Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_13.4618.831ON93192137310.0
Skud_13.4458.831ON89866218910.0
Smik_13.4868.831ON92367417880.0
YMR273C (ZDS1)8.831ON91564417700.0
KLTH0C04048g8.831ON9355435543e-58
Smik_13.258.831ON9494855393e-56
YML109W (ZDS2)8.831ON9425485384e-56
KNAG0G033708.831ON10761775192e-53
NCAS0B011108.831ON9931815074e-52
Kpol_541.108.831ON10564725004e-51
CAGL0F03421g8.831ON8175284911e-50
TDEL0B006608.831ON9591884862e-49
NDAI0E003508.831ON1163984872e-49
ZYRO0G13992g8.831ON1211994837e-49
KAFR0A027708.831ON884994781e-48
SAKL0D01716g8.831ON9421864772e-48
Kpol_1069.28.831ON1001984603e-46
KAFR0B038608.831ON8431014556e-46
TPHA0I002008.831ON1049984532e-45
KLLA0D01683g8.831ON944954513e-45
AAL185W8.831ON10181004434e-44
Suva_13.358.831ON982994424e-44
Skud_13.328.831ON9481014362e-43
Kwal_27.103188.831ON9251004344e-43
Ecym_27108.831ON8961014317e-43
TPHA0C047208.831ON10721974283e-42
CAGL0J06688g8.831ON828994254e-42
TBLA0B032008.831ON1086994151e-40
TBLA0D031908.831ON1682923946e-38
Skud_14.8singletonON74791757e-15
YOR274W (MOD5)8.725ON42887743.1
TDEL0A020302.427ON21277716.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_13.461
         (931 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_13.461 Chr13 complement(793859..796654) [2796 bp, 931 aa] {...  1441   0.0  
Skud_13.445 Chr13 complement(784651..787347) [2697 bp, 898 aa] {...   733   0.0  
Smik_13.486 Chr13 complement(794245..797016) [2772 bp, 923 aa] {...   693   0.0  
YMR273C Chr13 complement(811233..813980) [2748 bp, 915 aa] {ON} ...   686   0.0  
KLTH0C04048g Chr3 (352955..355762) [2808 bp, 935 aa] {ON} simila...   218   3e-58
Smik_13.25 Chr13 (47889..50738) [2850 bp, 949 aa] {ON} YML109W (...   212   3e-56
YML109W Chr13 (51640..54468) [2829 bp, 942 aa] {ON}  ZDS2Protein...   211   4e-56
KNAG0G03370 Chr7 complement(724041..727271) [3231 bp, 1076 aa] {...   204   2e-53
NCAS0B01110 Chr2 complement(182537..185518) [2982 bp, 993 aa] {O...   199   4e-52
Kpol_541.10 s541 complement(26683..29853) [3171 bp, 1056 aa] {ON...   197   4e-51
CAGL0F03421g Chr6 complement(336157..338610) [2454 bp, 817 aa] {...   193   1e-50
TDEL0B00660 Chr2 (124552..127431) [2880 bp, 959 aa] {ON} Anc_8.8...   191   2e-49
NDAI0E00350 Chr5 (54073..57564) [3492 bp, 1163 aa] {ON} Anc_8.83...   192   2e-49
ZYRO0G13992g Chr7 complement(1112324..1115959) [3636 bp, 1211 aa...   190   7e-49
KAFR0A02770 Chr1 complement(575572..578226) [2655 bp, 884 aa] {O...   188   1e-48
SAKL0D01716g Chr4 (135836..138664) [2829 bp, 942 aa] {ON} simila...   188   2e-48
Kpol_1069.2 s1069 (1560..4565) [3006 bp, 1001 aa] {ON} (1560..45...   181   3e-46
KAFR0B03860 Chr2 complement(798642..801173) [2532 bp, 843 aa] {O...   179   6e-46
TPHA0I00200 Chr9 complement(34713..37862) [3150 bp, 1049 aa] {ON...   179   2e-45
KLLA0D01683g Chr4 complement(148855..151689) [2835 bp, 944 aa] {...   178   3e-45
AAL185W Chr1 (9537..12593) [3057 bp, 1018 aa] {ON} Syntenic homo...   175   4e-44
Suva_13.35 Chr13 (51377..54325) [2949 bp, 982 aa] {ON} YML109W (...   174   4e-44
Skud_13.32 Chr13 (51228..54074) [2847 bp, 948 aa] {ON} YML109W (...   172   2e-43
Kwal_27.10318 s27 (284806..287583) [2778 bp, 925 aa] {ON} YMR273...   171   4e-43
Ecym_2710 Chr2 (1373818..1376508) [2691 bp, 896 aa] {ON} similar...   170   7e-43
TPHA0C04720 Chr3 complement(1017585..1020803) [3219 bp, 1072 aa]...   169   3e-42
CAGL0J06688g Chr10 complement(640041..642527) [2487 bp, 828 aa] ...   168   4e-42
TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {...   164   1e-40
TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {...   156   6e-38
Skud_14.8 Chr14 (9768..9905,9909..9914,9918..9926,9930..9998) [2...    72   7e-15
YOR274W Chr15 (837674..838960) [1287 bp, 428 aa] {ON}  MOD5Delta...    33   3.1  
TDEL0A02030 Chr1 (367215..367853) [639 bp, 212 aa] {ON} Anc_2.42...    32   6.1  

>Suva_13.461 Chr13 complement(793859..796654) [2796 bp, 931 aa] {ON}
           YMR273C (REAL)
          Length = 931

 Score = 1441 bits (3731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 731/921 (79%), Positives = 731/921 (79%)

Query: 1   MSNTINESMLRTTSNNRAAASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID 60
           MSNTINESMLRTTSNNRAAASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID
Sbjct: 1   MSNTINESMLRTTSNNRAAASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID 60

Query: 61  PELDIKFGGESNXXXXXXXXXXXXXXXPNVTRSMNNTRYSDPTPLEKLHVQSSTETESYE 120
           PELDIKFGGESN               PNVTRSMNNTRYSDPTPLEKLHVQSSTETESYE
Sbjct: 61  PELDIKFGGESNGRRSWSGATSSSTSAPNVTRSMNNTRYSDPTPLEKLHVQSSTETESYE 120

Query: 121 RCRQGNYTGHKKVVHSPSRXXXXXXXXXXXXWVPANQHPNVKPDNYLELVQDTLQNIRLX 180
           RCRQGNYTGHKKVVHSPSR            WVPANQHPNVKPDNYLELVQDTLQNIRL 
Sbjct: 121 RCRQGNYTGHKKVVHSPSRKLNANALKNNLLWVPANQHPNVKPDNYLELVQDTLQNIRLG 180

Query: 181 XXXXXXXXXXXXXXXAHGETESYGNKENLNVVNVNRGMPRHGNASLIRRPSTLRRSYTEF 240
                          AHGETESYGNKENLNVVNVNRGMPRHGNASLIRRPSTLRRSYTEF
Sbjct: 181 DNDDDNDNNDNEGDEAHGETESYGNKENLNVVNVNRGMPRHGNASLIRRPSTLRRSYTEF 240

Query: 241 DDSEGDIGQGDDDSMTVNKAKERTSRIRERPISLRDITEELTKISNSAGLTDDDAITLAR 300
           DDSEGDIGQGDDDSMTVNKAKERTSRIRERPISLRDITEELTKISNSAGLTDDDAITLAR
Sbjct: 241 DDSEGDIGQGDDDSMTVNKAKERTSRIRERPISLRDITEELTKISNSAGLTDDDAITLAR 300

Query: 301 TLNMAGSYSDKGDGPRSEDSRVGYEEENAKVTGSQTETPDDVEYASNMPINNDSTGPERS 360
           TLNMAGSYSDKGDGPRSEDSRVGYEEENAKVTGSQTETPDDVEYASNMPINNDSTGPERS
Sbjct: 301 TLNMAGSYSDKGDGPRSEDSRVGYEEENAKVTGSQTETPDDVEYASNMPINNDSTGPERS 360

Query: 361 SLKRSRFNTYRIRSHXXXXXXXXXXXXXXXXDVSRLHLAENTIEIGINSPKSPFRQEDDE 420
           SLKRSRFNTYRIRSH                DVSRLHLAENTIEIGINSPKSPFRQEDDE
Sbjct: 361 SLKRSRFNTYRIRSHTEEQEEEQVLEETKKEDVSRLHLAENTIEIGINSPKSPFRQEDDE 420

Query: 421 SDPVSSPGSIGDFQDIYDHYTQSSGDWEKEMGIEKSKALEGGKVEDNAVEQELEPQEEST 480
           SDPVSSPGSIGDFQDIYDHYTQSSGDWEKEMGIEKSKALEGGKVEDNAVEQELEPQEEST
Sbjct: 421 SDPVSSPGSIGDFQDIYDHYTQSSGDWEKEMGIEKSKALEGGKVEDNAVEQELEPQEEST 480

Query: 481 GTVVSGTTDDSKETKRHRRRNGWTWLNNKMXXXXXXXXXXXXXXXXXXVESQRMERDNSK 540
           GTVVSGTTDDSKETKRHRRRNGWTWLNNKM                  VESQRMERDNSK
Sbjct: 481 GTVVSGTTDDSKETKRHRRRNGWTWLNNKMNKEEDNGENQGDDEGDEDVESQRMERDNSK 540

Query: 541 KHHISIFNGXXXXXXXXXXXXXXXXXXXXXXQTRQKIEKTFANLFRRKPHHKHEASPLPS 600
           KHHISIFNG                      QTRQKIEKTFANLFRRKPHHKHEASPLPS
Sbjct: 541 KHHISIFNGAEKTEASSKEEANNANASTSTSQTRQKIEKTFANLFRRKPHHKHEASPLPS 600

Query: 601 SPAPDNDTAHGPETKLKKLSSKGGREPTEPIVLXXXXXXXXXXXXXXXXXEVSMKGTSDX 660
           SPAPDNDTAHGPETKLKKLSSKGGREPTEPIVL                 EVSMKGTSD 
Sbjct: 601 SPAPDNDTAHGPETKLKKLSSKGGREPTEPIVLHNRPHHHRHHQGRRGSREVSMKGTSDT 660

Query: 661 XXXXXXXXXXXXXXXXHVKGTSETXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 720
                           HVKGTSET                                    
Sbjct: 661 QTQTQTQTQTQTQTQTHVKGTSETQTQTQTQMQMQMQSQPQPQPQSHPQPQKPQPQPLQL 720

Query: 721 XXXGEVSSLEEVANNEESDTESLPKLQPAISVSSTKSNPRDCEEVDAKKKNKEKRSNTGK 780
              GEVSSLEEVANNEESDTESLPKLQPAISVSSTKSNPRDCEEVDAKKKNKEKRSNTGK
Sbjct: 721 QLKGEVSSLEEVANNEESDTESLPKLQPAISVSSTKSNPRDCEEVDAKKKNKEKRSNTGK 780

Query: 781 HAKHVQKEMDHEQRGQXXXXXXXXXXXXXXXXXXLRHTSVLPPRKLTFADVKKSEKPNAP 840
           HAKHVQKEMDHEQRGQ                  LRHTSVLPPRKLTFADVKKSEKPNAP
Sbjct: 781 HAKHVQKEMDHEQRGQAAAAPVAPADPAAPPAPALRHTSVLPPRKLTFADVKKSEKPNAP 840

Query: 841 VQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRLSHLKLSNSKRELREQVLLSNFM 900
           VQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRLSHLKLSNSKRELREQVLLSNFM
Sbjct: 841 VQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRLSHLKLSNSKRELREQVLLSNFM 900

Query: 901 YAYLNLVNHTLYMEQAGHDKE 921
           YAYLNLVNHTLYMEQAGHDKE
Sbjct: 901 YAYLNLVNHTLYMEQAGHDKE 921

>Skud_13.445 Chr13 complement(784651..787347) [2697 bp, 898 aa] {ON}
           YMR273C (REAL)
          Length = 898

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/662 (60%), Positives = 448/662 (67%), Gaps = 5/662 (0%)

Query: 1   MSNTINESMLRTTSNNRAAASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID 60
           MSNTIN+SMLR TSNNR AA QRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID
Sbjct: 1   MSNTINDSMLRATSNNRMAACQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID 60

