERDSGDIDRKRSIEDGQDEAPQKKTKAEHSQEDGPAQHEEEGENNEDSDS 720

Query: 721 QLEEELMGMLDG 732
           QLEEELMGMLDG
Sbjct: 721 QLEEELMGMLDG 732

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score = 1187 bits (3071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/735 (80%), Positives = 614/735 (83%), Gaps = 4/735 (0%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERXXXXXXXXXXXXXXX 60
           MTTQIRSPEGLPYPIQIDKL+PSVGS+L EGDRL+VYKFWYLVER               
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60

Query: 61  XXXXXXXXXXX--TKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 118
                        TKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD
Sbjct: 61  PGGGAGSGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120

Query: 119 IVYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGRALKEHLRRDKKLILVV 178
           IVYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIR+G ALKEHLRRDKKLILVV
Sbjct: 121 IVYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRSGEALKEHLRRDKKLILVV 180

Query: 179 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPPP 238
           DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYM EDGSV KPPP
Sbjct: 181 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLKPPP 240

Query: 239 VRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRD 298
           VRKCWYYVKVRPGLKEFF KVAPLFEMHIYTMATRAYA+QIAKIVDPTGELFGDRILSRD
Sbjct: 241 VRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRILSRD 300

Query: 299 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 358
           ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ
Sbjct: 301 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 360

Query: 359 STGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEEPSAN 418
           STGMLQLGRKTRQKSQESQEL+TDIMDNEKKLQEKID EVKRQEE+LNHQLATAEEPSAN
Sbjct: 361 STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPSAN 420

Query: 419 ESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXVDDDDELHYLMSTLLNIHKTYY 478
           ESKEELTKKLEYSASLEVQQQNRP              VDDDDEL+YLM TL NIH TYY
Sbjct: 421 ESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHNTYY 480

Query: 479 QMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTS 538
           QM+SQ  E EPNLMEIIPSLKQKVFQNC+FVFSGLIPLGTDIQRSDIVIWTSTFGATSTS
Sbjct: 481 QMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATSTS 540

Query: 539 DINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDSPI 598
           DI+YLTTHLITKNP TYKARLAKKFNPEIK++HPDWIFECLVNWKKVDEKPYTLIVDSPI
Sbjct: 541 DIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIVDSPI 600

Query: 599 SDDELQSFXXXXXXXXEYLDEHHEQQHMLMPQENINLFAAGTSWLXXXXXXXXXXXXXXX 658
           SD+ELQ+F        EYL+E+ +QQHML PQEN+NLFAAGTSWL               
Sbjct: 601 SDEELQNFQKQLQKRQEYLEENQQQQHMLTPQENLNLFAAGTSWLNNDDDEDIPDTASDE 660

Query: 659 XXXXXXXXXXXXXXXXXXXXRKRSIEDGQDEAPQKKTKAEHSQEDGPAQHXXXXXXXXX- 717
                               RKRSIED  ++A QKKTKAE  Q DGP QH          
Sbjct: 661 DEDDDHNDESNNENNPTGIDRKRSIEDNHNDASQKKTKAEPPQ-DGPVQHNEEEEENNED 719

Query: 718 XXXQLEEELMGMLDG 732
              QLEEELM MLDG
Sbjct: 720 SDSQLEEELMDMLDG 734

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score = 1186 bits (3068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/732 (80%), Positives = 611/732 (83%), Gaps = 2/732 (0%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERXXXXXXXXXXXXXXX 60
           MTTQIRSP+GLPYPIQIDKLIPSVGS+L EGDRLLVYKFWYLVER               
Sbjct: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60

Query: 61  XXXXXXXXXXX-TKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDI 119
                       TKQLRESIEFFESPYEGDLISWNVDVGDE+ATANQVICEIKRPCNHDI
Sbjct: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 120 VYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGRALKEHLRRDKKLILVVD 179
           VYGGLCTQCGKEVSADAFDGVPLDVVGD+DLQISETEAIRTG+ALKEHLRRDKKLILVVD
Sbjct: 121 VYGGLCTQCGKEVSADAFDGVPLDVVGDVDLQISETEAIRTGKALKEHLRRDKKLILVVD 180

Query: 180 LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPPPV 239
           LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYM +DGS+ +PPPV
Sbjct: 181 LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRPPPV 240

Query: 240 RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDE 299
           RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDE
Sbjct: 241 RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDE 300

Query: 300 NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS 359
           NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS
Sbjct: 301 NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS 360

Query: 360 TGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEEPSANE 419
           TGMLQLGRKTRQKSQESQEL+TDIMDNEKKLQEKID EVKRQEE+LNHQLATAEEP ANE
Sbjct: 361 TGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPANE 420

Query: 420 SKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXVDDDDELHYLMSTLLNIHKTYYQ 479
           SKEELTKKLEYSASLEVQQQNRP              VDDDDEL+YLM TL NIHKTYY 
Sbjct: 421 SKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHKTYYD 480

Query: 480 MLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSD 539
           MLSQ  E EPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATST D
Sbjct: 481 MLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTPD 540

Query: 540 INYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDSPIS 599
           I+YLTTHLITKNP TYKARLAKKFNP+IK+VHPDWIFECLVNWKKVDEKPYTLIVDSPIS
Sbjct: 541 IDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPIS 600

Query: 600 DDELQSFXXXXXXXXEYLDEHHEQQHMLMPQENINLFAAGTSWLXXXXXXXXXXXXXXXX 659
           D+ELQ+F        EYL+E  EQQHML  QEN+NLFAAGTSWL                
Sbjct: 601 DEELQNFQTQLQKRQEYLEETQEQQHMLTSQENLNLFAAGTSWLNNDDDEDIPDTASDDD 660

Query: 660 XXXXXXXXXXXXXXXXXXXRKRSIEDGQDEAPQKKTKAEHSQEDGPAQHXXXXXXXXXXX 719
                              RKRSIED  D+  QKKTKAE SQ DGP QH           
Sbjct: 661 EDDDHDDESDDENNSEGIDRKRSIEDNHDDTSQKKTKAEPSQ-DGPVQHKGEGDDNEDSD 719

Query: 720 XQLEEELMGMLD 731
            QLEEELM MLD
Sbjct: 720 SQLEEELMDMLD 731

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score = 1184 bits (3064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/733 (80%), Positives = 611/733 (83%), Gaps = 2/733 (0%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERXXXXXXXXXXXXXXX 60
           MTTQIRSPEGLPYPIQIDKLIPSVGS+L EGDRLLVYKFWYLVER               
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60

Query: 61  XXXXXXXXXXX-TKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDI 119
                       TKQLRESIEFFESPYEGDLISWNVDVGDE+ATANQVICEIKRPCNHDI
Sbjct: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 120 VYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGRALKEHLRRDKKLILVVD 179
           VYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTG+ALKEHLRRDKKLILVVD
Sbjct: 121 VYGGLCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGKALKEHLRRDKKLILVVD 180

Query: 180 LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPPPV 239
           LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYM EDGSV +PPPV
Sbjct: 181 LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLRPPPV 240

Query: 240 RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDE 299
           RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTG+LFGDRILSRDE
Sbjct: 241 RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRILSRDE 300

Query: 300 NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS 359
           NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS
Sbjct: 301 NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS 360

Query: 360 TGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEEPSANE 419
           TGMLQLGRKTRQKSQESQEL+TDIMDNEKKLQEKID EVKRQEE+LNHQLATAEEP ANE
Sbjct: 361 TGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPANE 420

Query: 420 SKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXVDDDDELHYLMSTLLNIHKTYYQ 479
           SKEELTKKLEYSASLEVQQQNRP              VDDDDEL+YLM TL NIH TYYQ
Sbjct: 421 SKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHMTYYQ 480

Query: 480 MLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSD 539
           MLSQ  E EPNLMEIIPSLKQKVFQNC+FVFSGLIPLGTDIQRSDIVIWTSTFGATSTSD
Sbjct: 481 MLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSD 540

Query: 540 INYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDSPIS 599
           I++LTTHLITKNP TYKARLAKKFNPEIK+VHPDWIFECLVNWKKVDEKPYTLIVDSPIS
Sbjct: 541 IDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPIS 600

Query: 600 DDELQSFXXXXXXXXEYLDEHHEQQHMLMPQENINLFAAGTSWLXXXXXXXXXXXXXXXX 659
           D+ELQ+F        EYL+E+ EQQHML  QEN+NLFA GTSWL                
Sbjct: 601 DEELQNFQSQLQKRQEYLEENQEQQHMLTSQENLNLFATGTSWLNNDDDDDIPDTASDDD 660

Query: 660 XXXXXXXXXXXXXXXXXXXRKRSIEDGQDEAPQKKTKAEHSQEDGPAQHXXXXXXXXXXX 719
                              RKRSIED  ++  QKKTKAE  Q DGP Q            
Sbjct: 661 EDDEHNDESDEENHPEGIDRKRSIEDNHEDTSQKKTKAEPLQ-DGPVQQKREGDDNEDSD 719

Query: 720 XQLEEELMGMLDG 732
            QLEEELM MLDG
Sbjct: 720 SQLEEELMDMLDG 732

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/655 (62%), Positives = 494/655 (75%), Gaps = 32/655 (4%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERXXXXXXXXXXXXXXX 60
           M+TQI +P GLPYPI ID+LI  VG  +Q+GDRLL YKFW++V+                
Sbjct: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVD----------VASSPD 50

Query: 61  XXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120
                       K +RESIEFFESPY+G LISWNVD+GDEIA+ NQV+ EI RPCNHD+V
Sbjct: 51  DNDVSSPPTAGKKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVV 110

Query: 121 YGGLCTQCGKEVSADAFD----GVPLDVV-GDMDLQISETEAIRTGRALKEHLRRDKKLI 175
           YGGLCT CG+EV  D  D    G  L +   D +L+IS  EA+  G  ++  LR++KKL+
Sbjct: 111 YGGLCTLCGEEVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLV 170

Query: 176 LVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPK 235
           LVVDLDQT+IHCGVDPTI EWKNDP NPNFETL+DVK F+L+EE +LP +YM      PK
Sbjct: 171 LVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMG-----PK 225

Query: 236 PPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRIL 295
           PP +RKCWYYVKVRPGLKEF  K+APLFEMHIYTMATRAYA +IAKI+DP G+LFGDRIL
Sbjct: 226 PP-LRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRIL 284

Query: 296 SRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFL 355
           SRDENGS+TTKSL +LFPTDQSMV+VIDDRGDVWNW PNLIKVVPYNFFVGVGDINSNFL
Sbjct: 285 SRDENGSMTTKSLERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFL 344

Query: 356 PKQSTGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEEP 415
           PKQ   MLQLGR++R+KS+++++L+ DIMD+EKKL+EKID EVKRQEE+L+HQ AT EEP
Sbjct: 345 PKQQATMLQLGRRSREKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEP 404

Query: 416 --SANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXVDDDDELHYLMSTLLNI 473
             SA E+KEE++KK+EYSASLEVQQQNRP              +DDDDEL++L  TL+ I
Sbjct: 405 PTSAGENKEEISKKIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRI 464

Query: 474 HKTYYQMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFG 533
           H  YY +L + GE++ ++  I+P++KQ V  NC FVFSGLIPLGTDIQR+DIVIWT+TFG
Sbjct: 465 HDKYYNVLKKDGELKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFG 524

Query: 534 ATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLI 593
           A STSDI+  TTH+ITK PGTYKARLAK FNP+IK++HPDW+FECL +WK VDEKPY LI
Sbjct: 525 AISTSDIDEKTTHVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELI 584

Query: 594 VDSPISDDELQSFXXXXXXXXEYLDEHHEQQHMLMPQENIN-----LFAAGTSWL 643
           V+ P+S+ EL+ F        + L   +E    L P    N     LF+ G SWL
Sbjct: 585 VEQPVSETELEEF-KKKLAKRQLLATANEN---LSPANGTNSAELELFSGGMSWL 635

>TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {ON}
           Anc_8.839 YMR277W
          Length = 713

 Score =  825 bits (2131), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/645 (62%), Positives = 476/645 (73%), Gaps = 22/645 (3%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERXXXXXXXXXXXXXXX 60
           MTT + SPE LPYPI ID+LI  +GS +++G RL  +KFWY+VE                
Sbjct: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVE--------------IA 46

Query: 61  XXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120
                       K +RESIEFFE+P+EGDL+SWNVDVGDE+   NQ ICEI RPCNHDIV
Sbjct: 47  SSPDENEGGHRKKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIV 106

Query: 121 YGGLCTQCGKEVS-ADAFDGVPLDVVGDMDLQISETEAIRTGRALKEHLRRDKKLILVVD 179
           YGGLCT CGKEV  ++ F+G       D++L++S  EA      LK  LR  KKL+LVVD
Sbjct: 107 YGGLCTLCGKEVDESEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVD 166

Query: 180 LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPPPV 239
           LDQT+IHCGVDPTI EWK D +NPN+E L+DV+SF LDEE +LPL+YM      PKPP V
Sbjct: 167 LDQTVIHCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMG-----PKPP-V 220

Query: 240 RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDE 299
           RKCWYYVKVRPGLKEFF KVAPLFEMHIYTMATRAYAL+IAKI+DP G LFGDRILSRDE
Sbjct: 221 RKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDE 280

Query: 300 NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS 359
           NGS+T KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP+Q 
Sbjct: 281 NGSITQKSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQ 340

Query: 360 TGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEEPSANE 419
             MLQLGR  R+K+QES ELITDIMD EKKLQEKID EVKRQEE+LNHQ+A+ EE  A E
Sbjct: 341 NTMLQLGRGARKKTQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAPE 400

Query: 420 SKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXVDDDDELHYLMSTLLNIHKTYYQ 479
           SK++L KKLEYSASLEVQQQNRP              VDDDDEL+YL   L  +H  YY+
Sbjct: 401 SKDQLAKKLEYSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYK 460

Query: 480 MLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSD 539
            L Q  E + ++  ++P +K KVF++C+FVFSGLIPLGT+I R+DIV+WT+ FGA S+ +
Sbjct: 461 TLGQDSEKKADIKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPE 520

Query: 540 INYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDSPIS 599
           I+  TTH+IT+ PGTYKAR+AK FN  IKVVHPDW+FECLV+WK VDEKPY LIV+   +
Sbjct: 521 IDDSTTHVITRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTAT 580

Query: 600 DDELQSFXXXXXXXXEYLDEHHEQQHMLMPQEN-INLFAAGTSWL 643
           D+EL  +          L E   +  M   +   INLFA GTSWL
Sbjct: 581 DEELGDYKQKLARRSSALAEQEMELAMESAKNGTINLFAGGTSWL 625

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/654 (62%), Positives = 490/654 (74%), Gaps = 24/654 (3%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERXXXXXXXXXXXXXXX 60
           MTT + +PEGLPYPI ID+LI  +G+++++G RL  YKFWY+VE                
Sbjct: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVE-------IASSPDDND 53

Query: 61  XXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120
                       K++RESIEFF++P+EG LISWN+DVGDE+++A+QVICEIKRPCNHDIV
Sbjct: 54  PANTDTQASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIV 113

Query: 121 YGGLCTQCGKEV--SADAFDGVPLDVV-GDMDLQISETEAIRTGRALKEHLRRDKKLILV 177
           YGGLCTQCGKEV  S  +  G    V   D +L+IS  EA+  G   K+ LR +KKL+LV
Sbjct: 114 YGGLCTQCGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLV 173

Query: 178 VDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPP 237
           VDLDQT+IHCGVDPTI EWK+DPNNPN++TL+DV+ F L+EE VLP MYM      PKP 
Sbjct: 174 VDLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMG-----PKPT 228

Query: 238 PVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSR 297
           P RKCWYYVKVRPGLKEFF KVAPLFEMHIYTMATRAYAL+I KI+DPTGELFG+RILSR
Sbjct: 229 P-RKCWYYVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSR 287

Query: 298 DENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPK 357
           DENGSLT+KSL +LFPTDQSMV++IDDRGDVWNW PNLIKVVPY+FFVGVGDINSNFLPK
Sbjct: 288 DENGSLTSKSLERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPK 347

Query: 358 QSTGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEEPSA 417
           Q T MLQLGR++R+K++E+ EL+TDIMD EKKLQEKID EVKRQE+ L+HQ+   EE  +
Sbjct: 348 QQTTMLQLGRRSREKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVS 407

Query: 418 NESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXVDDDDELHYLMSTLLNIHKTY 477
           NE+KEE TKKLE+SAS+EVQQQNRP              +DDDDEL++L  TL  +H  Y
Sbjct: 408 NETKEEWTKKLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEY 467

Query: 478 YQMLSQPG--EIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGAT 535
           Y +L      E   ++  I+P LKQ VF+ C+FVFSGLIPL TDI+R+DIV+WTS FGA 
Sbjct: 468 YSILENKSLDESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAE 527

Query: 536 STSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVD 595
           S+S+IN +TTH+ITK PGT+KARLAK FN +IK+VHPDW+FECL+ W  VDEKPYTLIV+
Sbjct: 528 SSSEINEVTTHVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVE 587

Query: 596 SPISDDELQSFXX--XXXXXXEYLDEHHEQQHMLMPQEN----INLFAAGTSWL 643
            PISD EL+ F          E  +E +         EN    ++LFA GTSWL
Sbjct: 588 EPISDRELKKFREDLNNRKLTERNNEQNSGDITGTIVENFDNTVDLFATGTSWL 641

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/607 (65%), Positives = 473/607 (77%), Gaps = 19/607 (3%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERXXXXXXXXXXXXXXX 60
           M+T + +P GLPYPI +D+L+  +GS++++G RL  YKFWY+VE                
Sbjct: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVE-------IANSPDDND 53

Query: 61  XXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120
                       +++RESIEF+E+P+EGDL+SWNVD  DEIA  N  +CEIKRPCNHDIV
Sbjct: 54  IDYEGPEIEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIV 113

Query: 121 YGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRTGRALKEHLRRDKKLILV 177
           YGGLCT CGKEV  D +D V  ++     D +L++S  EAI   + +   L+ +KKL+LV
Sbjct: 114 YGGLCTMCGKEV--DEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLV 171

Query: 178 VDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPP 237
           VDLDQT+IHCGVDPTI EWK DP+NPN+ETL+DVK F+L+EE +LPL+YM      PKPP
Sbjct: 172 VDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMG-----PKPP 226

Query: 238 PVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSR 297
            VR CWYYVK+RPGLKEFF K+APL+EMHIYTMATRAYAL+IAKI+DP   LFGDRILSR
Sbjct: 227 -VRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSR 285

Query: 298 DENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPK 357
           DENGSLT KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPK
Sbjct: 286 DENGSLTQKSLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPK 345

Query: 358 QSTGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEEPSA 417
           Q T MLQLGR+TRQK +ES+EL+TDIMD EKKLQEKID EVKRQEE+LNHQ+ATAEE + 
Sbjct: 346 QQTTMLQLGRRTRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTD 405

Query: 418 NESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXVDDDDELHYLMSTLLNIHKTY 477
            ESKE++ KKLE+SASLEVQQQNRP              +DDDDEL YL  TL  IHK +
Sbjct: 406 QESKEKIAKKLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEF 465

Query: 478 YQMLSQPG-EIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATS 536
           Y +L     + E ++  ++P LK+KVF+ C+FVFSGLIPLGTDI+R+DIVIWTS FGA S
Sbjct: 466 YHLLEDASDQNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAES 525

Query: 537 TSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDS 596
           TSDI+  TTH++TK PGTYKARLAK FNP+IKVVHPDWIFECL +WK++DEKPY LIV+ 
Sbjct: 526 TSDIDEHTTHVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQ 585

Query: 597 PISDDEL 603
           P+S+DEL
Sbjct: 586 PVSEDEL 592

>ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277W FCP1
           Carboxy-terminal domain (CTD) phosphatase
          Length = 764

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/651 (60%), Positives = 484/651 (74%), Gaps = 26/651 (3%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERXXXXXXXXXXXXXXX 60
           M T + +PE LPYPI ID+LI  +GS +++G RL  YKFWY+VE                
Sbjct: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVE----------IASSPD 50

Query: 61  XXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120
                       K +RESIEFFESP+EGDL+SW VD GDE+A+A QVICEI RPCNHD+V
Sbjct: 51  ENDGNGGAQHSKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVV 110

Query: 121 YGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRTGRALKEHLRRDKKLILV 177
           YGGLCT CGKEV  D  D +  ++     D +L++S  EA      LK+ LR+ KKL+LV
Sbjct: 111 YGGLCTMCGKEV--DENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLV 168

Query: 178 VDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPP 237
           VDLDQT+IHCGVDPTI EWK DP+NPN+ETL+DV+ F+L+EE ++P MYM      P+ P
Sbjct: 169 VDLDQTVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMG-----PRLP 223

Query: 238 PVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSR 297
             RKCWY+VKVRPGL+EFFA++APL+EMHIYTMATR YAL+IAKI+DP G LFGDRILSR
Sbjct: 224 E-RKCWYFVKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSR 282

Query: 298 DENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPK 357
           DENGSLT KSL +LFPTDQSMV+VIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP+
Sbjct: 283 DENGSLTQKSLERLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPR 342

Query: 358 QSTGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEEPSA 417
           Q +G+LQLGR+T +K QES EL+TDIMD EK+LQEKID EVKRQEE+L+HQL T +EP  
Sbjct: 343 QQSGLLQLGRRTHKKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQ 402

Query: 418 NESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXVDDDDELHYLMSTLLNIHKTY 477
            ESKE+LTKKLEYSASLEVQQQNRP              VDDDDEL+YL  TL  IH+ Y
Sbjct: 403 GESKEQLTKKLEYSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELYYLKDTLAKIHRKY 462

Query: 478 YQMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATST 537
           Y++L +  E   ++  ++P++K +VF++CYFVFSGLIPLGT+I+R+DIV+WT  FGA ++
Sbjct: 463 YKLLDEGNENSADIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITS 522

Query: 538 SDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDSP 597
           S+I+  TTH+ITK PGTYKAR+AK FN  +KVVHPDW+FECLV W  VDEKPY LI+  P
Sbjct: 523 SEIDENTTHVITKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDP 582

Query: 598 ISDDELQSFXXXXXXX---XEYLDEHHEQQHMLMPQEN--INLFAAGTSWL 643
            +++E+Q F           E   E  E + ++   ++  +NLFA GTSWL
Sbjct: 583 ATEEEIQDFKRKIEQRHLIEEQRREQFESEALMKTAQDSTLNLFAGGTSWL 633

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/657 (57%), Positives = 463/657 (70%), Gaps = 34/657 (5%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERXXXXXXXXXXXXXXX 60
           M+T + +P GLPYPI I KLI S+GS +++G RL  YKFWY+VE                
Sbjct: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVE----------IAKSPD 50

Query: 61  XXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120
                       K +RESIEFF+SP+EGDL+SWNVDVGDEI   NQ ICEI RPCNHDIV
Sbjct: 51  ENDDGVNDEHSKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIV 110