Query: 61  PELDIKFGGESNXXXXXXXXXXXXXXXPNVTRSMNNTRYSDPTPLEKLHVQSSTETESYE 120
           PELDIKF GESN               PN T  MNNTRYSDPTPLE LH + S+  E+  
Sbjct: 61  PELDIKFCGESNGRRSWSGTTSKPTSAPNGTTGMNNTRYSDPTPLENLHERRSSGIETCA 120

Query: 121 RCRQGNYTGHKKVVHSPSRXXXXXXXXXXXXWVPANQHPNVKPDNYLELVQDTLQNIRL- 179
           + +QG+ TGHK+ VHSPSR            WVPANQHPNVKPDNYLELVQDTLQNIRL 
Sbjct: 121 KNKQGSSTGHKRGVHSPSRKLTANALKKNLLWVPANQHPNVKPDNYLELVQDTLQNIRLG 180

Query: 180 XXXXXXXXXXXXXXXXAHGETESYGNKENLNVVNVNRGMPRHGNASLIRRPSTLRRSYTE 239
                              ETES+GNKEN+N V++NRGM RHGNASLIRRPSTLRRSYTE
Sbjct: 181 DNDDNDDENDKNENNRVTEETESHGNKENMNTVDLNRGMLRHGNASLIRRPSTLRRSYTE 240

Query: 240 FDDSEGDIGQGDDDSMTVNKAKERTSRIRERPISLRDITEELTKISNSAGLTDDDAITLA 299
           FDD E D GQ ++ S TVN+ +ERTSRI+ERP+SLRDITEELTKISNSAGLT++D ITLA
Sbjct: 241 FDDIEDDNGQRNEASKTVNRVEERTSRIKERPVSLRDITEELTKISNSAGLTNNDTITLA 300

Query: 300 RTLNMAGSYSDKGDGPRSEDSRVGYEEENAKVTGSQTETPDDVEYASNMPINNDSTGPER 359
           RTL+MAGSYSD G+    +D +  YE E+  V  SQ +  DD EYASNMP NND TGPER
Sbjct: 301 RTLSMAGSYSDGGNEAGPKDLKDDYEGESIGVASSQRKASDDGEYASNMPTNNDMTGPER 360

Query: 360 SSLKRSRFNTYRIRSHXXXXXXXXXXXXXXXXDVSRLHLAENTIEIGINSPKSPFRQEDD 419
           SSLKRSRFNTYRIRS                 +  RLHL + T++  I SPKSPF QEDD
Sbjct: 361 SSLKRSRFNTYRIRSQEQEKEEEQNVEETKNEEAGRLHLTDKTLKTEIESPKSPFGQEDD 420

Query: 420 ESDPVSSPGSIGDFQDIYDHYTQSSGDWEKEMGIEKSKALEGGKVEDNAVEQELEPQEES 479
           ES+  SSPGS+GDFQDIYDHY Q SGDWE+E GIEK +      + D+ VEQ+LE  EES
Sbjct: 421 ESEYASSPGSVGDFQDIYDHYRQFSGDWEQEEGIEKEEEPTAAMLPDDTVEQQLELGEES 480

Query: 480 TGTVVSGTTDDSKETKRHRRRNGWTWLNNKMXXXXXXXXXXXXXXXXXXVESQRMERDNS 539
            G  ++ +TDDSKETKRHRRRNGWTWLN+KM                  VESQ+MER+NS
Sbjct: 481 AG--MNKSTDDSKETKRHRRRNGWTWLNSKMNKENDNEENQGDDENEESVESQKMERENS 538

Query: 540 KKHHISIFNGXXXXXXXXXXXXXXXXXXXXXXQTRQKIEKTFANLFRRKPHHKHEASPLP 599
           KKHHIS+FNG                      QTRQKIEKTFANLFRRKPHHKHE S  P
Sbjct: 539 KKHHISLFNGGEKNEPSSKDEVNSANVPTTTSQTRQKIEKTFANLFRRKPHHKHEESLSP 598

Query: 600 SS--PAPDNDTAHGPETKLKKLSSKGGREPTEPIVLXXXXXXXXXXXXXXXXXEVSMKGT 657
           S+  P P+ND    PE KLK L  K  REP EPIVL                 E+S++  
Sbjct: 599 STSPPVPNNDAVRVPERKLKNLDEKNEREPIEPIVLHSRARRHRHRHNRHGSREISVEAF 658

Query: 658 SD 659
           +D
Sbjct: 659 ND 660

 Score =  271 bits (692), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 156/203 (76%), Gaps = 8/203 (3%)

Query: 724 GEVSSLEEVANNEESDTESLPKLQPAISVSSTKSNPRDCEEVDAKKKNKEKRSNT----- 778
           GEVS +E V    ESD+E L +LQPA++VSSTKSN RD EE + +K+NK+KR +T     
Sbjct: 686 GEVSGIE-VGKEVESDSEGLLQLQPAVNVSSTKSNRRDTEEAETRKQNKKKRGDTIDLPN 744

Query: 779 GKHAKHVQKEMDHEQRGQXXXXXXXXXXXXXXXXXXLRHTSVLPPRKLTFADVKKSEKPN 838
            +  K VQKE  HE++ Q                  LRHTSVLPPRKLTFADVKK EKPN
Sbjct: 745 ERLTKDVQKEKAHERKAQVQTEAPVQVQAPVAPP--LRHTSVLPPRKLTFADVKKPEKPN 802

Query: 839 APVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRLSHLKLSNSKRELREQVLLSN 898
           APVQF+DSAFGFPLPLLTVSTV+MFDHRLPINVERAIYRLSHLKLSNSKR LREQVLLSN
Sbjct: 803 APVQFSDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSN 862

Query: 899 FMYAYLNLVNHTLYMEQAGHDKE 921
           FMYAYLNLVNHTLYMEQA  DKE
Sbjct: 863 FMYAYLNLVNHTLYMEQAAQDKE 885

>Smik_13.486 Chr13 complement(794245..797016) [2772 bp, 923 aa] {ON}
           YMR273C (REAL)
          Length = 923

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/674 (56%), Positives = 435/674 (64%), Gaps = 26/674 (3%)

Query: 1   MSNTINESMLRTTSNNRAAASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID 60
           MSN  NE  LRTTSN++  ASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLL+D
Sbjct: 1   MSNRNNEGTLRTTSNSKVTASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVD 60

Query: 61  PELDIKFGGESNXXXXXXXXXXXXXXXPNVTRSMNNTRYSDPTPLEKLHVQSSTETESYE 120
           PELDIKFGGESN               P  T  MNNTRYSDPTPLE LH +   + ES +
Sbjct: 61  PELDIKFGGESNGRRSWSGTAYNSASTPGGTTRMNNTRYSDPTPLENLHERGDLKLESSD 120

Query: 121 RCRQGNYTGHKKVVHSPSRXXXXXXXXXXXXWVPANQHPNVKPDNYLELVQDTLQNIRLX 180
           + RQ NY G KK VHS SR            WVPANQHPNVKPDNYLELVQDTLQNI+L 
Sbjct: 121 KGRQSNYAGSKKGVHSTSRKLNANALKKNLLWVPANQHPNVKPDNYLELVQDTLQNIQLN 180

Query: 181 XXXXXXXXXXXXXXXAHGETESYGNKENLNVVNVNRGMPRHGNASLIRRPSTLRRSYTEF 240
                          +  +   Y NKEN +  N+NR M RHG ASLIRRPSTLRRSYTEF
Sbjct: 181 GSEDNNDDQNNGNKNSGSKV--YDNKEN-DTENLNRAMSRHGTASLIRRPSTLRRSYTEF 237

Query: 241 DDSEGDIGQGDDDSMTVNKAKERTSRIRERPISLRDITEELTKISNSAGLTDDDAITLAR 300
           DDSE D G    DS TVNK +ERTSRI+ERP+SLRDITEELTKISNSAGLTD+DAITLAR
Sbjct: 238 DDSEDDNG----DSKTVNKVEERTSRIKERPVSLRDITEELTKISNSAGLTDNDAITLAR 293

Query: 301 TLNMAGSYSDKGDGPRSEDSRVGYEEENAKVTGSQTETPDDVEYASNMPINNDSTGPERS 360
           TL+MAGSYSDK D     +    + EE++    SQ E  DD EYASNMPINN+ T PERS
Sbjct: 294 TLSMAGSYSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPSDDGEYASNMPINNNMTWPERS 353

Query: 361 SLKRSRFNTYRIRSHXXXXXXXXXXXXXXXXDVS-RLHLAENTIEIGINSPKSPFRQEDD 419
           SL+RSRFNTYRIR                  +    L LA NT +  I+  KSPFRQ+ +
Sbjct: 354 SLRRSRFNTYRIRQQEQEKEVEEDKEKIKDYETEHHLPLANNTSKTAIDPHKSPFRQQAE 413

Query: 420 ESDPVSSPGSIGDFQDIYDHYTQSSGDWEKEMGIEKSKALEGGKVEDNAVEQELEPQEES 479
           E + +SSPGSIGDFQDIYDHY QSSG+WE+EMGIEK   +   K E +++EQ+LE +EE 
Sbjct: 414 EPESMSSPGSIGDFQDIYDHYRQSSGEWEQEMGIEKEAEVVATKFEIDSLEQDLELREEP 473

Query: 480 TGTVVSGTTDDSKETKRHRRRNGWTWLNNKMXXXXXXXXXXXXXXXXXXVESQRMERDNS 539
            G + S +T+++KETKRHRRRNGWTWLNNKM                  ++SQRMER+NS
Sbjct: 474 VGVIKSSSTEENKETKRHRRRNGWTWLNNKMNRDDDNEGNQRDDENEENMDSQRMERENS 533

Query: 540 KKHHISIFNGXXXXXXXXXXXXXXXXXXXXXXQTRQKIEKTFANLFRRKPHHKHEAS--- 596
           K+HHIS+FNG                      QTRQKIEKTFANLFRRKPHHKHEAS   
Sbjct: 534 KRHHISLFNGSEKAEQSNKEEANSASAPTTTSQTRQKIEKTFANLFRRKPHHKHEASSSP 593

Query: 597 -----------PLPSSPAPDNDTAHGPETKLKKLSSKGGREPTEPIVLXXXXXXXXXXXX 645
                      PL     P+ND  H PE K+KK+ +K G+EP EPIVL            
Sbjct: 594 SSSPSSSPSSIPL----MPNNDAVHAPEKKVKKIGTKNGKEPVEPIVLRNRRRPQRNHHS 649

Query: 646 XXXXXEVSMKGTSD 659
                E+S+K T D
Sbjct: 650 RRGSREISVKITKD 663

 Score =  266 bits (681), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 142/226 (62%), Positives = 156/226 (69%), Gaps = 36/226 (15%)

Query: 731 EVANNEESDTESLPKLQPAISVSSTKSNPRDCEEVDAKKKNKEKRSNT-----GKHAKHV 785
           E+  NEE+D+++LPKLQPA+SVSSTKSN RD  E + KK+N EKRSNT      +H K+V
Sbjct: 692 EMKKNEENDSDNLPKLQPAVSVSSTKSNSRDTGEEEIKKRN-EKRSNTIELSNEQHRKYV 750

Query: 786 QKEMDHEQRG------------------------------QXXXXXXXXXXXXXXXXXXL 815
           QKE  HEQ+                               +                  L
Sbjct: 751 QKEKTHEQKAPCRSPSQAPSQAPGQSPSQAPIETSIETPIETPSETPSEAPAKTQAAPPL 810

Query: 816 RHTSVLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAI 875
           RHTSVLPPRKLTFADVKK +KPNAPVQFTDSAFGFPLPLLTVSTV+MFDHRLPINVERAI
Sbjct: 811 RHTSVLPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAI 870

Query: 876 YRLSHLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQAGHDKE 921
           YRLSHLKLSNSKR LREQVLLSNFMYAYLNLVNHTLYMEQ  HDKE
Sbjct: 871 YRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAHDKE 916

>YMR273C Chr13 complement(811233..813980) [2748 bp, 915 aa] {ON}
           ZDS1Protein with a role in regulating Swe1p-dependent
           polarized growth; involved in maintaining Cdc55p in the
           cytoplasm where it promotes mitotic entry; involved in
           mitotic exit through Cdc14p regulation; interacts with
           silencing proteins at the telomere; has a role in Bcy1p
           localization; implicated in mRNA nuclear export
          Length = 915

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/644 (59%), Positives = 441/644 (68%), Gaps = 15/644 (2%)

Query: 1   MSNTINESMLRTTSNNRAAASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID 60
           MSN  NESMLRTTS+++A ASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID
Sbjct: 1   MSNRDNESMLRTTSSDKAIASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLID 60