Query: 121 YGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRTGRALKEHLRRDKKLILV 177
           Y G+CT CGKEV  D  D V  ++     D +L++S  EA   G+ +K+ L R+KKLILV
Sbjct: 111 YAGICTMCGKEV--DESDQVSANLTISHTDTNLKVSRREANDIGQGIKKRLIREKKLILV 168

Query: 178 VDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPP 237
           VDLDQT+IHCGVDPTIAEWKNDP NPNFETLRDVKSF L+EE +LP MYM      PKPP
Sbjct: 169 VDLDQTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMG-----PKPP 223

Query: 238 PVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSR 297
              KCWYYVK+RPGLKEFF +V+ L+EMHIYTMATR+YA +IAKI+DP G LF DRILSR
Sbjct: 224 -THKCWYYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSR 282

Query: 298 DENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPK 357
           +ENGSLT KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKV PYNFFVG+GDINSNFLP+
Sbjct: 283 NENGSLTHKSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPR 342

Query: 358 QSTGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLAT-AEEPS 416
           Q T MLQLGR+  +K++++ EL+TDIMD EKKLQEKID EVKRQEE L+HQ A   EE S
Sbjct: 343 QQTTMLQLGRRNHKKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEIS 402

Query: 417 ANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXVDDDDELHYLMSTLLNIHKT 476
           +   KE++TKK+E+SASLEVQQQNRP               DDDDEL YL   L N+ + 
Sbjct: 403 SQVRKEDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQK 462

Query: 477 YYQMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATS 536
           YY+ L    EI+  +  ++P LK+KV + C FVFSGLIPLGT+IQ++DIV+WT+ FGA S
Sbjct: 463 YYEELKTDKEIQ--IQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQS 520

Query: 537 TSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDS 596
           ++DI   TTH+ITK P TYKA++AK F  +IKV+HPDW+FECL+NWK + E PY   +  
Sbjct: 521 SADITEDTTHVITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIP 580

Query: 597 PISDDELQSFXXXXXXXXEY-------LDEHHEQQHMLMPQE---NINLFAAGTSWL 643
             +D EL  F        +        + E   +     P     +++LFA+G SWL
Sbjct: 581 TATDKELNEFKEALERRKKKETKTKITVSEESLEGDSNSPSSQGASVDLFASGASWL 637

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/589 (63%), Positives = 451/589 (76%), Gaps = 26/589 (4%)

Query: 75  LRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIVYGGLCTQCGKEVSA 134
           +RESIEFF+ PY+G L SW V+ GD+I   NQ +CEI+RPCNHD++YGGLCT CGKEV  
Sbjct: 109 VRESIEFFDCPYDGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDE 168

Query: 135 DAFD---GVPLDVV-GDMDLQISETEAIRTGRALKEHLRRDKKLILVVDLDQTIIHCGVD 190
           +  D   G  L +   D +L+IS  EA+  G+++K+ LR DKKLILVVDLDQT+IHCGVD
Sbjct: 169 NDIDDLSGPNLTISHTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCGVD 228

Query: 191 PTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPPPVRKCWYYVKVRP 250
           PTI EWK DP NPNFETL+DVK F L+EE +LPLMYM      PKPP  RKCWYYVKVRP
Sbjct: 229 PTIGEWKRDPTNPNFETLKDVKEFALEEEPILPLMYMG-----PKPP-ARKCWYYVKVRP 282

Query: 251 GLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDENGSLTTKSLAK 310
           GLK+FF KVAPLFEMHIYTMATRAYA +IAKI+DPTG+LFG+RILSRDENGSLTTKSL +
Sbjct: 283 GLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLER 342

Query: 311 LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQSTGMLQLGRKTR 370
           LFPTDQSMV++IDDRGDVWNW PNLIKV+PYNFFVGVGDINSNFLPKQ   MLQLGR++ 
Sbjct: 343 LFPTDQSMVIIIDDRGDVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSS 402

Query: 371 Q-----KSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEEP--SANESKEE 423
           +      ++E+ +L+TDIMD EK LQ KI+ EVKRQEE+LNHQLAT EEP  +A E+KEE
Sbjct: 403 RGESKVSTKENDDLLTDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEE 462

Query: 424 LTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXVDDDDELHYLMSTLLNIHKTYYQMLSQ 483
           ++KK+EYSASLEVQQ+NRP              +DDD+EL++L  TL  IH  YY+ML +
Sbjct: 463 ISKKIEYSASLEVQQKNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQK 522

Query: 484 PGE----IEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSD 539
             E    IEP++  I+P +KQ V Q+C+FVFSGLIPLGT+IQ+SDIVIWT+ FGA ST+D
Sbjct: 523 ANENKDSIEPDIKYIMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTAD 582

Query: 540 INYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDSPIS 599
           I+  TTH+ITK PGTYKARLAK ++P+IK+VHPDW+FECL+ WK V+EKPY L+V+  +S
Sbjct: 583 IDENTTHVITKTPGTYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVS 642

Query: 600 DDELQSFXXXXXXXXEYLDEHHEQQHMLMPQENI-----NLFAAGTSWL 643
           D EL  F        +  +   E  +  +P  NI     NLFA GTSWL
Sbjct: 643 DKELADFNRKLERRIQLSELKDEGLYNKLPDGNIDINEVNLFAGGTSWL 691

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/42 (59%), Positives = 33/42 (78%)

Query: 3  TQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVE 44
          T IR+P GLPYPI ID+L+  +G+ + + DRLL YKFWY+VE
Sbjct: 5  TVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVE 46

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/680 (55%), Positives = 467/680 (68%), Gaps = 43/680 (6%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERX--------XXXXXX 52
           M+T + SP  LP+PI ID+LI  +GS +++G RL  YKFWY+VE                
Sbjct: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTSENSS 60

Query: 53  XXXXXXXXXXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIK 112
                               K +RESIEFFESP+EGDLI WNVD GDEI + NQ++C+IK
Sbjct: 61  DLSGNNSDSNENGNNASHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120

Query: 113 RPCNHDIVYGGLCTQCGKEVS-ADAFDGVPLDVVGDMDLQISETEAIRTGRALKEHLRRD 171
           RPCNHDIVY G+CTQCGKEV  +D  D        D +L+IS  EA    ++    L++ 
Sbjct: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRLKKI 180

Query: 172 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDG 231
           KKLILVVDLDQT+IHCGVDPTI EWKNDP NPN+ETL+DV+SF+LDEE +LP  YM    
Sbjct: 181 KKLILVVDLDQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMG--- 237

Query: 232 SVPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFG 291
             P+PP VRKCWYYVKVRPGLKEFFAK+APL+EMHIYTMATRAYAL+IAKI+DP G LFG
Sbjct: 238 --PRPP-VRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFG 294

Query: 292 DRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDIN 351
            RILSRDENGSLT KSL +LFPTDQSMV++IDDRGDVWNWC NLIKV+PYNFFVG+GDIN
Sbjct: 295 SRILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDIN 354

Query: 352 SNFLPKQSTGMLQLGRKTRQKSQ----------------------ESQELITDIMDNEKK 389
           SNFLP+Q + MLQLG ++ +K                        +++EL+TDIMD EKK
Sbjct: 355 SNFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKK 414

Query: 390 LQEKIDIEVKRQEEQL-NHQLATAEEPSANESKEELTKKLEYSASLEVQQQNRPXXXXXX 448
           LQ+KID EV+RQE++L   ++   +  S   S  EL+KK+E+SASLEVQQQNRP      
Sbjct: 415 LQKKIDEEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQR 474

Query: 449 XXXXXXXXVDDDDELHYLMSTLLNIHKTYYQMLSQPGEIEPNLMEIIPSLKQKVFQNCYF 508
                   +DDDDEL YL   L  +H T+Y+ L +      ++  ++P LK  VF    F
Sbjct: 475 HRQNQRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNF 534

Query: 509 VFSGLIPLGTDIQRSDIVIWTSTFGATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIK 568
           VFSGLIPLGTDI+R+DIV+WT+ FGA ST+DI+  TTH+ITK  GTYKARLAK FNPEIK
Sbjct: 535 VFSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIK 594

Query: 569 VVHPDWIFECLVNWKKVDEKPYTLIVDSPISDDELQSFXXXXXXXXEYLDEHHEQQHMLM 628
           VVHPDWIFECLV+WK++ EKPY LI++ P S++EL+ F        E L++   +     
Sbjct: 595 VVHPDWIFECLVSWKRMPEKPYELIIEQPASEEELEEFKKKLELKNELLEKREMETEAQF 654

Query: 629 PQEN-----INLFAAGTSWL 643
              N     I+LFA+GTSWL
Sbjct: 655 EALNTRDPAIDLFASGTSWL 674

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/660 (56%), Positives = 454/660 (68%), Gaps = 32/660 (4%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERXXXXXXXXXXXXXXX 60
           M T ++ P+G+PYPI I KLI  VGS++ +GDRL  YKFWYLVE                
Sbjct: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVE-------IAKSPDELD 53

Query: 61  XXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120
                       K +RESI+FF++P+EG +I WNVDVGDEI    +++CE+KRPC+HDIV
Sbjct: 54  VNGNVQDGEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIV 113

Query: 121 YGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRTGRALKEHLRRDKKLILV 177
           Y G+CT CGKEV  D  D V  ++     D +L++S  EA   G+  K  L R KKLILV
Sbjct: 114 YAGICTMCGKEV--DERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILV 171

Query: 178 VDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPP 237
           VDLDQT+IHCGVDPTI+EWKNDP+NPN+ETLR+VKSF L+EE +LP MYM      PKPP
Sbjct: 172 VDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMG-----PKPP 226

Query: 238 PVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSR 297
            V KC YYVKVRPGLKEFF KVAP++EMHIYTMATRAYA +IAKI+DP G LFG+RILSR
Sbjct: 227 -VHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSR 285

Query: 298 DENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPK 357
           DENGSLT KSL +LFPTDQSMVV+IDDRGDVWNW PNLIKV PYNFFVG+GDINSNFLP+
Sbjct: 286 DENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPR 345

Query: 358 QSTGMLQLGRKTRQK--SQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLAT-AEE 414
           Q   MLQ+GR+       +ES+EL+TDI+D EKKLQEKID EVKRQE  L H+ A   EE
Sbjct: 346 QQATMLQMGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEE 405

Query: 415 PSANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXVDDDDELHYLMSTLLNIH 474
             A     ++TKK+E+SASLEVQQQNRP               DDDDEL YL   L  + 
Sbjct: 406 AVAQVRNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQ 465

Query: 475 KTYYQM--LSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTF 532
             +Y+   L      + ++ E++P LK+ VF++C FVFSGLIPLGTDIQ++DIV+WT  F
Sbjct: 466 SEFYKALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMF 525

Query: 533 GATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTL 592
           GA+STS+I   TTH+ITK PGT KAR+AK FNP IKVVHPDW+FECL  WK VDEK + L
Sbjct: 526 GASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFEL 585

Query: 593 IVDSPISDDELQSFXXXXXXXXEYL---------DEHHEQQHMLMPQENINLFAAGTSWL 643
            VD   S+ EL+ F        +           D ++    M      ++LFA G+SWL
Sbjct: 586 KVDQVASERELEEFKKNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL 645

>KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON}
           Anc_8.839 YMR277W
          Length = 742

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/668 (55%), Positives = 463/668 (69%), Gaps = 42/668 (6%)

Query: 3   TQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERXXXXXXXXXXXXXXXXX 62
           T + S  GLPYP+ +D+LIP VG  +  GDRL  YKFWY+VE                  
Sbjct: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVE--------LAGVDAAAEG 58