Query: 61  PELDIKFGGESNXXXXXXXXXXXXXXXPNVTRSMNNTRYSDPTPLEKLHVQSSTETESYE 120
           PELDIKFGGES+               P+ T ++NNTRYSDPTPLE LH + ++  ES  
Sbjct: 61  PELDIKFGGESSGRRSWSGTTSSSASMPSDTTTVNNTRYSDPTPLENLHGRGNSGIESSN 120

Query: 121 RCRQGNYTGHKKVVHSPSRXXXXXXXXXXXXWVPANQHPNVKPDNYLELVQDTLQNIRLX 180
           + +QGNY G KK VHSPSR            WVPANQHPNVKPDN+LELVQDTLQNI+L 
Sbjct: 121 KTKQGNYLGIKKGVHSPSRKLNANVLKKNLLWVPANQHPNVKPDNFLELVQDTLQNIQLS 180

Query: 181 XXXXXXXXXXXXXXXAHG-----ETESYGNKENLNVVNVNRGMPRHGNASLIRRPSTLRR 235
                                  E++SY NKEN N +N+NRG+ RHGNASLIRRPSTLRR
Sbjct: 181 DNGEDNDGNSNENNDIEDNGEDKESQSYENKEN-NTINLNRGLSRHGNASLIRRPSTLRR 239

Query: 236 SYTEFDDSEGDIGQGDDDSMTVNKAKERTSRIRERPISLRDITEELTKISNSAGLTDDDA 295
           SYTEFDD+E D  +GD  S TVNK +ER S+I+ERP+SLRDITEELTKISNSAGLTD+DA
Sbjct: 240 SYTEFDDNEDDDNKGDSASETVNKVEERISKIKERPVSLRDITEELTKISNSAGLTDNDA 299

Query: 296 ITLARTLNMAGSYSDKGDGPRSEDSRVGYEEENAKVTGSQTETPDDVEYASNMPINNDST 355
           ITLARTL+MAGSYSDK D P+ E     Y+E +   + SQ  T DD E+ASNMPINN  T
Sbjct: 300 ITLARTLSMAGSYSDKKDQPQPEGH---YDEGDIGFSTSQANTLDDGEFASNMPINNTMT 356

Query: 356 GPERSSLKRSRFNTYRIRSHXXXXXXXXXXXXXXXXDVSRLHLAENTIEIGINSPKSPFR 415
            PERSSL+RSRFNTYRIRS                 D  RL L +NTI++ I+  KSPFR
Sbjct: 357 WPERSSLRRSRFNTYRIRSQEQEKEVEQSVDEMKNDDEERLKLTKNTIKVEIDPHKSPFR 416

Query: 416 QEDDESDPVSSPGSIGDFQDIYDHYTQSSGDWEKEMGIEKSKALEGGKVEDNAVEQELEP 475
           Q+D++S+ +SSPGSIGDFQDIY+HY QSSG+WE+EMGIEK       KV ++ VEQ+LE 
Sbjct: 417 QQDEDSENMSSPGSIGDFQDIYNHYRQSSGEWEQEMGIEKEAEEVPVKVRNDTVEQDLEL 476

Query: 476 QEESTGTVVSGTTDDSKETKRHRRRNGWTWLNNKMXXXXXXXXXXXXXXXXXXVESQRME 535
           +E +T  V    TDD+KETKRHRRRNGWTWLNNKM                  V+SQRME
Sbjct: 477 REGTTDMVKPSATDDNKETKRHRRRNGWTWLNNKMSREDDNEENQGDDENEENVDSQRME 536

Query: 536 RDNSKKHHISIFNGXXXXXXXXXXXXXXXXXXXXXXQTRQKIEKTFANLFRRKPHHKHEA 595
            DNSKKH+IS+FNG                      QTRQKIEKTFANLFRRKPHHKH+A
Sbjct: 537 LDNSKKHYISLFNGGEKTEVSNKEEMNNSSTSTATSQTRQKIEKTFANLFRRKPHHKHDA 596

Query: 596 SPLPSSPA------PDNDTAHGPETKLKKLSSKGGREPTEPIVL 633
           S  PSS        P+ND  H    K KKL +K GREP EPIVL
Sbjct: 597 SSSPSSSPSSSPSIPNNDAVHVRVRKSKKLGNKSGREPVEPIVL 640

 Score =  254 bits (649), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 153/224 (68%), Gaps = 34/224 (15%)

Query: 731 EVANNEESDTESLPKLQPAISVSSTKSNPRDCEEVDAKKKNKEKRSNTG-----KHAKHV 785
           E+   EESD+ESLP+LQPA+SVSSTKSN RD  E +  KK  +KRSNT      +H+KHV
Sbjct: 684 EIEKKEESDSESLPQLQPAVSVSSTKSNSRD-REEEEAKKKNKKRSNTTEISNQQHSKHV 742

Query: 786 QKEMDHEQRGQXXXXXXXXXXXXXXXXXX----------------------------LRH 817
           QKE   EQ+ Q                                              L+H
Sbjct: 743 QKENTDEQKAQLQAPAQEQVQTSVPVQASAPVQNSAPVQTSAPVEASAQTQAPAAPPLKH 802

Query: 818 TSVLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYR 877
           TS+LPPRKLTFADVKK +KPN+PVQFTDSAFGFPLPLLTVSTV+MFDHRLPINVERAIYR
Sbjct: 803 TSILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYR 862

Query: 878 LSHLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQAGHDKE 921
           LSHLKLSNSKR LREQVLLSNFMYAYLNLVNHTLYMEQ  HDKE
Sbjct: 863 LSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAHDKE 906

>KLTH0C04048g Chr3 (352955..355762) [2808 bp, 935 aa] {ON} similar
           to uniprot|P54786 Saccharomyces cerevisiae YML109W ZDS2
           Protein that interacts with silencing proteins at the
           telomere involved in transcriptional silencing paralog
           of Zds1p
          Length = 935

 Score =  218 bits (554), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 178/543 (32%), Positives = 256/543 (47%), Gaps = 97/543 (17%)

Query: 24  DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGGESNXXXXXXXXXXX 83
           +KRKSEVLIAAQSLD+E++ VKNLKR+SIGSMD+LIDPE++ +     +           
Sbjct: 34  EKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRVSPSPSQPAPTTDTSHD 93

Query: 84  XX--------------XXPNVTRSMNNTRY---SDPTPLEKLHVQSSTETESYER----C 122
                              N +  + +T Y   S+ T  E L   SS + +  +R     
Sbjct: 94  QQLYNSHSDHDSDDDLSYVNDSIDITSTEYLQESEGTGFESLG-SSSNDADCGKRTLSGV 152

Query: 123 RQGNYTGHKKVVHSPSRXXXXXXXXXXXXWVPANQHPNVKPDNYLELVQDTLQNIRLXXX 182
           R+G  +G  ++ ++ S             WVPANQHPN+KP+NYLELVQDTL  +++   
Sbjct: 153 RRGGLSGKTRMNNNLS-AKDEESVTHNLLWVPANQHPNIKPENYLELVQDTLHTLKIEPD 211

Query: 183 XXXXXXXXXXXXXAHGETESYGNKENLNVVNVNRGMPRHGNASLIRRPSTLRRSYTEFDD 242
                         H    +  N    N +       R G  SL+RRPS LR+S+TE +D
Sbjct: 212 NEGSVEGGNDEKIVHAPAAASANLPPSNQL-------RSGLNSLVRRPSGLRKSFTELED 264

Query: 243 ---SEGDIGQGDDDSMTVNKAKERTS---RIRERPISLRDITEELTKISNSAGLTDDDAI 296
               E     G D++  +  A +  S   RI  R  SL+DITEELT+ISN AG TD DA+
Sbjct: 265 LLLQEAQDTSGGDENAELPSADKMPSVRPRIGSRSSSLKDITEELTRISNRAGFTDGDAV 324

Query: 297 TLARTLNMAGSYSDKGDGPRSEDSRVGYEEENAKVTGSQTETPDDVEYASNMPINNDSTG 356
           +LARTL+MA SY               Y +E+ +  GS  + P+  EYAS+M   N    
Sbjct: 325 SLARTLSMASSY---------------YTDEDGESVGSPEKKPEK-EYASSMLTKNGLAI 368

Query: 357 PERSSLKRSRFNTYRIRSHXXXXXXXXXXXXXXXXDVSRLHLAENTIEIGINSPKSPFRQ 416
           P RSSL+RS+FNTYRIR+                 ++       N ++      +SP R 
Sbjct: 369 PARSSLRRSKFNTYRIRN--------TSGGSTAPSNLRSPSAEHNELD------RSPIRV 414

Query: 417 EDDESDPVSSPGSIGDFQDIYDHYTQSSGDWE--------KEMGIEKSKALEGGKVEDNA 468
            D ++  + SP S+ DF +IYDHY QSS D          +        ++   + +D+ 
Sbjct: 415 -DQKNAQLQSPTSVNDFNEIYDHYRQSSFDSSLGAYPHEHQNAHTSNFHSIASKRPKDDT 473

Query: 469 V---EQEL-------------EPQEESTGTVVSGTTDDSKETKRH------RRRNGWTWL 506
           +   E  L             + Q+ S    V  T +D K+  +H      R+++GW+W 
Sbjct: 474 LLDSESSLHDLHKGSLNKALDDEQQASFRGHVEATNNDEKDDHKHASSQAPRKKSGWSWF 533

Query: 507 NNK 509
             K
Sbjct: 534 GKK 536

 Score =  177 bits (448), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 89/96 (92%)

Query: 820 VLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRLS 879
           VLPPRKL F+DV K E+PNAP++F+DS+FGFPLP LTVSTVVM DHRLPINVERAIYRLS
Sbjct: 819 VLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLS 878

Query: 880 HLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQ 915
           HLKL + KRELR+QV+LSNFMYAYLNLVNH+LY++Q
Sbjct: 879 HLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQ 914

>Smik_13.25 Chr13 (47889..50738) [2850 bp, 949 aa] {ON} YML109W
           (REAL)
          Length = 949

 Score =  212 bits (539), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 170/485 (35%), Positives = 234/485 (48%), Gaps = 115/485 (23%)

Query: 24  DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGGESNXXXXXXXXXXX 83
           +KRKS+V IAA+SLD EI++VKNLKRLSIGSMDL+IDPEL+ K    ++           
Sbjct: 47  EKRKSDVFIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNSRNSYSSDSSKESLQ 106

Query: 84  XXXXPNVT---------RSMNNTRYS-----------DPTPLEKLHVQSSTETE------ 117
                            R  +N  Y            D T  E LH + + E E      
Sbjct: 107 ESLCEEDVIQPKQEEEKRGEDNDAYEEGEATNADDSIDITQTEYLHDEETLEKEKIFYNA 166

Query: 118 ----SYER--CRQGNYTGHKKVVHSP------SRXXXXXXXXXXXXWVPANQHPNVKPDN 165
               S  R  CR    +G K + H                      WVPANQHPNVKP+N
Sbjct: 167 PSSTSSARVTCRNRRLSGVKALAHDAVLEAMDDHESKTVDFTQNLLWVPANQHPNVKPEN 226

Query: 166 YLELVQDTLQNIRLXXXXXXXXXXXXXXXXAHGETESYGNKENLNVVNVNRGMPRHGNAS 225
           YLEL+QDTLQNI++                    T+    +  L V N +  + R  + S
Sbjct: 227 YLELIQDTLQNIQIS-------------------TDEDSGESTLEVGNNHVILNRKSSGS 267

Query: 226 LIRRPSTLRRSYTEFDDSEGDIGQGDDDSMTVNKAKER--TSRIRE-RPISLRDITEELT 282
           ++RRPS L+ SYT+FDD   +I   D   +   +  +R  +S +R  R +SL++ITEELT
Sbjct: 268 IVRRPSRLKTSYTKFDD---EISVADKPEVGQEQVNKRIPSSEVRTIRSVSLKEITEELT 324

Query: 283 KISNSAGLTDDDAITLARTLNMAGSYSDKGDGPRSEDSRVGYEEENAKVTGSQTETPDDV 342
           KISN+AGLT  +A+TLAR+L+M+GS++++    +S D+                   +D 
Sbjct: 325 KISNNAGLTGSNAVTLARSLSMSGSFTNENLLLKSNDAE------------------NDS 366