Query: 63  XXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIVYG 122
                     K +RES+EFFESP+EG ++SW+VD GDEI      +C ++RPCNHD+VY 
Sbjct: 59  DSDGTGTTAKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYN 118

Query: 123 GLCTQCGKEVS-------ADAFDGVPLDVV---GDMDLQISETEAIRTGRALKEHLRRDK 172
           GLCT CG+EV        A A  GV  ++     D +LQIS  EA +    L++ LR  +
Sbjct: 119 GLCTLCGREVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEAQQLDLQLQQRLRAAQ 178

Query: 173 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGS 232
           KL+LVVDLDQT++HCGVDPTI EWK DP NPN+E LRDV+SF L+EE +LP +Y+   G 
Sbjct: 179 KLVLVVDLDQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVG--GK 236

Query: 233 VPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGD 292
            P P   RKCWYYVKVRPGLK+FF ++APLFEMHIYTMATRAYAL+IAKI+DP   LFGD
Sbjct: 237 RPAP---RKCWYYVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGD 293

Query: 293 RILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINS 352
           RILSRDENGSLT KSL +LFPTDQSMV VIDDRGDVWNWC NLIKVVPYNFFVGVGDINS
Sbjct: 294 RILSRDENGSLTHKSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINS 353

Query: 353 NFLPKQSTGMLQLGRKTR--QKSQESQE---------LITDIMDNEKKLQEKIDIEVKRQ 401
           NFLPKQ   MLQ+GR+++  ++  ES++         L+TDIM+ EK+LQEKID EVKRQ
Sbjct: 354 NFLPKQQPTMLQMGRRSKLNERGHESKQQQDDVKDDLLLTDIMNTEKQLQEKIDQEVKRQ 413

Query: 402 EEQLNHQLATA-EEPSANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXVDDD 460
           E +LN   A   E+ +  +SKEE TKKLE+SAS+EVQQ+NRP              VD+D
Sbjct: 414 EHKLNKGNAAGDEQQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDND 473

Query: 461 DELHYLMSTLLNIHKTYYQMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDI 520
           DEL YL   L ++HK YY  L +  + + N+  I+  LK +VFQ+C+FVFSGLIPL T++
Sbjct: 474 DELFYLKDRLADLHKRYYSTLKENPQ-DTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNV 532

Query: 521 QRSDIVIWTSTFGATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLV 580
           Q +DIVIWT+ FGAT+T+D++  TTHLITK PGT KARLAK FNP+IK+VHPDWIFECL+
Sbjct: 533 QAADIVIWTNKFGATTTNDLDETTTHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLI 592

Query: 581 NWKKVDEKPYTLIVDSPISDDELQSFXXXXXXXXEYLDEHHEQQHMLMP-----QENINL 635
            W++VD KPY LIV+ P+S+ +++ F        E   E    +  L+P     + +I+L
Sbjct: 593 KWERVDVKPYLLIVEDPVSEAQVREFKEKLTRQKERA-ERQTSRTALLPANKPAEPDIDL 651

Query: 636 FAAGTSWL 643
           FA G SWL
Sbjct: 652 FAGGISWL 659

>SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 688

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/650 (54%), Positives = 449/650 (69%), Gaps = 33/650 (5%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERXXXXXXXXXXXXXXX 60
           MTT ++ P+ LPYPI I +L  S G  +++G RL  YK+W   +                
Sbjct: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQD---------------V 45

Query: 61  XXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120
                       KQ  + I  F+SP EG L+S+N+ +GDE   +N V+ EIK+ C HD+ 
Sbjct: 46  VTSPNDTSTKPKKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVT 105

Query: 121 YGGLCTQCGKEV----SADAFDGVPLDVV---GDMDLQISETEAIRTGRALKEHLRRDKK 173
           YGGLC  CGK V    S  A D     +     + +++ISE +A       ++ LR+ KK
Sbjct: 106 YGGLCVICGKSVEEYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAQKQLRKLKK 165

Query: 174 LILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSV 233
           L+LVVDLDQT+IHCGVDPTI EW  DP NPN+E L+D+KSF L EE +LP  YM      
Sbjct: 166 LVLVVDLDQTVIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMG----- 220

Query: 234 PKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDR 293
           PKPP  RKCWYYVK+RPGLKEFF K+AP FE+HIYTMATRAYAL+IAKI+DP G+LFGDR
Sbjct: 221 PKPP-ARKCWYYVKLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDR 279

Query: 294 ILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSN 353
           ILSRDENGS+T KSL +LFP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVGVGDINSN
Sbjct: 280 ILSRDENGSITHKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSN 339

Query: 354 FLPKQSTGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAE 413
           FLP+Q   ML LGR+ R+K++E +EL+TDI+D EKKLQEKID EVKRQEE+L+ ++   +
Sbjct: 340 FLPRQQNSMLHLGRRHRKKAEE-EELLTDILDTEKKLQEKIDEEVKRQEEKLS-KMTEEK 397

Query: 414 EPSANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXVDDDDELHYLMSTLLNI 473
           +P    SKE+L KKLE+SASLEVQQQNRP              +DDDDEL +L   LL +
Sbjct: 398 QPEDTNSKEDLAKKLEHSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQV 457

Query: 474 HKTYYQMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFG 533
           H  YY+ LS+     PN+  ++P LK++VF  C FVFSGLIPLGTD++++DI +WTS FG
Sbjct: 458 HGKYYEDLSKHSS-PPNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFG 516

Query: 534 ATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLI 593
           A +T+DI+  TTH+ITK PGT+KARLAK FNPEIKVVHPDWIFECLVNWK+VDEK Y L+
Sbjct: 517 AKTTADIDEATTHIITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELL 576

Query: 594 VDSPISDDELQSFXXXXXXXXEYLDEHHEQQHMLMPQENINLFAAGTSWL 643
           ++ P+S++EL  F        E  D   +++   +  + INL A   SWL
Sbjct: 577 IEQPVSEEELDDF--KKKLENEKKDAQIQEEVDRVSSDEINLLAGNDSWL 624

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/651 (53%), Positives = 452/651 (69%), Gaps = 34/651 (5%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERXXXXXXXXXXXXXXX 60
           MTT IR P  LP+PI I KL  S G  + +G RL VYK+W L +                
Sbjct: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQD---------------- 44

Query: 61  XXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120
                       K+  + I  F+SP EG L+S  V VGDE    + +I E+++PC+H++ 
Sbjct: 45  VITAPNEEASKKKRRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVT 104

Query: 121 YGGLCTQCGKEVSAD----AFDGVP---LDVV-GDMDLQISETEAIRTGRALKEHLRRDK 172
           YG LC  CGK V  D    +  GV    L V   + ++++SE +A    +  ++ LR  K
Sbjct: 105 YGALCVVCGKAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERK 164

Query: 173 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGS 232
           KL+LVVDLDQT+IHCGVDPTI EW NDP+NPN++ L++VK+F+LDE+ +LP  YM     
Sbjct: 165 KLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMG---- 220

Query: 233 VPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGD 292
            P+PPP R+C YYVK+RPGL+EFF KVAP FE+HIYTMATRAYAL+IAKI+DPT  LFGD
Sbjct: 221 -PRPPP-RRCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGD 278

Query: 293 RILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINS 352
           RILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDINS
Sbjct: 279 RILSRDENGSLTHKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINS 338

Query: 353 NFLPKQSTGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATA 412
           NFLP+Q   ML +GR+ R+K++E +EL+TDIMD EKKLQEKID EVK+QEE+ N +++  
Sbjct: 339 NFLPRQQNSMLHMGRRHRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KISEE 396

Query: 413 EEPSANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXVDDDDELHYLMSTLLN 472
            +P  + SKE+LTKKLE++ASLEVQQQNRP              +DDDDEL +L   LLN
Sbjct: 397 NQPDRSMSKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLN 456

Query: 473 IHKTYYQMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTF 532
           +H+TYY+ L++  E+ P++  ++P +K KVF  C+FVFSGLIPLGT+I+ +DIV+WT+ F
Sbjct: 457 VHRTYYEELAK-TEVFPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMF 515

Query: 533 GATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTL 592
           GA ++SDI+  TTH+ITK PGT+KARLAK +NP+IK+VHPDWIFECLV W + DEKPY L
Sbjct: 516 GAQTSSDIDENTTHVITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYEL 575

Query: 593 IVDSPISDDELQSFXXXXXXXXEYLDEHHEQQHMLMPQENINLFAAGTSWL 643
           I++  +S DEL+ F        +  ++   +       E +NL A    WL
Sbjct: 576 IIEQEVSSDELEEF-QRNLKKRQMAEKAARESLQQETGEELNLLAGNDMWL 625

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/614 (55%), Positives = 438/614 (71%), Gaps = 33/614 (5%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERXXXXXXXXXXXXXXX 60
           MTT IR P  LP+P+ I KL  S G  +++G RL VYK+W L +                
Sbjct: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQD---------------- 44

Query: 61  XXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120
                       K+  + I  F+SP EG L+S N+ +GDE      VI E+ + C+H++ 
Sbjct: 45  IITAPNEEAPKKKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVT 104

Query: 121 YGGLCTQCGK-------EVSADAFDGVPLDVV-GDMDLQISETEAIRTGRALKEHLRRDK 172
           YGGLC  CGK        VS +      L V   + ++++SE +A    +  ++HLR  K
Sbjct: 105 YGGLCVVCGKTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHK 164

Query: 173 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGS 232
           KL+LVVDLDQT+IHCGVDPTI EW NDP+NPN++ L++VK+F+LDE+ +LP  YM     
Sbjct: 165 KLVLVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMG---- 220

Query: 233 VPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGD 292
            P+PPP RKC YYVK+RPGL+EFF K+AP FE+HIYTMATRAYAL+IAKI+DP GELFGD
Sbjct: 221 -PRPPP-RKCQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGD 278

Query: 293 RILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINS 352
           RILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDINS
Sbjct: 279 RILSRDENGSLTHKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINS 338

Query: 353 NFLPKQSTGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATA 412
           NFLP+Q   ML LGR+ R+K++E +EL+TDIMD EKKLQEKID EVK+QEE+ N ++   
Sbjct: 339 NFLPRQQNSMLHLGRRNRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KINEE 396

Query: 413 EEPSANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXVDDDDELHYLMSTLLN 472
            +P    SKE+LTKKLE++ASLEVQQQNRP               DDDDEL +L + LLN
Sbjct: 397 NQPERPISKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLN 456

Query: 473 IHKTYYQMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTF 532
           +HKTYY  L++ G+  P++  ++P +K +VF+ C+FVFSGLIPLGT+++++DIV+WTS F
Sbjct: 457 VHKTYYDKLAEQGQ-PPDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMF 515

Query: 533 GATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTL 592
           GAT++ D++  TTH+ITK PGT+KARLAK +NP IKV+HPDWIFECLV W +V+EKPY L
Sbjct: 516 GATTSVDVDEATTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYEL 575

Query: 593 IVDSPISDDELQSF 606
             +  +S +EL+ F
Sbjct: 576 TTEQDVSPEELEEF 589

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/620 (54%), Positives = 431/620 (69%), Gaps = 37/620 (5%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERXXXXXXXXXXXXXXX 60
           M+T IR P+ LPYPI + +L  S G  ++ G RL  YK+W   +                
Sbjct: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQ---------------- 44