Query: 343 EYASNMPINNDSTGPERSSLKRSRFNTYRIRSHXXXXXXXXXXXXXXXXDVSRLHLAENT 402
           E+ASNM   +  T PERSSL+RS+FNTY+IR                  + S L  A N 
Sbjct: 367 EFASNMFNESGRTIPERSSLRRSKFNTYKIR-----------------LEGSGLPQAANL 409

Query: 403 IEIGINSPKSPFRQEDDESDPVSSP----------GSIGDFQDIYDHYTQSSGDWEKEMG 452
             + +N      R  DD     SSP          GS+ DFQ+I+DHY ++S DW  +  
Sbjct: 410 KNL-MN-----MRTSDDRR-STSSPACYARLPQEQGSLNDFQEIFDHYRRTSTDWSTDWS 462

Query: 453 IEKSK 457
            E +K
Sbjct: 463 TENAK 467

 Score =  175 bits (443), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 87/97 (89%)

Query: 821 LPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRLSH 880
           L PRKLTF DV K + PNAP++FTDSAFGFPLP++T STV+MFDHRL INVERAIYRLSH
Sbjct: 824 LIPRKLTFGDVVKPKYPNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSH 883

Query: 881 LKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQAG 917
           LKLS+  RELR+QVLLSNFMY+YLNLVNHTLYMEQ G
Sbjct: 884 LKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQMG 920

>YML109W Chr13 (51640..54468) [2829 bp, 942 aa] {ON}  ZDS2Protein
           with a role in regulating Swe1p-dependent polarized
           growth; involved in maintenance of Cdc55p in the
           cytoplasm where it promotes mitotic entry; interacts
           with silencing proteins at the telomere; implicated in
           the mitotic exit network through regulation of Cdc14p
           localization; paralog of Zds1p
          Length = 942

 Score =  211 bits (538), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 180/548 (32%), Positives = 252/548 (45%), Gaps = 119/548 (21%)

Query: 24  DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGGESNXXXXXXXXXXX 83
           +KRKS+VLIAA+SLD EI++VKNLKRLSIGSMDL+IDPEL+ K    ++           
Sbjct: 46  EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNSRNSYSSDSSKESLQ 105

Query: 84  XXX-XPNVTRSM--------NNTRYS-----------DPTPLEKLHVQSSTETESYER-- 121
                 N+ RS         +N  Y            D T  E LH + + E E   R  
Sbjct: 106 ESLHEENIIRSEQKEEQGSEDNDAYEEGDATNVDDSIDITQTEYLHDEETLEKEKIIRNA 165

Query: 122 -----------CRQGNYTGHKKVVHSP------SRXXXXXXXXXXXXWVPANQHPNVKPD 164
                       R    +G K + H                      WVPA+QHPNVKP+
Sbjct: 166 SSSTSSSARVTSRNRRLSGVKTLAHDVVLDVENDHDSKMVDLTQNLLWVPADQHPNVKPE 225

Query: 165 NYLELVQDTLQNIRLXXXXXXXXXXXXXXXXAHGETESYGNKENLNVVNVNRGMPRHGNA 224
           NYLEL+QDTLQNI++                         NK  L   +V     R G  
Sbjct: 226 NYLELIQDTLQNIQISTNQDIDE-----------------NKLELGNNHVISNRKRTG-- 266

Query: 225 SLIRRPSTLRRSYTEFDDSEGDIGQGDDDSMTVNKAKERTSRIRERPISLRDITEELTKI 284
           S++RRPS L+ SYT+FDD      +  +  + V+K    +     R +SL++ITEELTKI
Sbjct: 267 SVVRRPSRLKTSYTKFDDEPPLADKPQEGEIQVDKRISSSDIKTIRSVSLKEITEELTKI 326

Query: 285 SNSAGLTDDDAITLARTLNMAGSYSDKGDGPRSEDSRVGYEEENAKVTGSQTETPDDVEY 344
           SN+AGLTD DA+TLAR+L+M+GS+++                E+  + G+ TE  +D E+
Sbjct: 327 SNNAGLTDSDAVTLARSLSMSGSFTN----------------ESLHLNGNHTE--NDNEF 368

Query: 345 ASNMPINNDSTGPERSSLKRSRFNTYRIRSHXXXXXXXXXXXXXXXXDVSRLHLAENTIE 404
           ASNM      T PERSSL+RS+FNTY+IR                    S +++  N   
Sbjct: 369 ASNMFNETGLTIPERSSLRRSKFNTYKIRLEGSSLPQAVKLN-------SLMNIQTNDNR 421

Query: 405 IGINSPKSPFRQEDDESDPVSSPGSIGDFQDIYDHYTQSSGDWEKE-------------- 450
              +SP S + Q   E        S+ DF +I+DHY ++S DW  E              
Sbjct: 422 RSASSPAS-YTQVPQEQ------ASLNDFHEIFDHYRRTSTDWSTENEKYVDSTNYYSDE 474

Query: 451 -----MGIEKSKALEGGKVEDNAVEQELEPQEESTGTVVSGTTD------DSKETKRHRR 499
                  I +  +L      +N+V   ++P   +TG+++S   D      +   T     
Sbjct: 475 EDLTHASISQESSLLSTDSSNNSV--LIKPH--NTGSMISEKLDQHVSSSEKSNTNNSEA 530

Query: 500 RNGWTWLN 507
            +GW+WLN
Sbjct: 531 NHGWSWLN 538

 Score =  177 bits (449), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 79/99 (79%), Positives = 88/99 (88%)

Query: 819 SVLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRL 878
           S LPPRKLTF DV K +  NAP++FTDSAFGFPLP++T STV+MFDHRL INVERAIYRL
Sbjct: 815 STLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRL 874

Query: 879 SHLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQAG 917
           SHLKLS+  RELR+QVLLSNFMY+YLNLVNHTLYMEQ G
Sbjct: 875 SHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVG 913

>KNAG0G03370 Chr7 complement(724041..727271) [3231 bp, 1076 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1076

 Score =  204 bits (519), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 104/177 (58%), Positives = 123/177 (69%), Gaps = 4/177 (2%)

Query: 743  LPKLQPAISVSSTKSNPRDCEEVDAKKK---NKEKRSNTGKHAKHVQKEMDHEQRGQXXX 799
            LP LQPA+SV+S K N RD  +V    +     + +  +G   ++  + +D    G+   
Sbjct: 850  LPGLQPAVSVTSAK-NTRDNGDVVETVRELDGDDSQDISGGDIQYQMQPIDEPVDGEVAT 908

Query: 800  XXXXXXXXXXXXXXXLRHTSVLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVST 859
                               S LPPRKLT+ADVK+ EKPNAP+QFTDSAFGFPLP+LTVST
Sbjct: 909  VDDTQTVTAAAASALPAVISTLPPRKLTYADVKRPEKPNAPIQFTDSAFGFPLPMLTVST 968

Query: 860  VVMFDHRLPINVERAIYRLSHLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQA 916
            V+MFDHRL INVERAIYRLSHLKLS+SKRELR+QVLLSNFMYAYLNLVNHTLYMEQ 
Sbjct: 969  VIMFDHRLGINVERAIYRLSHLKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQV 1025

 Score =  169 bits (428), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 126/318 (39%), Positives = 164/318 (51%), Gaps = 33/318 (10%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIRLXXXXXXXXXXXXXXXXAHGETESYGNKENLNV 211
           WVPANQHPNVKP+NYLELV DTLQ I                       +S    +  N 
Sbjct: 237 WVPANQHPNVKPENYLELVHDTLQTINGEGDGDGDGHTIDTSADTGTAADSVDESDKENN 296

Query: 212 VNVNRGMPRHGNAS-LIRRPSTLRRSYTEFDDSEG---------DIGQGDDDSMTVNKAK 261
               R   R+G AS L+RRPS LRRSY E D+ E          DI +G     ++++ K
Sbjct: 297 NTRLRVRYRNGKASSLVRRPSRLRRSYIETDEDEDSNTSNAKIDDIEEG---GRSLDERK 353

Query: 262 ERTSRIRERPISLRDITEELTKISNSAGLTDDDAITLARTLNMAGSYSDKG----DGPR- 316
              +    + +SLRDITEELTK+SNS GLTDDDA+TLARTLNM  +Y+D      D  R 
Sbjct: 354 PTRTNGDRKSVSLRDITEELTKMSNSVGLTDDDAVTLARTLNMTCTYTDTDSEGLDNLRT 413

Query: 317 -SEDSRVGYEEENAKVTGSQTETPDDVEYASNMPINNDSTGPERSSLKRSRFNTYRIR-- 373
            S++     E EN   T      PD+ ++ASNM + N  + P RSSL+RS+FNTYRIR  
Sbjct: 414 DSKEQLRAEESENPPGTTHAKILPDENQFASNMFMKNGLSIPTRSSLRRSKFNTYRIRTT 473

Query: 374 SHXXXXXXXXXXXXXXXXDVSRLHL-----AENTIEIGINSPKSPFRQEDDESDPVSSPG 428
           S                  +S +HL     A +     + SP       +DE+  + SPG
Sbjct: 474 SAPTPLVEKPKRNNSRHARLSFVHLDDEEFASHESPAALQSPTV----NNDEAGVIESPG 529

Query: 429 SIGDFQDIYDHYTQSSGD 446
           SI    D+YDHYT ++ +
Sbjct: 530 SIS---DLYDHYTGTASE 544

 Score = 76.3 bits (186), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/51 (72%), Positives = 44/51 (86%)

Query: 17 RAAASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKF 67
          RA    R+KRKSEVLIAAQSLD E+++VK+LKRLSIGSMDLLIDPEL+ + 
Sbjct: 18 RATEMDRNKRKSEVLIAAQSLDVEVQNVKHLKRLSIGSMDLLIDPELEFRV 68

>NCAS0B01110 Chr2 complement(182537..185518) [2982 bp, 993 aa] {ON}
           Anc_8.831 YML109W
          Length = 993

 Score =  199 bits (507), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 122/181 (67%), Gaps = 3/181 (1%)

Query: 741 ESLPKLQPAISVSSTKSNPRDCEEVDAKKKNKEKRS---NTGKHAKHVQKEMDHEQRGQX 797
           E+LP LQPA+SV+STK+       V+  ++  E  S   + G  +  V   M  E+    
Sbjct: 767 EALPSLQPAVSVTSTKNVHLSASIVETVRELGEDDSQDISGGDLSTEVDNSMLAERNVMN 826

Query: 798 XXXXXXXXXXXXXXXXXLRHTSVLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTV 857
                                 VLP RKLTFADVK+ ++PNAP+QFTDSAFGFPLP+LTV
Sbjct: 827 SSDLQSIENSSDDINTGNTIEHVLPARKLTFADVKRPDRPNAPIQFTDSAFGFPLPMLTV 886

Query: 858 STVVMFDHRLPINVERAIYRLSHLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQAG 917
           STV+MFDHRL INVERAIYRLSHLKLS+SKRELR+QVLLSNFMYAYLNLVNHTLYMEQ  
Sbjct: 887 STVIMFDHRLGINVERAIYRLSHLKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQVA 946

Query: 918 H 918
            
Sbjct: 947 Q 947

 Score =  159 bits (402), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 159/507 (31%), Positives = 209/507 (41%), Gaps = 111/507 (21%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIRLXXXXXXXXXXXXXXXXAHGETESYGNKENLNV 211
           WVPANQHPNVKP+NYLELVQDTLQNI L                 H   +S  NKEN+++
Sbjct: 202 WVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQ---------HENEKSNNNKENIDI 252

Query: 212 VNVNRG----MPRHG-------------NASLIRRPSTLRRSYTEFDDSEGDIGQGDDDS 254
              N      + RH              N SL+RRPS LR SYTEF+  E D    ++  
Sbjct: 253 SKSNMSEEEPIDRHPQSLDKTFLEITNRNRSLVRRPSRLRTSYTEFE--EDDYSNSEESE 310

Query: 255 MTVNKAK-----------------ERTSRIRERPISLRDITEELTKISNSAGLTDDDAIT 297
              N+++                  +     +R +SL+DITEELT ISN AGLTD DAIT
Sbjct: 311 AKTNESQLSSREEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNKAGLTDSDAIT 370

Query: 298 LARTLNMAGSYSDKGDGPRSEDSRVGYEEENAKVTGSQTETPDDVEYASNMPINNDSTGP 357
           LARTL+MA S+SD                 N   +  Q E+ ++ E+ASNM + N  T P
Sbjct: 371 LARTLSMASSFSDGN--------------VNLGKSKLQNESNEESEFASNMFMKNGLTIP 416

Query: 358 ERSSLKRSRFNTYRIRSHXXXXXXXXXXXXXXXXDVSRLHLAENTIEIGINSPKSPFRQE 417
           ERSSL+RS+FNTYRIRS                   S     E   +    SP S   ++
Sbjct: 417 ERSSLRRSKFNTYRIRSTSSSTSTREKTSPLLQS--SSFARQEADTDDLQRSPVSFTNRD 474

Query: 418 DDESDPVSSPGSIGDFQDIYDHYTQSSGDWEKEMGIEKSKALEGGKVEDNAVEQE--LEP 475
              +   SSPGSI D   +YDHY  ++   E + G +       G +   ++ QE     
Sbjct: 475 SYLATTTSSPGSISD---LYDHYQDNA---ESKQGNDNDNEARQGDLSHASISQESSFLS 528

Query: 476 QEESTGTVV---------------SGTTDDSKE----------------TKRHRRRNGWT 504
            E S  +++               +G   D  +                ++   +RNGW+
Sbjct: 529 NESSNDSILVKPLGSKSMIHENLDNGQDHDDDQPAYQKVSKLNPTIPDTSRSKHKRNGWS 588

Query: 505 WLNNKMXXXXXXXXXXXXXXXXXXVESQRMERDN-SKKHHISIFNGXXXXXXXXXXXXXX 563
           W  N+                    E Q    D  SK  H  I                 
Sbjct: 589 WSGNRANSEEDATVLVNSQD-----EDQTGYTDQKSKSRHRPIL-----ARSRDHLKINK 638

Query: 564 XXXXXXXXQTRQKIEKTFANLFRRKPH 590
                     R+ IEK F  LFRRK H
Sbjct: 639 EAELPKESHKRETIEKRFVKLFRRKGH 665

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (83%), Gaps = 2/61 (3%)

Query: 10 LRTTSNNRAAASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGG 69
          LR TS   +  +QRDKRKSEVLIAAQSLDNE++SVKNLKRLSIGSMDLLIDPEL+ +   
Sbjct: 10 LRKTSG--SLQTQRDKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPELEFRVNN 67

Query: 70 E 70
          +
Sbjct: 68 D 68

>Kpol_541.10 s541 complement(26683..29853) [3171 bp, 1056 aa] {ON}
           complement(26683..29853) [3171 nt, 1057 aa]
          Length = 1056

 Score =  197 bits (500), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 156/472 (33%), Positives = 227/472 (48%), Gaps = 66/472 (13%)

Query: 19  AASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGGESNXXXXXX 78
           A S  DKRKS VLIAA+SLD E++ +K+LKR SIGSMD+L+DPEL+ +    SN      
Sbjct: 27  ATSMDDKRKSAVLIAAKSLDRELKHIKDLKRFSIGSMDMLMDPELEYRV---SNINKQST 83

Query: 79  XXXXXXXXXPNVTRSMN-NTRYSD-----------PTPLEKLHVQSSTETESYERCRQGN 126
                     +  + ++ N  +SD           P+ + +    S   ++ Y R +   
Sbjct: 84  DTYSKRRSITSDLQPLDANDDFSDDPLGIKSTEFLPSSVIRSSNPSGNRSDKYTRRKLSG 143

Query: 127 YTGHKKVVHSPSRXXXXXXXXXXXXWVPANQHPNVKPDNYLELVQDTLQNIRLXXXXXXX 186
                 +  S +             WVPA++HPNV PDNY++++Q++L N+ L       
Sbjct: 144 SRSLNTIPDSMAYNSKASTTKKNLLWVPADKHPNVMPDNYIQMIQNSLNNLSLESNEDVD 203

Query: 187 XXXXXXXXXAHGETESYGNKENLNVVNVNRGMPRHGNASLIRRPSTLRRSYTEFDDSEGD 246
                       +   Y ++E L+V    R      N SL+RRPS LR+SYTEF++S+ +
Sbjct: 204 KDSKVLPQ--ENKENIYEDRERLSVAYKRR------NRSLVRRPSQLRKSYTEFNNSDDE 255

Query: 247 IGQGDDDSMTVNKAKE------------RTSRI---RERPISLRDITEELTKISNSAGLT 291
               D+++++ N                +TS+    +   ISL+DIT ELTKISNS GL+
Sbjct: 256 EDNTDENNLSKNNKDTNENSANTSMDSIKTSKSFDNKRYSISLKDITAELTKISNSVGLS 315

Query: 292 DDDAITLARTLNMAGSYSDKGDGPRSEDSRVGYEEENAKVTGSQTETPDDVEYASNMPIN 351
           D DA++LAR+L++ G Y D+ +   + D  +           S  E+ +D E+ SNM + 
Sbjct: 316 DSDAVSLARSLSITGPYQDETESDGAGDIMLD--------NPSDEESLND-EFVSNMVLR 366

Query: 352 NDSTGPERSSLKRSRFNTYRIRSHXXXXXXXXXXXXXXXXDVSRLHLAENTIEIGINSPK 411
           N    P RSSL+RS+F TYR R+                 + S      N  EI     K
Sbjct: 367 NGLMIPTRSSLRRSKFTTYRSRTSSSDSLSPKKQNFDDKQETSVSSSKANENEI-----K 421

Query: 412 SPFRQ------------EDDESDPVSSPGSIGDFQDIYDHYTQSSGDWEKEM 451
           +PF +            EDDES   S   S  DFQDIYDHY Q S DW+ E 
Sbjct: 422 NPFGKLPEVNLKAEESNEDDESLKTSPAAS--DFQDIYDHYRQPSSDWDMEF 471

 Score =  189 bits (480), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 83/97 (85%), Positives = 90/97 (92%)

Query: 819  SVLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRL 878
            SVLPPRKL FADV KS+ PN P+QFTDSAFGFPLPLLT+STV+MFDHRLP+NVERAIYRL
Sbjct: 928  SVLPPRKLVFADVHKSDIPNGPIQFTDSAFGFPLPLLTISTVIMFDHRLPVNVERAIYRL 987

Query: 879  SHLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQ 915
            SHLKLS  KR LR+QVLLSNFMYAYL+LVNHTLYMEQ
Sbjct: 988  SHLKLSEPKRALRDQVLLSNFMYAYLHLVNHTLYMEQ 1024

>CAGL0F03421g Chr6 complement(336157..338610) [2454 bp, 817 aa] {ON}
           similar to uniprot|P50111 Saccharomyces cerevisiae
           YMR273c ZDS1
          Length = 817

 Score =  193 bits (491), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 176/528 (33%), Positives = 234/528 (44%), Gaps = 124/528 (23%)

Query: 28  SEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGGESNXXXXXXXXXXXXXXX 87
           SEV IAAQSLD E+RSVKNLKRLSIGSMDLL+DPE+D+     +N               
Sbjct: 6   SEVYIAAQSLDKELRSVKNLKRLSIGSMDLLMDPEMDM--LPYNNGYRNSWSTQLEQGDK 63

Query: 88  PNVTRSMNNTRYSDPT------------PLEKLHVQSS----TETESYER--------CR 123
           P     + +TRYSDPT            P ++   Q S    T+ E+ ++         R
Sbjct: 64  P-----LKSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVENTKKQPGSPKSLTR 118

Query: 124 QG--NYTGHKKVVHSPSRXXXXX-------XXXXXXXWVPANQHPNVKPDNYLELVQDTL 174
           +G  N++  + V  S                      WV A+QHPNVKP+NY+ELVQD L
Sbjct: 119 RGAVNFSSRRPVDRSNHSKNSSKINDTLPDEVAQNLLWVRADQHPNVKPENYIELVQDAL 178

Query: 175 QNIRLXXXXXXXXXXXXXXXXAHGETESYGNKENLNVVNVNRGMPRHGNASLIRRPSTLR 234
            NI++                   +   Y N  N    N         N  L+RRPS LR
Sbjct: 179 HNIQIDKTEEHDKENSDTL----DKVSRYYNSNNKRSPN---------NTGLVRRPSLLR 225

Query: 235 RSYTEFDD-SEGDIGQGDDDSMTVNKAKERTSRIRERPISLRDITEELTKISNSAGLTDD 293
           +SYTEFD+  + DI +    +  V+      S    +  +L+DITEELT+ISN AGLT++
Sbjct: 226 KSYTEFDEVKDSDIKEQSSTNNNVD------STPHNKKFTLKDITEELTRISNKAGLTNN 279

Query: 294 DAITLARTLNMAG-----SYSDKGDGPRSEDSRVGYEEENAKVTGSQTETPDDVEYASNM 348
           DA+TLARTL+MA         D  + P +ED               Q+   DD  YAS M
Sbjct: 280 DAVTLARTLSMASVAEEDETDDLQERPEAEDD-----------YARQSRNNDD-NYASTM 327

Query: 349 PINNDS-TGPERSSLKRSRFNTYRIRSHXXXXXXXXXXXXXXXXDVSRLHLAENTIEIGI 407
            +  DS    E S+LKRS++ TY IR+                                 
Sbjct: 328 LLPTDSLIKSEHSTLKRSKY-TYHIRTQEDK----------------------------- 357

Query: 408 NSPKSPFRQEDDESDPV-SSPGSIGDFQDIYDHYTQSSGDWEKEMGIEKSKALEGGKVED 466
             P  P   E    D + +SPGSI    DIYDHY + SGDW   + +      E  K  D
Sbjct: 358 -DPTIPVSTESQHQDVIEASPGSIN---DIYDHYREPSGDWSSLIQVAPEN--ENKKRTD 411

Query: 467 NAVEQELEPQEESTGTVVSGTTDDS---------KETKRHRRRNGWTW 505
             ++   +  + ST  V  G+T  S         KE    ++RNGW W
Sbjct: 412 TDIDSNTKIVQHSTEHVDLGSTGHSTSDKSDINKKEPAHRKKRNGWLW 459

 Score =  186 bits (472), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 90/96 (93%)

Query: 820 VLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRLS 879
           + PPRKLTFADVKK +K NAP++FTDSAFGFPLP LT STV+MFDHRLPI+VERAIYRLS
Sbjct: 720 LYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLS 779

Query: 880 HLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQ 915
           HLKLSNSKR LREQVLLSNFMY+YLNLVNHTLYMEQ
Sbjct: 780 HLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815

>TDEL0B00660 Chr2 (124552..127431) [2880 bp, 959 aa] {ON} Anc_8.831
           YMR273C
          Length = 959

 Score =  191 bits (486), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 122/188 (64%), Gaps = 3/188 (1%)

Query: 737 ESDTESLPKLQPAISVSSTKSNPRDCEE---VDAKKKNKEKRSNTGKHAKHVQKEMDHEQ 793
           +S  E LP LQPA+SV+STKS          +++ K+     S      ++ Q  +D   
Sbjct: 745 KSKAEDLPALQPAVSVTSTKSAHVPLASSVVIESVKELDGDDSQDVSMDQNAQTSIDIST 804

Query: 794 RGQXXXXXXXXXXXXXXXXXXLRHTSVLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLP 853
                                      +PPRKLTF DVK+SE+ NAP++FTDSAFGFPLP
Sbjct: 805 ETLSMKEQTSEVQTDVKQPADGPSHQPVPPRKLTFDDVKRSEQSNAPMKFTDSAFGFPLP 864

Query: 854 LLTVSTVVMFDHRLPINVERAIYRLSHLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYM 913
           +LTVSTV+MFDHRLPINVERAIYRLSHLKLS+ KRELR+QV+LSNFMYAYLNLVNHTLYM
Sbjct: 865 MLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRELRQQVVLSNFMYAYLNLVNHTLYM 924

Query: 914 EQAGHDKE 921
           EQ   + +
Sbjct: 925 EQVAQEND 932

 Score =  189 bits (481), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 169/511 (33%), Positives = 218/511 (42%), Gaps = 103/511 (20%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIRLXXXXXXXXXXXXXXXXAHGETESYGNKENLNV 211
           WVPA QHP+VKP+N+LELVQDTL NI+L                         NKEN   
Sbjct: 198 WVPAAQHPSVKPENFLELVQDTLHNIQLDEKKETTDNDNDE-----------SNKENAKA 246

Query: 212 -----VNVNRGMPRHGNASLIRRPSTLRRSYTEFDDS------EGDIGQGDD--DSMTVN 258
                +++ R        SL+RRPS LR+SYTEF++       EG +  G +  +S   +
Sbjct: 247 YDRLPIDITRK-----RDSLVRRPSRLRKSYTEFEEYDETESLEGSVAVGKESRNSFERS 301