Query: 61  XXXXXXXXXXXTKQLRESIEF---FESPYEGDLISWNVDVGDEIATANQVICEIKRPCNH 117
                       K  R+ I+    F+SP  G ++S N+ +GDE   +   + EIK+PC H
Sbjct: 45  IVTSPGDESAGGKSKRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTH 104

Query: 118 DIVYGGLCTQCGKEVSADAFDGVPLDVVG-------DMDLQISETEAIRTGRALKEHLRR 170
           D+ YGGLC QCG+ V  +   G  LD          +M+++ISE +A    ++ ++ LR 
Sbjct: 105 DVTYGGLCVQCGQTVEDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLRE 164

Query: 171 DKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAED 230
            +KL+LVVDLDQT+IHCGVDPTI EW  DP+NPN+E+L+DV+SF+L EE VLP  YM   
Sbjct: 165 ARKLVLVVDLDQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMG-- 222

Query: 231 GSVPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELF 290
              PKPP  RKCWYYVK+RPGL++FF+ +AP FE+HIYTMATR YAL+IAKI+DP G LF
Sbjct: 223 ---PKPP-TRKCWYYVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLF 278

Query: 291 GDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDI 350
           GDRILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVG+GDI
Sbjct: 279 GDRILSRDENGSLTQKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDI 338

Query: 351 NSNFLPKQSTGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLA 410
           NSNFLP+Q   ML LGR+ R+K ++ +EL+TDI+D EKKL+ KI  EVKRQEE++  +L+
Sbjct: 339 NSNFLPRQQNSMLHLGRRNRKKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEM-QKLS 397

Query: 411 TAEEPSANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXVDDDDELHYLMSTL 470
             + P    SKE++ KKLE++ASLEVQQQNRP              +DDDDEL +L   L
Sbjct: 398 EEKIPDHTTSKEDIAKKLEHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDIL 457

Query: 471 LNIHKTYYQMLSQ----PGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIV 526
           L +H  YY  L +      E+ P++  +IPSLK+ VF+ C FVFSGLIPL T+I R+DIV
Sbjct: 458 LRVHSAYYDQLEKNKHGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIV 517

Query: 527 IWTSTFGATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVD 586
           +WT+TFGA +T +I+Y TTHLITK PGT KARLA  FN +IK+VHPDWIFEC+VNWK+VD
Sbjct: 518 LWTNTFGAKTTINIDYNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVD 577

Query: 587 EKPYTLIVDSPISDDELQSF 606
           EKPY LIV+ P+S + L++F
Sbjct: 578 EKPYELIVEEPVSKEYLENF 597

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/615 (55%), Positives = 435/615 (70%), Gaps = 34/615 (5%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERXXXXXXXXXXXXXXX 60
           M+T IR P+ LPYPI I +L  S G  +++G RLL YK+W LV+                
Sbjct: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVD--------------VI 46

Query: 61  XXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120
                       KQ  + +  F+SP  G ++S +V VGDE   + + + EI++ C HD+ 
Sbjct: 47  TAPGEEEAGKARKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVT 106

Query: 121 YGGLCTQCGKEVS--ADAFDGV---PLDVV-GDMDLQISETEAIRTGRALKEHLRRDKKL 174
           YGGLC QCG+ V   A A DGV    L V   +  +++SE +A   G++ +  LR  +KL
Sbjct: 107 YGGLCVQCGQAVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKL 166

Query: 175 ILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVP 234
           +LVVDLDQT+IHCGVDPTI EW  DPNNPN+E L+DV+SF+LDEE VLP  YM      P
Sbjct: 167 VLVVDLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMG-----P 221

Query: 235 KPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRI 294
           KPP  RKCWYYVK+RPGLKEFFAK+AP FE+HIYTMATRAYAL+IAKI+DP G+LFGDRI
Sbjct: 222 KPP-TRKCWYYVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRI 280

Query: 295 LSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNF 354
           LSRDENGSLT KSL +LFP DQSMVVVIDDRGDVWNWC NLIKVVPY+FFVG+GDINSNF
Sbjct: 281 LSRDENGSLTQKSLERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNF 340

Query: 355 LPKQSTGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEE 414
           LP Q   ML LGR+ R+K ++ +EL+TDI+D EKKL+EKI+ EVKRQE+Q+ H+L   + 
Sbjct: 341 LPIQQNSMLHLGRRNRKKPKQEEELLTDILDTEKKLKEKINEEVKRQEDQM-HRLTDEKL 399

Query: 415 PSANESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXVDDDDELHYLMSTLLNIH 474
           P       ++ KKLE++ASLEVQQQNRP               DDDDEL +L + LL +H
Sbjct: 400 PDTR----DIAKKLEHNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVH 455

Query: 475 KTYYQMLSQPGEIE---PNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTST 531
             YY  L +    E   P++  ++P LK+ VF+ C FVFSGLIPL T+I+R+DIV+WT+ 
Sbjct: 456 SAYYDQLQRYNSGEDPIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNM 515

Query: 532 FGATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYT 591
           FGA++T++++Y TTHLIT+ PGT KARLAK FNP IK+VHPDWIFECLV W++V+E PY 
Sbjct: 516 FGASTTANLDYNTTHLITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYE 575

Query: 592 LIVDSPISDDELQSF 606
           LIV+ P+ ++ L++F
Sbjct: 576 LIVEEPVGEEYLENF 590

>KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase ,
          Length = 719

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/608 (52%), Positives = 418/608 (68%), Gaps = 28/608 (4%)

Query: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERXXXXXXXXXXXXXXX 60
           + T ++    LPYPI + +L    G  +++G RL  Y++W   +                
Sbjct: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQD---------------- 46

Query: 61  XXXXXXXXXXXTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120
                       KQ  + +  F+SP  G +  W+  V DE A+AN  +  I++ CNHDI 
Sbjct: 47  --VLVKYEEKTKKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDIT 104

Query: 121 YGGLCTQCGKEVSA-DAFDGVPLDVVGDMDLQISETEAIRTGRALKEHLRRDKKLILVVD 179
           YGGLC QCG  V   D    + +  V + ++++SE +A    R+    LR +KKL+LVVD
Sbjct: 105 YGGLCVQCGNTVDEEDNSKNLTISHV-NTNIKVSEQQAETLERSSLTRLREEKKLVLVVD 163

Query: 180 LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPPPV 239
           LDQT+IHCGVDPTI EW  DP NPN++ L+DVKSFTL++E ++P  Y       PKPP  
Sbjct: 164 LDQTVIHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFG-----PKPP-A 217

Query: 240 RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDE 299
           RK WYYVK+RPGLKEFF  V+P FEMHIYTMATR+YA +IAKI+DPTGELFGDRILSRDE
Sbjct: 218 RKSWYYVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDE 277

Query: 300 NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS 359
           NGSLTTKSL +LFP DQSMVVVIDDRGDVWNW  NLIKVVPY+FFVG+GDINSNFLP+Q 
Sbjct: 278 NGSLTTKSLERLFPMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQ 337

Query: 360 TGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNH-QLATAEEPSAN 418
             +L LGR  R+K QE ++LI+DI+DNEKKL+EKID EVKRQEE ++H       +    
Sbjct: 338 NSVLHLGRHHRRK-QEEEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGP 396

Query: 419 ESKEELTKKLEYSASLEVQQQNRPXXXXXXXXXXXXXXVDDDDELHYLMSTLLNIHKTYY 478
            +KE+++KKLE+SASLEVQQQNRP              +DDDDEL +L   LL +HK Y+
Sbjct: 397 PNKEDISKKLEHSASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYF 456

Query: 479 QMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTS 538
              ++  +  P++  ++P +K KVFQ C+FVFSGLIPL TD++++DIV+WT  FGAT++S
Sbjct: 457 NQYTEAPKNPPDIKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSS 516

Query: 539 DINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDSPI 598
           DINY TTH+IT    T+KARLAK FNP+IK+VHPDW+FECLV W++V E PY L++  P+
Sbjct: 517 DINYKTTHIITTTSRTFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPV 576

Query: 599 SDDELQSF 606
            +D+++ F
Sbjct: 577 DEDKVKEF 584

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 63/159 (39%), Gaps = 35/159 (22%)

Query: 137 FDGVPLDVVGDMDLQISETEAIRTGRALKEHLRRDKKLILVVDLDQTIIHCGVDPTIAEW 196
            DG  +D+      Q+S T    T  A KE  R  +K  L++DLD+T++H          
Sbjct: 288 IDGNLIDLSKLQANQVSAT-GYETLLAPKEIKRFGRKKCLILDLDETLVHSSF------- 339

Query: 197 KNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPPPVRKCWYYVKVRPGLKEFF 256
                            +    + V+P+    +   V           YV  RPG+ EF 
Sbjct: 340 ----------------KYVDSADFVIPVTIDNQTHHV-----------YVIKRPGVDEFL 372

Query: 257 AKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRIL 295
            +V+ L+E+ ++T +   Y   +  I+DP   +   R+ 
Sbjct: 373 KRVSELYEVVVFTASVSRYGDPLLNILDPANTIIHHRLF 411

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 58/131 (44%), Gaps = 38/131 (29%)

Query: 169 RRDKKLI----LVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPL 224
           + +KKLI    LV+DLD+T++H                  F+ L+         + VLP+
Sbjct: 294 KTEKKLIGKKCLVLDLDETLVHSS----------------FKYLQTA-------DFVLPV 330

Query: 225 MYMAEDGSVPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 284
               +  +V           YV  RPG++EF  +V  LFE+ ++T +   Y   +  I+D
Sbjct: 331 NIDEQIHNV-----------YVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILD 379

Query: 285 PTGELFGDRIL 295
           P  +L   R+ 
Sbjct: 380 PGRQLIHHRLF 390

>KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.94
           YHR154W
          Length = 951

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 516 LGTDIQRSDIVIWTS---TFGATSTSDINYLTTHLITKNPGTYKARLAKK-FNPEIKVVH 571
           L    + S+ +++T    + G T   +IN  TTH+IT NP      + K+     IK ++
Sbjct: 133 LKPSFEASEYLLYTELIHSMGGTCVENINNKTTHIITTNPKESCFEILKRNGTTSIKYIY 192

Query: 572 PDWIFECLVNWKKVDEKPYTLIVDSPISDD 601
           P W+  C+   + +DE  + ++   P +DD
Sbjct: 193 PTWLIHCVKESQLIDESEHEIV---PFTDD 219

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 59/140 (42%), Gaps = 34/140 (24%)

Query: 156 EAIRTGRALKEHLRRDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFT 215
           +  +T  + K+ ++   K  LV+DLD+T++H       + +K  PN              
Sbjct: 326 DGYKTLLSPKDEIKFKHKKCLVLDLDETLVH-------SSFKYLPN-------------- 364

Query: 216 LDEELVLPLMYMAEDGSVPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAY 275
              +  LP+    +  +V           YV  RPG+ EF  KV  LFE+ I+T +   Y
Sbjct: 365 --ADFNLPVNIDDQIHNV-----------YVIKRPGVDEFLEKVGKLFEVVIFTASVSRY 411

Query: 276 ALQIAKIVDPTGELFGDRIL 295
              +   +DP G+    R+ 
Sbjct: 412 GDPLLDRLDPKGKSIHHRLF 431

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 56/132 (42%), Gaps = 38/132 (28%)

Query: 173 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGS 232
           K  LV+DLD+T++H                 +F+ LR         + V+P+    +  +
Sbjct: 229 KKCLVLDLDETLVHS----------------SFKYLRTA-------DFVIPVEIDDQVHN 265

Query: 233 VPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTG----E 288
           V           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+DP G     
Sbjct: 266 V-----------YVIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAVHHR 314

Query: 289 LFGDRILSRDEN 300
           LF D   + D N
Sbjct: 315 LFRDSCYNYDGN 326

>Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932
           aa] {ON} (148944..151325,151327..151743) [2799 nt, 933
           aa]
          Length = 932

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 48/87 (55%), Gaps = 7/87 (8%)

Query: 518 TDIQRSDIVIWT---STFGATSTSDINYLTTHLITKNPG--TYKARLAKKFNPEIKVVHP 572
           T   R++ ++++   +  G + +  I+  TTHLI+ +P      A +A   +  IK V+P
Sbjct: 133 TVFNRTENILYSELINALGGSVSDMISNKTTHLISSDPTDPALIAIVASDCHSRIKQVYP 192

Query: 573 DWIFECLVNWKKVDEKPYTLIVDSPIS 599
            W+ +C +  K VDEK +  I+DS +S
Sbjct: 193 AWLCQCFLEVKYVDEKNF--ILDSSLS 217

 Score = 32.3 bits (72), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 52/118 (44%), Gaps = 5/118 (4%)

Query: 470 LLNIHKTYYQMLSQPGEIEP-NLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIW 528
           L NI   +Y M S    I+P + + +IP  K+K+F       +     G   QR  I   
Sbjct: 313 LGNIAWIFY-MWSVNQFIDPCSKLTLIP-YKRKMFDKNQLTLTFTNYFGQ--QRYYIQQL 368

Query: 529 TSTFGATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVD 586
           T   G TST++++   THL+   P   K   A K+     VV+  W+  C     K+D
Sbjct: 369 TRFLGGTSTTELSKKNTHLLFGFPYGKKYETALKWTDNCSVVNHRWLENCYEKGSKLD 426

>TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5.94
           YHR154W
          Length = 1015

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 10/106 (9%)

Query: 502 VFQNCYFVFSGLIPLGTDIQRSDIVIWT---STFGATSTSDINYLTTHLITKNPG--TYK 556
           +F+N Y +F  L        +++++ ++   +  G T+   I+ LTTHLIT +P      
Sbjct: 119 IFKN-YQIFLSL----NSFNKTEVLFYSELINALGGTTVDHISTLTTHLITNDPTDQAVI 173

Query: 557 ARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDSPISDDE 602
           A +A +    I  V+P W+ +C  +   V+E  + + + S   D +
Sbjct: 174 ATIASEQKQNISFVYPTWLCQCFKSMTLVNESDHLINIQSSAEDSK 219

 Score = 32.0 bits (71), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 4/90 (4%)

Query: 498 LKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDINYLTTHLITKNPGTYKA 557
            K+K+F+    + +     G   QR  I   T   G  +++D++   THLI  +P   K 
Sbjct: 337 FKKKIFERSQLILAYTNYFGP--QRYYIQRLTRLMGGIASTDLSKKNTHLIFGSPHGKKY 394

Query: 558 RLAKKFNPEIKVV-HPDWIFECLVNWKKVD 586
             A +  P I V  +  W+ +C ++ +K+D
Sbjct: 395 DFAMR-RPNILVTTNHSWLEDCYISGEKLD 423

>Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}
           similar to Ashbya gossypii ADL145C
          Length = 880

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 51/112 (45%), Gaps = 11/112 (9%)

Query: 499 KQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDINYLTT---HLITKNPGTY 555
           K    ++CY   S           ++  ++TS         ++YL+T   H+IT +P   
Sbjct: 115 KTHFMKDCYVYVSS-----QQFSAAEYELYTSMLTYMGGCCMDYLSTKVTHIITSDPKDQ 169

Query: 556 KARLAKKFNP-EIKVVHPDWIFECLVNWKKVDEKPYTLIVDSPISDDELQSF 606
              + K+FN  E+  V   W+ EC V  + V E  Y  +V S +S++E+ + 
Sbjct: 170 AVLVLKRFNKFEVLTVSSAWLAECFVRQEYVSEAAY--LVGSEMSNEEVTAL 219

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query: 245 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGEL 289
           YV  RPG+ EF ++V  L+E+ ++T +   YA  +   +DP G +
Sbjct: 260 YVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTI 304

>NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5.94
           YHR154W
          Length = 1034

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 45/96 (46%), Gaps = 8/96 (8%)

Query: 503 FQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDINYLTTHLIT---KNPGTYKARL 559
           FQ C   +S  +     I  S+++   ++ G T T  IN  TTHLI     +P     + 
Sbjct: 136 FQICISTYS--MKFSEYIFYSELI---NSLGGTITHVINNKTTHLIAIAIDDPAIIAIKE 190

Query: 560 AKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVD 595
             + N  IK V+P W+ +C    K +DE P+ +  D
Sbjct: 191 KGQNNTIIKSVYPTWLVQCFKERKYIDESPHLITED 226

 Score = 40.4 bits (93), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 2/99 (2%)

Query: 477 YYQMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATS 536
           ++ M S    + PN   +    K+K+F++   + +     G   QRS I   T   G  S
Sbjct: 331 FFHMWSICEFVPPNTNLLFEPFKKKIFKSSELILTYTNYFGR--QRSYIQRLTEMLGGIS 388

Query: 537 TSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWI 575
           T++++   THL+++ P   K   AKK+    +V++  W+
Sbjct: 389 TTELSKRNTHLVSRMPVGKKFFQAKKWKDRCQVINHLWL 427

>Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON}
           (138268..141444) [3177 nt, 1059 aa]
          Length = 1058

 Score = 40.8 bits (94), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 39/70 (55%)

Query: 521 QRSDIVIWTSTFGATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLV 580
           QR+ I   T+  G  +T+ ++++   L+   P   K + A+K+  ++ +V P+W+ EC  
Sbjct: 360 QRTYIKTLTNALGGVTTATLSHINNCLVYGIPEGMKYKTAEKWGDKLIIVGPNWLEECYK 419

Query: 581 NWKKVDEKPY 590
             KK+D K +
Sbjct: 420 ANKKLDPKLF 429

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query: 245 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGEL 289
           YV  RPG+ EF  +V+ L+E+ ++T +   YA  +   +DP G +
Sbjct: 265 YVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTI 309

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 48/94 (51%), Gaps = 7/94 (7%)

Query: 245 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDE----N 300
           YV  RPG+  F    + LFE+ I+T +   Y   +  I+D T +L   R+  RD     N
Sbjct: 217 YVIKRPGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILDSTNDLVHHRLF-RDACYNYN 275

Query: 301 GSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPN 334
           G+   K+LA+L     S ++++D+    + + PN
Sbjct: 276 GNY-IKNLAQL-GRPLSDIIILDNSPTSYLFHPN 307

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 48/112 (42%), Gaps = 34/112 (30%)

Query: 173 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGS 232
           K  LV+DLD+T++H                 +F+ L+         + VLP+    +  +
Sbjct: 312 KKCLVLDLDETLVHS----------------SFKYLKGA-------DFVLPVDIDDQIHN 348

Query: 233 VPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 284
           V           YV  RPG+ EF  KV  LFE+ I+T +   Y   +  I+D
Sbjct: 349 V-----------YVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILD 389

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 53/127 (41%), Gaps = 34/127 (26%)

Query: 170 RDK-KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMA 228
           +DK K  L++DLD+T++H              NNP+F               +LP+    
Sbjct: 308 KDKHKKCLILDLDETLVHSSFKFI--------NNPDF---------------ILPIE--I 342

Query: 229 EDGSVPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGE 288
           EDG +           YV  RPG+  F  +V   +E+ I+T +   YA  +  ++D    
Sbjct: 343 EDGQIHN--------VYVIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHN 394

Query: 289 LFGDRIL 295
           L   R+ 
Sbjct: 395 LINHRLF 401

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 38.5 bits (88), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 51/115 (44%), Gaps = 35/115 (30%)

Query: 170 RDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAE 229
           +DKK  L++DLD+T++H                  F+ LR         + VLP+    +
Sbjct: 243 KDKKC-LILDLDETLVHSS----------------FKYLRSA-------DFVLPVEIDDQ 278

Query: 230 DGSVPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 284
             +V           YV  RPG++EF  +V  LFE+ ++T +   Y   +  I+D
Sbjct: 279 VHNV-----------YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 322

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 38.5 bits (88), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%)

Query: 245 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGEL 289
           YV  RPG+ EF  +V+ ++E+ ++T +   YA  +   +DP G +
Sbjct: 260 YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTI 304

>SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 879

 Score = 38.5 bits (88), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 51/109 (46%), Gaps = 2/109 (1%)

Query: 478 YQMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATST 537
           + M S    I P+   ++  L+ K+F     + S    LG   QR  I       G  ST
Sbjct: 316 FFMWSMQEFISPSSKLLLSPLRPKIFHKNELLLSYTNYLGQ--QRFYIQKLVEALGGAST 373

Query: 538 SDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVD 586
           ++++   TH+++  P   K + A +++   KVV+  W+ EC    KK+D
Sbjct: 374 TELSKKNTHVLSCMPYGQKYQAAVRWSDTCKVVNHLWLEECYKFAKKLD 422

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 54/123 (43%), Gaps = 35/123 (28%)

Query: 173 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGS 232
           K  L++DLD+T++H                 +F+ LR         + VLP+    +  +
Sbjct: 245 KKCLILDLDETLVHS----------------SFKYLRSA-------DFVLPVEIDDQVHN 281

Query: 233 VPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGD 292
           V           YV  RPG++EF  +V  LFE+ ++T +   Y   +  I+D T ++   
Sbjct: 282 V-----------YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD-TNKVIHH 329

Query: 293 RIL 295
           R+ 
Sbjct: 330 RLF 332

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 49/112 (43%), Gaps = 34/112 (30%)

Query: 173 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGS 232
           K  L++DLD+T++H                 +F+ LR         + VLP+    +  +
Sbjct: 244 KKCLILDLDETLVHS----------------SFKYLRSA-------DFVLPVEIDDQVHN 280

Query: 233 VPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 284
           V           YV  RPG++EF  +V  LFE+ ++T +   Y   +  I+D
Sbjct: 281 V-----------YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 321

>Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar to
           Ashbya gossypii ADR369C
          Length = 873

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 45/102 (44%), Gaps = 16/102 (15%)

Query: 500 QKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDINYLT-----THLITKNPGT 554
           ++VF+ C    +G      +  R +IV+    F       + YLT     TH++ +N   
Sbjct: 88  RRVFEGCKVYINGRTDPDREQLRKEIVLHGGQF-------VQYLTKKSDVTHIVAQNLSA 140

Query: 555 YKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDS 596
            K    + F    KVV P WI  C+   K +  + Y++IV S
Sbjct: 141 AKCIEFRNF----KVVQPGWIGACVRIGKMLSWREYSVIVRS 178

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%)

Query: 245 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPT 286
           YV  RPG+ EF  +V+ L+E+ ++T +   YA  +   +DP 
Sbjct: 253 YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPN 294

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 245 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGEL 289
           YV  RPG+ EF  +VA L+E+ ++T +   Y   +  I+D +  +
Sbjct: 259 YVIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSSNSI 303

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%)

Query: 245 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP 285
           YV  RPG+ EF   V  L+E+ ++T +   Y   +  I+DP
Sbjct: 320 YVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDP 360

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 47/112 (41%), Gaps = 34/112 (30%)

Query: 173 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGS 232
           K  LV+DLD+T++H                  F+ LR         + VLP+    +  +
Sbjct: 240 KKCLVLDLDETLVHSS----------------FKYLRTA-------DFVLPVNIDDQVHN 276

Query: 233 VPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 284
           V           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D
Sbjct: 277 V-----------YVIKRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILD 317