Query: 259 KAKERTSRIRERPISLRDITEELTKISNSAGLTDDDAITLARTLNMAGSYSDKGDGPRSE 318
                +S    R +SL+DITEEL KISN+AGLT  DAITLARTL+MAGS++        +
Sbjct: 302 SIAPCSSGRSSRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEVNEDYD 361

Query: 319 DSRVGYEEENAKVTGSQTETPDDVEYASNMPINNDSTGPERSSLKRSRFNTYRIRSHXXX 378
            S+      +A    ++    DD E+ASNM + +    P RSSL+RS+FNTYR+RS    
Sbjct: 362 TSKRNGIHLDADDVQNEYNKEDDNEFASNMLMKHGVVIPARSSLRRSKFNTYRVRSSGST 421

Query: 379 XXXXXXXXXXXXXDVSRLHLAENTIEIGINSPKSPFRQEDDESDP--------VSSPGSI 430
                              L   T E       S   Q+D    P        +SSP SI
Sbjct: 422 SSLDDEHHESETKRKLSSGLENVTAE-------SSASQQDIYHSPSIKGNGSIMSSPSSI 474

Query: 431 GDFQDIYDHYTQSSGDWEKE---------------MGIEKSKALEGGKVED----NAVEQ 471
            DFQDIYDHY Q S DWEKE               +  E SK +   K+ D    NA   
Sbjct: 475 NDFQDIYDHYRQPSVDWEKELKKGTESDDSNKGNQLDFETSKEIASSKLSDLSQGNAKSS 534

Query: 472 -ELEPQEESTGTVVSGTTDDSKETKRHRRRNGWTWLNNKMXXXXXXXXXXXXXXXXXXVE 530
            E +  E+++ TVV       +E K   +R+GW+WLN  M                  V 
Sbjct: 535 IEAQDMEQASSTVV-------REMK--GKRSGWSWLNG-MGSKETNTEKNVKDTARQEVP 584

Query: 531 SQR---------------------MERDN-SKKHHISIFNGXXXXXXXXXXXXXXXXXXX 568
             R                     ++R N SK  H+ IF                     
Sbjct: 585 LHREPSDSHIDEDFEKTSTPVTTEIQRSNHSKNRHLPIFPANESSKRKDTTEEPAVSTKM 644

Query: 569 XXXQ-------TRQKIEKTFANLFRRKPHHK 592
                      TRQ  EK  ANLFRRK   K
Sbjct: 645 GRSSSSDSSNLTRQMFEKKIANLFRRKGKKK 675

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 45/47 (95%)

Query: 21 SQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKF 67
          SQR+KRKSEVLIAAQS+DNE+++VK+LKR+SIGS+DLL+DPEL+ + 
Sbjct: 27 SQREKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRV 73

>NDAI0E00350 Chr5 (54073..57564) [3492 bp, 1163 aa] {ON} Anc_8.831
            YML109W
          Length = 1163

 Score =  192 bits (487), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 86/98 (87%), Positives = 91/98 (92%)

Query: 821  LPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRLSH 880
            LPPRKLTF DVK+ E+PNAPV+FTDSAFGFPLP LTVSTV+MFDHRL INVERAIYRLSH
Sbjct: 1025 LPPRKLTFDDVKRPERPNAPVEFTDSAFGFPLPALTVSTVIMFDHRLGINVERAIYRLSH 1084

Query: 881  LKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQAGH 918
            LKLS+SKRELREQVLLSNFMYAYLNLVNHTLYMEQ   
Sbjct: 1085 LKLSDSKRELREQVLLSNFMYAYLNLVNHTLYMEQVAQ 1122

 Score =  171 bits (434), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 136/345 (39%), Positives = 168/345 (48%), Gaps = 74/345 (21%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIRLXXXXXXXXXXXXXXX----XAHGETESYGNKE 207
           WVPANQHPN+KP++YLELVQDTL NI L                      G  E+  NKE
Sbjct: 270 WVPANQHPNIKPESYLELVQDTLHNIHLDDDNHNNDDAKVSTDDDLYSMDGTDET--NKE 327

Query: 208 NLNVVNVNR---GMPRHGNASLIRRPSTLRRSYTEFD------------DSEGDIGQGDD 252
           NLN+  + +      R  N SL+RRPS LR+SYTEF+            D E +     D
Sbjct: 328 NLNIDYLTKPSTSELRRKNKSLVRRPSGLRKSYTEFEEFNTSDEEDETSDCEEEQQLSTD 387

Query: 253 DS------------------MTVNKAKERTSRIRERPISLRDITEELTKISNSAGLTDDD 294
           +S                  + + K   R+SR     +SL+DITEELTKISN+AGLTD D
Sbjct: 388 NSTNNANHHQDIIINNKTPEIIIPKGNTRSSRF----VSLKDITEELTKISNNAGLTDSD 443

Query: 295 AITLARTLNMAGSYSDKGDGPRSEDSRVGYEEENAKVTGSQTETPDDVEYASNMPINNDS 354
           AITLARTL+MAGS+  + +   + +S    EE+N         TP+D EYASNM + N  
Sbjct: 444 AITLARTLSMAGSF--QDNSNNNHNSDNFNEEQNGN-------TPEDDEYASNMFMKNGL 494

Query: 355 TGPERSSLKRSRFNTYRIRSHXXXXXXXXXXXXXXXXDVSRLHLAENTIEIGI-NSPKSP 413
           T P RSSL+RSRFNTYRIRS                      +  +   E G  N P   
Sbjct: 495 TIPTRSSLRRSRFNTYRIRSGSSSTSAQSSSSSRTTSGSQMTNNNKTVTEPGRGNQP--- 551

Query: 414 FRQEDDESDPVS------------SPGSIGDFQDIYDHYTQSSGD 446
              ED  + P S            SPGSI    D+YDHY  S  D
Sbjct: 552 ---EDHNNTPASHYTARLSYMSTTSPGSIS---DLYDHYQNSDSD 590

 Score = 74.7 bits (182), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 36/54 (66%), Positives = 47/54 (87%), Gaps = 2/54 (3%)

Query: 15 NNRAAASQ--RDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIK 66
          NN A+  Q  ++KRKS++ IAA+SLDNE++SV+NLKRLSIGSMDLLIDPEL+ +
Sbjct: 25 NNAASIQQARKEKRKSDMFIAAKSLDNELQSVQNLKRLSIGSMDLLIDPELEFR 78

>ZYRO0G13992g Chr7 complement(1112324..1115959) [3636 bp, 1211 aa]
            {ON} similar to uniprot|P54786 Saccharomyces cerevisiae
            YML109W ZDS2 Protein that interacts with silencing
            proteins at the telomere involved in transcriptional
            silencing paralog of Zds1p
          Length = 1211

 Score =  190 bits (483), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 83/99 (83%), Positives = 93/99 (93%)

Query: 821  LPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRLSH 880
            LP RKLTF+DVK+ ++PNAP+QFTDSAFGFPLP+LTVSTVVMFDHRLPINVERAIYRLSH
Sbjct: 1070 LPARKLTFSDVKRLDRPNAPMQFTDSAFGFPLPMLTVSTVVMFDHRLPINVERAIYRLSH 1129

Query: 881  LKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQAGHD 919
            LKLS+ KRELR+QV+LSNFMYAYLNLVNHTLYMEQ   +
Sbjct: 1130 LKLSDPKRELRQQVMLSNFMYAYLNLVNHTLYMEQVAQE 1168

 Score =  176 bits (447), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 118/254 (46%), Positives = 144/254 (56%), Gaps = 60/254 (23%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIRLXXXXXXXXXXXXXXXXAHGETESYGNKENLNV 211
           WVPANQHPNVKP+NYLELVQDTL NIRL                   E E  GN  N   
Sbjct: 241 WVPANQHPNVKPENYLELVQDTLHNIRLEG----------------NEDEQTGNDMNTTT 284

Query: 212 VNVNRG----------MPRHGNASLIRRPSTLRRSYTEFDDSEGDIGQGDDDSMTVNKAK 261
             V  G          +PR  N SL+R+PS LR+SYTEFD+      + DD   T   +K
Sbjct: 285 AKVEHGTNKENEDKGYLPRKNN-SLVRKPSRLRKSYTEFDE------ENDDYLDTSGFSK 337

Query: 262 ERTSRIRE-------------RPISLRDITEELTKISNSAGLTDDDAITLARTLNMAGSY 308
           +R+S   E             R +SLRDIT+ELTKISN+AGLTD DAITLARTL+MAGS+
Sbjct: 338 KRSSEDVEDASNLTISSTNSSRAVSLRDITDELTKISNNAGLTDSDAITLARTLSMAGSF 397

Query: 309 -SDKGD-------GPRSEDSRVGYEEENAKVTGSQTETPDDVEYASNMPINNDSTGPERS 360
            SD+ D       G + +D +  Y E +A       +  DD E+ASNM + N    P RS
Sbjct: 398 TSDEPDDIIENSRGTQGDDLQY-YNEADA-----MEKKEDDAEFASNMFMKNGFVIPARS 451

Query: 361 SLKRSRFNTYRIRS 374
           SL+RS+FNTYR+RS
Sbjct: 452 SLRRSKFNTYRVRS 465

 Score = 75.9 bits (185), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 33/46 (71%), Positives = 44/46 (95%)

Query: 21 SQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIK 66
          + ++KRKSEV+IAAQSLDNE++SVKNLKR+SIGSMD+L+DPEL+ +
Sbjct: 53 TMKEKRKSEVMIAAQSLDNEVQSVKNLKRISIGSMDMLLDPELEYR 98

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (68%)

Query: 411 KSPFRQEDDESDPVSSPGSIGDFQDIYDHYTQSSGDWEKEMGIEKSKA 458
           KSP +   ++   ++SP +I DFQDIYDHY QSS DWEKE+  E+  A
Sbjct: 557 KSPSQFIGEDGSNLTSPSTISDFQDIYDHYRQSSVDWEKELKKERDFA 604

>KAFR0A02770 Chr1 complement(575572..578226) [2655 bp, 884 aa] {ON}
           Anc_8.831 YMR273C
          Length = 884

 Score =  188 bits (478), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 84/99 (84%), Positives = 91/99 (91%)

Query: 819 SVLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRL 878
           S LPPRKLTF DVK+ EKPNAP+ F+DSAFGFPLP+LT STV+MFDHRL INVERAIYRL
Sbjct: 745 SSLPPRKLTFDDVKRPEKPNAPIHFSDSAFGFPLPMLTTSTVIMFDHRLGINVERAIYRL 804

Query: 879 SHLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQAG 917
           SHLKLS+ KRELR+QVLLSNFMYAYLNLVNHTLYMEQA 
Sbjct: 805 SHLKLSDPKRELRQQVLLSNFMYAYLNLVNHTLYMEQAA 843

 Score =  172 bits (436), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 119/320 (37%), Positives = 164/320 (51%), Gaps = 35/320 (10%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIRLXXXXXXXXXXXXXXXXAHGETESYGNKENLNV 211
           WVPA++HPNVKP NY+ELVQDTLQ+I +                AH              
Sbjct: 194 WVPASKHPNVKPQNYIELVQDTLQHIHIDDSKSNDNDNINKENDAHSS------------ 241

Query: 212 VNVNRGMPRHGNASLIRRPSTLRRSYTEFDDS--EGDIGQGD-DDSMTVNKAKERTSRIR 268
                      N SL+RRPS LR+SYTE+++   + D  + + +D    N    R+S  +
Sbjct: 242 ----------KNGSLVRRPSRLRKSYTEYEEENYQDDYNRNNSNDEENPNIGNFRSSN-K 290

Query: 269 ERPISLRDITEELTKISNSAGLTDDDAITLARTLNMAGSYSDKGDGPRSEDSRVGYEEEN 328
            R +SL+DITEELTKISN AGLTD DAITLARTL+M GS+S+  D      +    ++ N
Sbjct: 291 GRSVSLKDITEELTKISNKAGLTDSDAITLARTLSMTGSFSNGTDDMELLSNYSDQQDNN 350

Query: 329 AKVTGSQTETPDDVEYASNMPINNDSTGPERSSLKRSRFNTYRIRSHXXXXXXXXXXXXX 388
                 +    +D E+ASNM + N  T P+RSSL+RS+FNTYR+RS              
Sbjct: 351 --FNNDEHYNKNDDEFASNMLMKNGLTIPQRSSLRRSKFNTYRVRSSSAPSNIHSKPINS 408

Query: 389 XXXDVSRLHLAENTIEIGINSPKSPFRQEDDESDPVS-SPGSIGDFQDIYDHYTQSSGDW 447
              +        N+     +  KSP  + ++ ++PV+ SPGSI    D+YDHY  SS D 
Sbjct: 409 NIKEPKTFKYPYNS---KTSIKKSPVNRSNNYTEPVTESPGSIS---DLYDHYAYSSVDE 462

Query: 448 EKEMGIEKSKALEGGKVEDN 467
           E        +    G ++ N
Sbjct: 463 ETSNATNLQETSNDGSIDSN 482

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/46 (82%), Positives = 44/46 (95%)

Query: 21 SQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIK 66
          S R+KRKSEVLIAA+S+DNE+R+VKNLKRLSIGSMDLLIDPEL+ K
Sbjct: 27 SLRNKRKSEVLIAARSIDNEVRNVKNLKRLSIGSMDLLIDPELEYK 72

>SAKL0D01716g Chr4 (135836..138664) [2829 bp, 942 aa] {ON} similar
           to uniprot|P54786 Saccharomyces cerevisiae YML109W ZDS2
           Protein that interacts with silencing proteins at the
           telomere involved in transcriptional silencing paralog
           of Zds1p
          Length = 942

 Score =  188 bits (477), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 106/186 (56%), Positives = 124/186 (66%), Gaps = 9/186 (4%)

Query: 737 ESD-TESLPKLQPAISVSSTKSNPRDCEEV-DAKKKNKEKRSNTGKHAKHVQKEMDHEQR 794
           ESD  E LP LQPA+SV+STK +      V + K  +KE   N      HVQ+ +D +Q+
Sbjct: 721 ESDGLEELPTLQPAVSVTSTKQSDGAIPGVLENKTVSKEYEQN---QYNHVQQTLDQQQQ 777

Query: 795 GQXXXXXXXXXXXXXXX----XXXLRHTSVLPPRKLTFADVKKSEKPNAPVQFTDSAFGF 850
            Q                            LPPRKL F DVK+ E PNAP++FTDSAFGF
Sbjct: 778 QQQKQQKQQQQQQQQQSLKPPASPTNDPHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGF 837

Query: 851 PLPLLTVSTVVMFDHRLPINVERAIYRLSHLKLSNSKRELREQVLLSNFMYAYLNLVNHT 910
           PLP LTVSTV+MFDHRLPINVERAIYRLSHLKLS+ KRELR+QVLLSNFMYAYLNLVNH+
Sbjct: 838 PLPPLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHS 897

Query: 911 LYMEQA 916
           LY++Q 
Sbjct: 898 LYLQQV 903

 Score =  175 bits (444), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 137/393 (34%), Positives = 185/393 (47%), Gaps = 84/393 (21%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIRLXXXXXXXXXXXXXXXXAHGETESYGNKENLNV 211
           WVPANQHP+VKP+NYLELVQDTLQN++L                 HG          LN 
Sbjct: 205 WVPANQHPSVKPENYLELVQDTLQNLQLENGVRDESNKENTVKLIHG----------LNS 254

Query: 212 VNVNRGMPRHGNASLIRRPSTLRRSYTEFDDSEGDIGQGDDDSMTVNKAKERTSRIRERP 271
            NV++   + G  SL+RRPS LR+SYTEF+D+E       + ++ ++            P
Sbjct: 255 -NVSQLPIQQGKNSLVRRPSRLRKSYTEFEDTE-------EYNLPISGNSSSLPSSVPTP 306

Query: 272 --ISLRDITEELTKISNSAGLTDDDAITLARTLNMAGSYSDKGDGPRSEDSRVGYEEENA 329
             +SLR+IT+ELTK+SN+AGLTD DAITLARTL+MA ++               YE  N+
Sbjct: 307 RSVSLREITDELTKVSNNAGLTDSDAITLARTLSMASTF---------------YEGSNS 351

Query: 330 -KVTGSQTETPDDVEYASNMPINNDSTGPERSSLKRSRFNTYRIRSHXXXXXXXXXXXXX 388
            K   S TE  ++ E+ASNM   N    P RSSL+RS+FNTYRIR+              
Sbjct: 352 EKENQSNTEKAEEDEFASNMLNQNSLAIPARSSLRRSKFNTYRIRTPSGSSTNEFAQSNL 411

Query: 389 XXXDVSRLHLAENTIEIGINSPKSPFRQEDDESDPVSSPGSIGDFQDIYDHYTQSS---- 444
                      E  IE+ +        +E      ++SP +I D QDIYDHY  SS    
Sbjct: 412 KVSSTEENPQPE--IEVAVEETLPRVLEE----HILNSPSTINDMQDIYDHYDTSSVEES 465

Query: 445 --------------GDWEKEM--------------GIEKSKALEGGKVEDNAVEQELEPQ 476
                         GD  ++                I KSK        D+  ++ L P 
Sbjct: 466 LPPQNSNYSSAQQDGDNLQDSPDSSDFSTDSSTANAILKSKQSIVQTKSDSIQKEFLSPV 525

Query: 477 EESTGTVVSGTTDDSKETKRHRRRNGWTWLNNK 509
            EST          + + KR +++ GW+W N K
Sbjct: 526 TEST----------TADVKRQKKKGGWSWFNKK 548

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/51 (68%), Positives = 46/51 (90%)

Query: 17 RAAASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKF 67
          R + + ++KRKSEVLIAAQSLDNE+++VKNLKRLSIGSMDLL+DPE++ + 
Sbjct: 27 RNSPTSKEKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRI 77

>Kpol_1069.2 s1069 (1560..4565) [3006 bp, 1001 aa] {ON} (1560..4565)
           [3006 nt, 1002 aa]
          Length = 1001

 Score =  181 bits (460), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 78/98 (79%), Positives = 91/98 (92%)

Query: 819 SVLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRL 878
           ++LPPRKLTF DV++ ++PN  + FTDSAFGFPLPLLTVSTV+MFDHRLP+NVERAIYRL
Sbjct: 854 TILPPRKLTFEDVERLDRPNGSMVFTDSAFGFPLPLLTVSTVIMFDHRLPVNVERAIYRL 913

Query: 879 SHLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQA 916
           SHLKLS+S+R LREQVLLSNFMYAYL+LVNH+LYMEQ 
Sbjct: 914 SHLKLSDSRRSLREQVLLSNFMYAYLHLVNHSLYMEQV 951

 Score =  133 bits (334), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 90/223 (40%), Positives = 134/223 (60%), Gaps = 26/223 (11%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIRLXXXXXXXXXXXXXXXXAHGETESYGNKENLNV 211
           WVPANQHP+VKP N++ELV DTLQN+ L                   E+++  +K+ LN 
Sbjct: 203 WVPANQHPSVKPQNFVELVHDTLQNMSLDDVQTN-----------ESESKNEVSKDLLNT 251

Query: 212 VNVNRGMPRHGNASLIRRPSTLRRSYTEFDDSEGDIGQGDDDSMTVNKAKERTSRIRERP 271
            + +  M    N SL+RRPS LR+SYTEF++   +  +    S  +N++ ++  + + R 
Sbjct: 252 FSRDMNM---RNKSLVRRPSRLRKSYTEFEEETEEEVKPTTSSNNINESNKKNVQGK-RA 307

Query: 272 ISLRDITEELTKISNSAGLTDDDAITLARTLNMAGSYSDKGDGPRSEDSRVGYEEENAKV 331
           +SL+DI +ELT ISN+ GL++ DAI+LAR+L++AGS      G  SE      EEE  KV
Sbjct: 308 VSLKDIADELTVISNNVGLSNSDAISLARSLSIAGSI-----GSTSE------EEEEDKV 356

Query: 332 TGSQTETPDDVEYASNMPINNDSTGPERSSLKRSRFNTYRIRS 374
             + +    +  +ASN+   N  + P RSSL+RS+FNTY+IR+
Sbjct: 357 LNTSSIGQSEEVFASNILAKNGISIPARSSLRRSKFNTYKIRT 399

 Score = 77.8 bits (190), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 41/43 (95%)

Query: 22 QRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELD 64
          QRDKRKS VLIAAQSLD E+++VKNLKRLSIGSMDLLIDPEL+
Sbjct: 19 QRDKRKSAVLIAAQSLDQEVQNVKNLKRLSIGSMDLLIDPELE 61

>KAFR0B03860 Chr2 complement(798642..801173) [2532 bp, 843 aa] {ON}
           Anc_8.831 YMR273C
          Length = 843

 Score =  179 bits (455), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 90/101 (89%)

Query: 816 RHTSVLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAI 875
           +H S+LPPRKLTF DVKK EK N P+Q+TDSAFGFPLPLLTVSTV+M+D RL  NVERAI
Sbjct: 711 QHKSILPPRKLTFDDVKKPEKVNGPMQYTDSAFGFPLPLLTVSTVIMYDCRLATNVERAI 770

Query: 876 YRLSHLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQA 916
           YRLSHLKL N KR LREQVL+SNFMYAYLNLVNHTL+MEQ+
Sbjct: 771 YRLSHLKLGNRKRPLREQVLVSNFMYAYLNLVNHTLFMEQS 811

 Score =  100 bits (248), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 91/309 (29%), Positives = 137/309 (44%), Gaps = 59/309 (19%)

Query: 22  QRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGG-ESNXXXXXXXX 80
           Q+++R S + +AAQSL +E+++V +LKRLS+GS+D+L D +++  F   + N        
Sbjct: 7   QKEQRNSRIYLAAQSLGHEVQNVNHLKRLSVGSIDMLTDTDVEFSFNKLQRNISAKKTQE 66

Query: 81  XXXXXXXPNVTRSMNNTRYSDPTPLEKLHVQSSTETESYERCRQGNYT------------ 128
                     T S+     S  T LE  +     E ES +  R  + +            
Sbjct: 67  ILSQKRTSTETESV-----SYNTLLEGFYGSDDAEDESEKTTRNTSISETRDKSPSVPAR 121

Query: 129 GHKKVVHSPSRXXXXXXXXXXXXW----------VPANQHPNVKPDNYLELVQDTLQNIR 178
              + V + SR            +          V A+ HPNVKP+NY+ELVQDTL+   
Sbjct: 122 ARGRKVGAVSRSSRTANLGKKGGYDKEISKGLLWVSADVHPNVKPENYIELVQDTLEQY- 180

Query: 179 LXXXXXXXXXXXXXXXXAHGETESYGNKENLN-----VVNVNRGMPRHGNASLIRRPSTL 233
                                +  Y   E L      +++  R    H   SL+R+PS L
Sbjct: 181 --------------------NSSDYSISERLPEDKQVLLSAFRAKKSH---SLVRKPSKL 217

Query: 234 RRSYTEFDDSEGDIGQGDDDSMTVNKAKERTSRIRERPISLRDITEELTKISNSAGLTDD 293
           R+SY   + +       D ++        R   +    ISL++++EEL KIS+SAGLT D
Sbjct: 218 RKSYISIESNNTPAENNDANAHRKPLGSSRDPVVST--ISLKELSEELAKISSSAGLTKD 275

Query: 294 DAITLARTL 302
           DAITLA TL
Sbjct: 276 DAITLATTL 284

>TPHA0I00200 Chr9 complement(34713..37862) [3150 bp, 1049 aa] {ON}
           Anc_8.831 YMR273C
          Length = 1049

 Score =  179 bits (453), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 79/98 (80%), Positives = 89/98 (90%)

Query: 819 SVLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRL 878
           S LP RKLTF DV K E+PN P++FTDSAFGFPLP LT STV+MFDHRLP+NVERAIYRL
Sbjct: 883 SSLPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYRL 942

Query: 879 SHLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQA 916
           SHLKLS+ KRELREQ+LLSNFMYAYL+LVNH+LY+EQA
Sbjct: 943 SHLKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQA 980

 Score =  129 bits (323), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 136/244 (55%), Gaps = 35/244 (14%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIRLXXXXXXXXXXXXXXXXAHGETESYGNKENLNV 211
           WVPAN+HP VKP+NY+EL+QDTLQNI L                +    +   ++E +  
Sbjct: 210 WVPANKHPGVKPENYVELLQDTLQNINLNLNETQNNVEDTSNKTSD---KMVMDREVIRR 266