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 49/118 (41%), Gaps = 34/118 (28%)

Query: 172 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDG 231
            K  LV+DLD+T++H                  F+ +R         + VLP+    +  
Sbjct: 227 NKKCLVLDLDETLVHSS----------------FKYVRTA-------DFVLPVEIEDQIH 263

Query: 232 SVPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGEL 289
           +V           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D +  +
Sbjct: 264 NV-----------YVIKRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILDQSNSV 310

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 48/112 (42%), Gaps = 34/112 (30%)

Query: 173 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGS 232
           K  LV+DLD+T++H                 +F+ LR         + VLP+    +  +
Sbjct: 283 KKCLVLDLDETLVHS----------------SFKYLRTA-------DFVLPVDIDDQIHN 319

Query: 233 VPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 284
           V           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D
Sbjct: 320 V-----------YVIKRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILD 360

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 52/127 (40%), Gaps = 35/127 (27%)

Query: 163 ALKEHLRRDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVL 222
           A K+ + ++KK  LV+DLD+T++H                           +    + VL
Sbjct: 298 AKKDPVFKNKKC-LVLDLDETLVHSSF-----------------------KYIDTADFVL 333

Query: 223 PLMYMAEDGSVPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKI 282
           P+    +   V           YV  RPG+ EF  +V  +FE+ ++T +   Y   +  I
Sbjct: 334 PVTIDDQTHQV-----------YVIKRPGVDEFLKRVGKIFEVVVFTASVSRYGDPLLDI 382

Query: 283 VDPTGEL 289
           +D +  +
Sbjct: 383 LDSSKSI 389

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%)

Query: 245 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 284
           YV  RPG++EF  +V  LFE+ ++T +   Y   +  I+D
Sbjct: 295 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 334

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 59/127 (46%), Gaps = 11/127 (8%)

Query: 222 LPLMYMAEDGSVPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAK 281
           L L+   ED  V      +  W   K RPG   F   ++  FE+ +++     Y+ +IA+
Sbjct: 197 LTLVITLEDFLVHSEWSQKYGWRTAK-RPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAE 255

Query: 282 IVDP-----TGELFGDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NL 335
            +DP     +  LF +  + +D    +  K L+KL   D S V++ID   + +   P N 
Sbjct: 256 KLDPIHAFVSYNLFKEHCVYKD---GVHIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENA 311

Query: 336 IKVVPYN 342
           I + P+N
Sbjct: 312 IPMEPWN 318

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 48/113 (42%), Gaps = 34/113 (30%)

Query: 172 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDG 231
           +K  LV+DLD+T++H                  F+ L+         + VLP+    +  
Sbjct: 312 RKKCLVLDLDETLVHSS----------------FKYLKSA-------DFVLPVDIDDQIH 348

Query: 232 SVPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 284
           +V           YV  RPG+ EF  +V  +FE+ ++T +   Y   +  ++D
Sbjct: 349 NV-----------YVIKRPGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLD 390

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 245 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 284
           YV  RPG+ EF  +V  LFE+ ++T +   Y   +  I+D
Sbjct: 346 YVIKRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILD 385

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 48/112 (42%), Gaps = 22/112 (19%)

Query: 168 LRRDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMY- 226
           L+ +K+  L++DLD+T+IH                      R++ S T+    ++ + + 
Sbjct: 187 LKTNKRKKLILDLDETLIHSMS-------------------RNISSSTISNYHLIEVKFP 227

Query: 227 --MAEDGSVPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYA 276
              +   S P P       YYV  RP    F   V+  +++ I+T + + YA
Sbjct: 228 TPTSAPTSAPGPSLPLSSLYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYA 279

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 249 RPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP-----TGELFGDRILSRDENGSL 303
           RPG   F   ++  FE+ +++     Y+ +IA+ +DP     +  LF +  + +D    +
Sbjct: 218 RPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 274

Query: 304 TTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 342
             K L+KL   D S V++ID   + +   P N I + P+N
Sbjct: 275 HIKDLSKL-NRDLSKVIIIDTEPNSYKLQPENAIPMDPWN 313

>Smik_8.238 Chr8 (379729..382956) [3228 bp, 1075 aa] {ON} YHR154W
           (REAL)
          Length = 1075

 Score = 35.0 bits (79), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 37/72 (51%), Gaps = 4/72 (5%)

Query: 521 QRSDIVIWTSTFGATSTSDINYLTTHLITKNPGTYKARLAKKFNPE----IKVVHPDWIF 576
           QR  I       G  ST ++    THLITKN    K ++AKK++ +    I V +  W+ 
Sbjct: 391 QRFYIQRLVEILGGLSTPELTRKNTHLITKNAIGKKFKVAKKWSLDPQNAIIVTNHLWLE 450

Query: 577 ECLVNWKKVDEK 588
           EC +N  K++ K
Sbjct: 451 ECYMNNSKLNPK 462

>KNAG0E00570 Chr5 (95945..98890) [2946 bp, 981 aa] {ON} Anc_5.94
           YHR154W
          Length = 981

 Score = 35.0 bits (79), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 47/102 (46%), Gaps = 3/102 (2%)

Query: 478 YQMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATST 537
           + M S      P+   I   LKQ V ++   + S     G  +QRS I   T   G  ST
Sbjct: 324 FNMWSLDSFTLPSSKIIWGPLKQSVVRSDELILSFTNYFG--LQRSYIQRITERLGGVST 381

Query: 538 SDINYLTTHLITKNPGTYKARLAKKFNPE-IKVVHPDWIFEC 578
           + +    THL+++     K  LAK++  +  +VV+  W+ EC
Sbjct: 382 TSLTKRNTHLVSRMAIGKKFELAKQWGGQRCRVVNHLWLEEC 423

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 34.7 bits (78), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 25/45 (55%)

Query: 245 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGEL 289
           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  ++D +  +
Sbjct: 315 YVIKRPGVDEFLQRVGELYEVVVFTASVSRYGDPLLDVLDKSNNI 359

>ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR346W
           (REV1)
          Length = 827

 Score = 34.7 bits (78), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 42/97 (43%), Gaps = 16/97 (16%)

Query: 499 KQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDINYLT-----THLITKNPG 553
           +  +F+ C    +G      +  R +IV+   TF       ++YL      TH++ ++  
Sbjct: 40  RTPIFRGCRVHVNGHTDPDREELRREIVMHGGTF-------VHYLARPSDVTHIVAEHVP 92

Query: 554 TYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPY 590
             K RL        KVV P W+  CL + + V  KPY
Sbjct: 93  VAKRRLWH----ACKVVRPAWVSACLCSGELVPWKPY 125

>Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}
           similar to Ashbya gossypii AGL051C
          Length = 593

 Score = 34.7 bits (78), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%)

Query: 544 TTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDS 596
           TTH +  +  +    LA+  N  I VV P+WI  C +  + V  + + L VDS
Sbjct: 211 TTHFVCNDAQSDDKELARAKNGNIPVVRPEWIRACELEKRIVGVRGFYLDVDS 263

>ADL145C Chr4 complement(435983..438610) [2628 bp, 875 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR154W
           (ESC4)
          Length = 875

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 48/109 (44%), Gaps = 3/109 (2%)

Query: 478 YQMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATST 537
           + MLS    I P    ++     K+F     V +    LG   QR  I       G +ST
Sbjct: 313 FYMLSMQQFIAPTAKLVLSPRYPKLFTEKELVLAFTNYLGQ--QRYYIQRLVDLLGGSST 370

Query: 538 SDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVD 586
           ++++   THLI+  P   K   A K+N  I V H  W+ +C    KK+D
Sbjct: 371 TELSRKNTHLISLFPHGKKHETALKWNSCIVVNHL-WLEQCYKLRKKLD 418

>KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa]
           {ON} Anc_4.156 YLR330W
          Length = 555

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 25/55 (45%)

Query: 544 TTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDSPI 598
           TTH I  +     A L +  N  I +V P+WI  C V  + V  + + L  D  I
Sbjct: 212 TTHFICNDEEEEDAELIRAKNSNIPIVRPEWIRACAVEKRIVGVRGFYLDADKSI 266

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 63/149 (42%), Gaps = 40/149 (26%)

Query: 138 DGVPLDVVGDMDLQISETEAIRTGRAL--KEHLRRDKKLILVVDLDQTIIHCGVDPTIAE 195
           DG PLD+     LQ  +  A      L  K  + + KK  LV+DLD+T++H         
Sbjct: 211 DGEPLDL---SQLQPDQAHAPGCNTLLLPKADMFKGKK-CLVLDLDETLVHS-------- 258

Query: 196 WKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPPPVRKCWYYVKVRPGLKEF 255
                   +F+ LR         + V+P+    +  +V           YV  RPG+ EF
Sbjct: 259 --------SFKYLRTA-------DFVIPVEIDNQVHNV-----------YVIKRPGVDEF 292

Query: 256 FAKVAPLFEMHIYTMATRAYALQIAKIVD 284
             ++  L+E+ ++T +   Y   +  I+D
Sbjct: 293 LRRITELYEVVVFTASVSRYGDPLLDILD 321

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 54/132 (40%), Gaps = 38/132 (28%)

Query: 173 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGS 232
           K  LV+DLD+T++H                 +F+ LR         + V+P+    +  +
Sbjct: 240 KKCLVLDLDETLVHS----------------SFKFLRTA-------DFVIPVEIDNQIHN 276

Query: 233 VPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPT----GE 288
           V           YV  RPG+ EF   V  L+E+ ++T +   Y   +  ++D T      
Sbjct: 277 V-----------YVIKRPGVDEFLKLVGQLYEVVVFTASVSRYGDPLLDVLDQTQCIHHR 325

Query: 289 LFGDRILSRDEN 300
           LF D   + D N
Sbjct: 326 LFRDSCYNYDGN 337

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 245 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 284
           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D
Sbjct: 360 YVIKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILD 399

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 245 YVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVD 284
           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D
Sbjct: 349 YVIKRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILD 388

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 52/106 (49%), Gaps = 11/106 (10%)

Query: 243 WYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP-----TGELFGDRILSR 297
           W   K RPG+  F   ++  +E+ +++     YA +IA+ +DP     T  LF +  L +
Sbjct: 216 WRTAK-RPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDPIHAFITYNLFKEHCLYK 274

Query: 298 DENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 342
           D    +  K L+KL   D   V++ID   + +   P N I + P++
Sbjct: 275 D---GVHIKDLSKL-NRDLGKVLIIDTDENSFKLQPENAIYLEPWD 316

>SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]
           {ON} some similarities with uniprot|Q12114 Saccharomyces
           cerevisiae YLR330W CHS5 Protein of unknown function
           involved in chitin biosynthesis by regulating Chs3p
           localization also involved in cell fusion during mating
          Length = 508

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 1/77 (1%)

Query: 520 IQRSDIVIWTSTFGATSTSD-INYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFEC 578
           + ++ I    S  GA +  D +   TTH I     +    L K  N  I VV P+W+  C
Sbjct: 186 VTKNQIETSLSNIGAKALQDHVGLDTTHFICNEKDSEDPELEKAQNSNIPVVRPEWVRAC 245

Query: 579 LVNWKKVDEKPYTLIVD 595
            +  + V  + + L  D
Sbjct: 246 ELERRIVGVRGFYLDAD 262

>KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.269
           YDR117C
          Length = 561

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 204 NFETLRDVKSFTL-DEELVLPLMYMAEDGSVPKPPPVRKCWYYVKVRPGLKEFFAKVAPL 262
           NF++   V +  L DE++ +PL +  + GS P  P V  CW +    PGL       + +
Sbjct: 46  NFQSTTSVGTIYLNDEKIPVPLFFKEKHGSGPLWPSVYACWSH----PGLLPIILTHSVV 101

Query: 263 FEMHIYTMA 271
            E H++  A
Sbjct: 102 IEDHLFNGA 110

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 58/125 (46%), Gaps = 11/125 (8%)

Query: 224 LMYMAEDGSVPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIV 283
           L+   ED  V      +  W   K RPG   F   ++  +E+ +++     Y+ +IA+ +
Sbjct: 194 LVITLEDFLVHSEWSQKHGWRTAK-RPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKL 252

Query: 284 DP-----TGELFGDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIK 337
           DP     +  LF +  + +D    +  K L+KL   D S V++ID   + +   P N I 
Sbjct: 253 DPIHAFVSYNLFKEHCVYKD---GVHIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIP 308

Query: 338 VVPYN 342
           + P+N
Sbjct: 309 MEPWN 313

>Smik_12.335 Chr12 (603893..605929) [2037 bp, 678 aa] {ON} YLR260W
           (REAL)
          Length = 678

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 51/119 (42%), Gaps = 9/119 (7%)

Query: 124 LCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGRALKEHL-----RRDKKLILVV 178
           L +QC  EV    + G  +++  +MD+   +T A  +G  +   +     RR   +    
Sbjct: 288 LASQCSIEVVYTKYPGHAIEIAREMDIDQYDTIACASGDGIPHEVINGLYRRPDHVKAFN 347

Query: 179 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPP 237
            L  T I CG    ++   +  NNP++ TL  +KS     E  + LM  ++     K P
Sbjct: 348 KLAITEIPCGSGNAMSVSCHWTNNPSYSTLCLIKSI----ETKIDLMCCSQPSYAKKHP 402

>Skud_12.340 Chr12 (606790..608832) [2043 bp, 680 aa] {ON} YLR260W
           (REAL)
          Length = 680

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 5/95 (5%)

Query: 124 LCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGRALKEHL-----RRDKKLILVV 178
           L ++C  EV    + G  +++  +MD+   +T A  +G  +   +     RR  ++    
Sbjct: 288 LASRCSIEVVYTKYPGHAIEIAREMDIDKYDTIACASGDGIPHEVINGLYRRPDRVKAFN 347

Query: 179 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKS 213
            L  T I CG    ++   +  NNP++ TL  +KS
Sbjct: 348 QLAITEIPCGSGNAMSVSCHWTNNPSYSTLCLIKS 382

>NCAS0D01510 Chr4 complement(282977..285679) [2703 bp, 900 aa] {ON}
           Anc_5.94 YHR154W
          Length = 900

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 43/90 (47%), Gaps = 4/90 (4%)

Query: 503 FQNCYFVFSGLIPLGTDI---QRSDIVIWTSTFGATSTSDINYLTTHLITKNPGTYKARL 559
           FQ   F  + L P  T+    QRS I       G  ST++ +   THLI+++    K + 
Sbjct: 343 FQPVIFKRNELRPAYTNYFGRQRSYIQRLVELLGGVSTTEFSKRNTHLISRSNVGKKFKT 402

Query: 560 AKKFN-PEIKVVHPDWIFECLVNWKKVDEK 588
           A K+    + VV+  W+ EC    KK+D K
Sbjct: 403 AMKWGESSVIVVNHLWLEECYKLNKKLDPK 432

>NCAS0J00880 Chr10 complement(146472..148172) [1701 bp, 566 aa] {ON}
           Anc_4.156 YLR330W
          Length = 566

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 3/61 (4%)

Query: 544 TTHLITK---NPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDSPISD 600
           TTH +     + G     L K  N  I +V P+WI  C V  + V  + + +  +S +SD
Sbjct: 212 TTHFVCNELDDNGEEDEELQKAKNNNIPIVKPEWIRACCVEKRIVGVRAFYVGAESTVSD 271

Query: 601 D 601
           D
Sbjct: 272 D 272

>SAKL0B06864g Chr2 (591422..595669) [4248 bp, 1415 aa] {ON} similar to
            uniprot|P38198 Saccharomyces cerevisiae YBL034C STU1
            Component of the mitotic spindle that binds to interpolar
            microtubules via its association with beta- tubulin
            (Tub2p) required for interpolar microtubules to provide
            an outward force on the spindle poles
          Length = 1415

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%)

Query: 464  HYLMSTLLNIHKTYYQMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSG 512
            HYL++ L N+     ++    GE    L++ IPS  + +F+NC  + SG
Sbjct: 1269 HYLITLLGNLCGYSNELFIACGEFRDVLIDCIPSYFKNLFENCIKLLSG 1317

>CAGL0I01958g Chr9 (162266..165565) [3300 bp, 1099 aa] {ON} weakly
           similar to uniprot|P38850 Saccharomyces cerevisiae
           YHR154w ESC4 Establishes Silent Chromatin
          Length = 1099

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 63/161 (39%), Gaps = 24/161 (14%)

Query: 495 IPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDINYLTTHLITKNPGT 554
           +P  ++K+F+      +     G   QR+ +       G ++T +++   THLI   P  
Sbjct: 363 LPRRRRKLFRKQDLAVTYTNYFGE--QRTYLQQLIELLGGSATMELSKQNTHLICNLPFG 420

Query: 555 YKARLAKKF---NPEIKVVHPDWIFECLVNWKKV-----------DEKPYTLI------- 593
            K  +A K+     +I +    W+ EC ++ KKV           D+  Y+L        
Sbjct: 421 KKYEVAMKWKESGSKIVICSHRWLEECYISGKKVPVDEAYTRLERDDNTYSLTLGQQLSP 480

Query: 594 -VDSPISDDELQSFXXXXXXXXEYLDEHHEQQHMLMPQENI 633
            +DS  S DE            EYL     + H L   ++I
Sbjct: 481 KLDSENSSDEETDIEESQVFALEYLKTSQSRAHDLTGLDDI 521

>KLTH0C01584g Chr3 complement(139563..142304) [2742 bp, 913 aa] {ON}
           some similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 913

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 47/113 (41%), Gaps = 5/113 (4%)

Query: 478 YQMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATST 537
           + M S    + P    ++  L+  VF     + S    LG   QR  I       G  ST
Sbjct: 316 FHMWSLQSFVLPQFKLLLSPLRPPVFNKGQLILSYTNYLGQ--QRYYIQKLVEALGGVST 373

Query: 538 SDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPY 590
           +++    THL+T  P   K   A ++    K+ +  W+ +C   ++K  + P+
Sbjct: 374 TELTKKNTHLLTCLPLGQKYEAALRWEGTCKIANHLWLEDC---YRKQTQVPF 423

>CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063w
          Length = 485

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 58/127 (45%), Gaps = 11/127 (8%)

Query: 222 LPLMYMAEDGSVPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAK 281
           L L+   ED  V      +  W   K RPG   F   ++  +E+ +++     YA +IA+
Sbjct: 198 LTLVITLEDFLVHSEWDQKHGWRTAK-RPGADYFLGYLSQYYEIVLFSSNYMMYAEKIAE 256

Query: 282 IVDP-----TGELFGDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NL 335
            +DP     +  LF +  + +D    +  K L+KL   D   V++ID   + +   P N 
Sbjct: 257 KMDPIHAFISYNLFKEHCVYKD---GVHIKDLSKL-NRDLKKVMIIDTDENSYKLQPENA 312

Query: 336 IKVVPYN 342
           I + P++
Sbjct: 313 IPMDPWD 319

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 11/106 (10%)

Query: 243 WYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP-----TGELFGDRILSR 297
           W   K RPG + F   ++  +E+ +++     Y+ + A+ +DP     +  LF +  + +
Sbjct: 216 WRTAK-RPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLDPIHAFVSYNLFKEHCVYK 274

Query: 298 DENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 342
           D    +  K L+KL   D S V++ID   + +   P N I + P+N
Sbjct: 275 D---GVHIKDLSKL-KRDLSKVIIIDTDPNSYKLQPENAIPMDPWN 316

>KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]
           {ON} some similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 891

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 530 STFGATSTSDINYLTTHLITKNPGTYKARLAKKFNP-EIKVVHPDWIFECLVNWKKVDEK 588
           S FG T    ++   TH+IT +      +  +KF+   +  + P+W+ +CL   + + E 
Sbjct: 147 SVFGGTCMDYLSTKATHIITWDKNDVAIKAMQKFHKYTVIYLMPNWLVDCLCGLEYIKED 206

Query: 589 PYTLIVD 595
            Y + V+
Sbjct: 207 EYLINVN 213

>NDAI0I02370 Chr9 (540379..542661) [2283 bp, 760 aa] {ON} Anc_6.48
           YLR260W
          Length = 760

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 5/95 (5%)

Query: 124 LCTQCGKEVSADAFDGVPLDVVGDMDLQISETEAIRTGRALKEHL-----RRDKKLILVV 178
           L + C  EV    + G  +++  +MD+   +T A  +G  +   +     RR+ ++    
Sbjct: 380 LASDCFLEVHYTKYVGHAIEIAKEMDIDKFDTIACASGDGIPHEVINGLYRREDRVKAFN 439

Query: 179 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKS 213
            L  T I CG    ++   +  NNP++ TL  +KS
Sbjct: 440 KLTITQIPCGSGNAMSVSCHWTNNPSYATLCLIKS 474

>Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W
           (REAL)
          Length = 985

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 53/123 (43%), Gaps = 13/123 (10%)

Query: 476 TYYQMLSQPGEIEPNLME-----IIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTS 530
           TY+Q  +Q   ++  +++     +I S    +F+NC    +G    G       IV+   
Sbjct: 135 TYFQDKAQGQSVQDQILKNQYKGLISSQNGNLFKNCVIYINGYTKPGRLQLHEMIVLHGG 194

Query: 531 TFGATSTSDINYLTTHLITKN-PGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKP 589
            F    ++      TH++  N P   +   A       KVV+PDWI +C+   + +  + 
Sbjct: 195 KFLHHLSAKKR--VTHIVASNLPLKKRIEFA-----NYKVVNPDWITDCIKERRLLPWQN 247

Query: 590 YTL 592
           Y+L
Sbjct: 248 YSL 250

>YHR154W Chr8 (402966..406178) [3213 bp, 1070 aa] {ON}
           RTT107Protein implicated in Mms22-dependent DNA repair
           during S phase; involved in recruiting the SMC5/6
           complex to double-strand breaks; DNA damage induces
           phosphorylation by Mec1p at one or more SQ/TQ motifs;
           interacts with Mms22p and Slx4p; has four BRCT domains;
           has a role in regulation of Ty1 transposition
          Length = 1070

 Score = 32.0 bits (71), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 4/72 (5%)

Query: 521 QRSDIVIWTSTFGATSTSDINYLTTHLITKNPGTYKARLAKKFNPE----IKVVHPDWIF 576
           QR  I       G  ST ++    THLITK+    K ++AKK++ +    I V +  W+ 
Sbjct: 391 QRFYIQRLVEILGGLSTPELTRKNTHLITKSTIGKKFKVAKKWSLDPQNAIIVTNHMWLE 450

Query: 577 ECLVNWKKVDEK 588
           +C +N  K++ K
Sbjct: 451 QCYMNNSKLNPK 462

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,482,704
Number of extensions: 3048729
Number of successful extensions: 13623
Number of sequences better than 10.0: 167
Number of HSP's gapped: 14065
Number of HSP's successfully gapped: 188
Length of query: 732
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 615
Effective length of database: 40,065,477
Effective search space: 24640268355
Effective search space used: 24640268355
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)