Query: 212 VNVNRGMPRHGNASLIRRPSTLRRSYTE----FDDS-------------EGDIGQGDDDS 254
             +++ + R+ ++SL+RRP+ LR SY+E    F D+             E  + Q     
Sbjct: 267 RRISQDLNRN-HSSLVRRPTGLRISYSESVEEFHDALESENSLNSDKEREPSLSQNSISM 325

Query: 255 MTVNKAKERTSRIRERPISLRDITEELTKISNSAGLTDDDAITLARTLNMAGSYSDKGDG 314
           +T++   + T ++ +   SL+DITEELTKISN AGL++ DAI+LAR+L++AGS S K D 
Sbjct: 326 ITIDLQNKSTYQMGKNYASLKDITEELTKISNKAGLSNSDAISLARSLSIAGSVS-KTDN 384

Query: 315 PRSEDSRVGYEEENAKVTGSQTETPDDVE-----YASNMPINNDSTGPERSSLKRSRFNT 369
             S++ +       +   G+    P   E     YASN+ + N  T P R SL+RS+FNT
Sbjct: 385 SVSDNLQ-------SATQGNDDNKPRSSEVSEAGYASNILVRNGITMPTR-SLRRSKFNT 436

Query: 370 YRIR 373
           Y+IR
Sbjct: 437 YKIR 440

 Score = 68.9 bits (167), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 40/50 (80%)

Query: 19 AASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFG 68
          A +  +KRKS VLIAAQSLD E+++VK LKRLS+GSMDLL+DPE +   G
Sbjct: 10 ACTVEEKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTMG 59

>KLLA0D01683g Chr4 complement(148855..151689) [2835 bp, 944 aa] {ON}
           some similarities with uniprot|P54786 Saccharomyces
           cerevisiae YML109W ZDS2 Protein that interacts with
           silencing proteins at the telomere involved in
           transcriptional silencing paralog of Zds1p and with
           YMR273C uniprot|P50111 Saccharomyces cerevisiae YMR273C
           ZDS1 Protein that interacts with silencing proteins at
           the telomere, involved in transcriptional silencing;
           also has a role in localization of Bcy1p, which is a
           regulatory subunit of protein kinase A; paralog of Zds2p
          Length = 944

 Score =  178 bits (451), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 90/95 (94%)

Query: 821 LPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRLSH 880
           LPPRKLTFADV K ++PN+P++FTDSAFGFPLP LT+STV+MFDHRLPI+VERAIYRLSH
Sbjct: 824 LPPRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYRLSH 883

Query: 881 LKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQ 915
           LKLS+ KR LR+QVLLSNFMYAYLNLVNH+LY++Q
Sbjct: 884 LKLSDPKRVLRQQVLLSNFMYAYLNLVNHSLYLQQ 918

 Score =  133 bits (334), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 93/223 (41%), Positives = 119/223 (53%), Gaps = 36/223 (16%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIRLXXXXXXXXXXXXXXXXAHGETESYGNKENLNV 211
           WV A+QHPNVKP+NYLELVQ+TL+N+ L                    T +    ++L+ 
Sbjct: 194 WVRADQHPNVKPENYLELVQNTLENMNLG---------------GRSPTANETQAQSLSG 238

Query: 212 VNVNRGMPRHGNASLIRRPSTLRRSYTEFDDSEGDIGQGDDDSMTVNKAKERTSRIRERP 271
           +   R        SL RRPS LR SYTE   SE D  +G  D      A   +SR   R 
Sbjct: 239 LKTLRKRSMQSGNSLARRPSRLRTSYTEL--SEDDEDKGMTDQPLAAAAPTMSSR---RT 293

Query: 272 ISLRDITEELTKISNSAGLTDDDAITLARTLNMAGSYSDKGDGPRSEDSRVGYEEENAKV 331
           +SL+DITEELTK+SN AGLTD DA+TLARTL +A   +    G +   + +  EEE    
Sbjct: 294 VSLKDITEELTKLSNQAGLTDTDAVTLARTLWVADESTTDSTG-QGLSNNLADEEE---- 348

Query: 332 TGSQTETPDDVEYASNMPINNDSTGPERSSLKRSRFNTYRIRS 374
                      E+AS M   +  T P R SL+RS+FNTYRI+S
Sbjct: 349 -----------EFASTMFTKSGFTVPARHSLRRSKFNTYRIQS 380

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%)

Query: 21 SQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIK 66
          S+RDKRKSEVLIAAQSLD E++ VKNLKRLSIGSMDLL+DPEL+ +
Sbjct: 4  SKRDKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEYR 49

>AAL185W Chr1 (9537..12593) [3057 bp, 1018 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YML109W (ZDS2) and YMR273C
           (ZDS1)
          Length = 1018

 Score =  175 bits (443), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%)

Query: 821 LPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRLSH 880
           LPPRKL F DV + EKPN+P++FT SAFGFPLP LTVSTV+MFDHRLPI VERAIYRLSH
Sbjct: 896 LPPRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRLPIYVERAIYRLSH 955

Query: 881 LKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQAGHDK 920
           LKLS+ KRELR+QVLLSNFMY+YLNLVNH+LY++Q   DK
Sbjct: 956 LKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEEDK 995

 Score =  129 bits (324), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 94/224 (41%), Positives = 121/224 (54%), Gaps = 40/224 (17%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIRLXXXXXXXXXXXXXXXXAHGETESYGNKENLNV 211
           WV A+QHPNVKP+NYLELV DTL N+R+                 HG  +S   + N  V
Sbjct: 234 WVRADQHPNVKPENYLELVHDTLNNLRIGAR--------------HGRGDSPVQQSNTPV 279

Query: 212 VNVNRGMPRHGNA-SLIRRPSTLRRSYTEFDDSEGDIGQGDDDSMTVNKAKERTSRIRER 270
            N   G     +A SL+R+ S LR+S+TE +  E       +   T +   E     R R
Sbjct: 280 AN---GESSTASARSLVRKQSRLRKSFTEVEAIE-------ESQFTDSIGSEIPVGKRMR 329

Query: 271 PISLRDITEELTKISNSAGLTDDDAITLARTLNMAGSYSDKGDGPRSEDSRVGYEEENAK 330
             SL++ITEELT+ISN+AGLTD DAITLARTL         G G +S D    + E    
Sbjct: 330 VSSLKEITEELTRISNNAGLTDSDAITLARTL---------GIGSQSADEHATFSE---C 377

Query: 331 VTGSQTETPDDVEYASNMPINNDSTGPERSSLKRSRFNTYRIRS 374
           V  ++ E   + EYAS++   N    P RSSL+RS+F TYRIRS
Sbjct: 378 VPSAEAE---ENEYASSILAKNGLAIPARSSLRRSKFTTYRIRS 418

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 52/65 (80%), Gaps = 5/65 (7%)

Query: 5   INESMLRTTSNNRAAASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELD 64
           + E +LR  ++ R A   ++KRKSEVLIAAQSLD E+++VKNLKR+SIGSMDLL+DPE++
Sbjct: 57  VQERVLR--AHTRQA---KEKRKSEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEME 111

Query: 65  IKFGG 69
            +  G
Sbjct: 112 FRMNG 116

>Suva_13.35 Chr13 (51377..54325) [2949 bp, 982 aa] {ON} YML109W
           (REAL)
          Length = 982

 Score =  174 bits (442), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 78/99 (78%), Positives = 88/99 (88%)

Query: 819 SVLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRL 878
           S+L P+KLTF DV   E PNAP++FTDSAFGFPLP++T STV+MFDHRL INVERAIYRL
Sbjct: 855 SILLPKKLTFEDVITPEYPNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRL 914

Query: 879 SHLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQAG 917
           SHLKLS+  RELR+QVLLSNFMY+YLNLVNHTLYMEQ G
Sbjct: 915 SHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQIG 953

 Score =  159 bits (401), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 118/328 (35%), Positives = 168/328 (51%), Gaps = 94/328 (28%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIRLXXXXXXXXXXXXXXXXAHGETESYGNKENLNV 211
           WVPA+QHPNVKP+NYLELVQDTLQNI++                    T+   +++N ++
Sbjct: 251 WVPASQHPNVKPENYLELVQDTLQNIQIT-------------------TDQDPDEKNSDL 291

Query: 212 VNVNRGMPRHGNASLIRRPSTLRRSYTEFDDSEGDI-----GQGDDDSMTVNKAKERTSR 266
            N +    R  + S++RRPS L+ SYT+FDD    +     G G        +A++R S 
Sbjct: 292 SNNHVFSNRQRSGSIVRRPSHLKTSYTKFDDEPSSVDRQRQGHG--------QAEKRISS 343

Query: 267 IRE---RPISLRDITEELTKISNSAGLTDDDAITLARTLNMAGSYSDKGDGPRSEDSRVG 323
           +     R +SL++ITEELTKIS++AGLTD DAITLAR+L+M+GS++              
Sbjct: 344 LETKSIRCVSLKEITEELTKISDNAGLTDSDAITLARSLSMSGSFT-------------- 389

Query: 324 YEEENAKVTGSQTETPDDVEYASNMPINNDSTGPERSSLKRSRFNTYRIRSHXXXXXXXX 383
               N  +  S  +T  D E+ASNM   +  T PER SL+RS+FNTY+IR          
Sbjct: 390 ----NESLHLSSNKTDSDNEFASNMFNKSGLTIPER-SLRRSKFNTYKIR---------- 434

Query: 384 XXXXXXXXDVSRLHLAENTIEIGINSPKSPFR-QEDDESDPVSSPGS----------IGD 432
                           EN   +    P S    Q +D+    SSP S          + D
Sbjct: 435 ---------------LENNDLLPTGRPNSLMNVQTNDDRRRASSPASYTQPPQDQTPLND 479

Query: 433 FQDIYDHYTQSSGDWEKEMGIEKSKALE 460
           FQ+I++HY ++S DW    G E +K ++
Sbjct: 480 FQEIFEHYRRTSTDW----GTENTKYVD 503

 Score = 71.2 bits (173), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 40/43 (93%)

Query: 24 DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIK 66
          +KRKS+VLIAA+SLD EI+ VKNLKRLSIGSMDL+IDPEL+ K
Sbjct: 51 EKRKSDVLIAAKSLDTEIQHVKNLKRLSIGSMDLVIDPELEFK 93

>Skud_13.32 Chr13 (51228..54074) [2847 bp, 948 aa] {ON} YML109W
           (REAL)
          Length = 948

 Score =  172 bits (436), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 86/101 (85%)

Query: 817 HTSVLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIY 876
             S L PRKL F DV K E PNAP++FTDSAFGFPLP++  STV+MFDHRL INVERAIY
Sbjct: 819 QISTLLPRKLIFEDVIKPEYPNAPIKFTDSAFGFPLPMIANSTVIMFDHRLNINVERAIY 878

Query: 877 RLSHLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQAG 917
           RLSHLKLS+  RELR+QVLLSNFMY+YLNLVNHTLYMEQ G
Sbjct: 879 RLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQMG 919

 Score =  157 bits (396), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 111/311 (35%), Positives = 161/311 (51%), Gaps = 59/311 (18%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIRLXXXXXXXXXXXXXXXXAHGETESYGNKENLNV 211
           WVPANQHPNVKP+NYLEL+QDTLQNI++                     +   ++  L +
Sbjct: 217 WVPANQHPNVKPENYLELIQDTLQNIQIS-------------------VDQEFDESKLEL 257

Query: 212 VNVNRGMP-RHGNASLIRRPSTLRRSYTEFDDSEGDIGQGDDDSMTVNKAKERTSRIRER 270
            N N   P R  + S++R PS L+ SY++FDD     GQ   +   V +    +     R
Sbjct: 258 GN-NHAFPNRQRSGSIVRNPSRLKTSYSKFDDEPSLAGQPQQEQEQVERRIPSSEFKSMR 316

Query: 271 PISLRDITEELTKISNSAGLTDDDAITLARTLNMAGSYSDKGDGPRSEDSRVGYEEENAK 330
            +SL++ITEELTKISN+AGLTD DA+TLAR+L+M+GS++                  N  
Sbjct: 317 SVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTSG----------------NLH 360

Query: 331 VTGSQTETPDDVEYASNMPINNDSTG-PERSSLKRSRFNTYRIRSHXXXXXXXXXXXXXX 389
           ++ +  E  +D E+ASNM  N    G PERSSL+RS+FNTY+IR                
Sbjct: 361 LSNNNAE--NDNEFASNM-FNEIGGGIPERSSLRRSKFNTYKIRLEGSGLSQASRPNSLM 417

Query: 390 XXDVSRLHLAENTIEIGINSPKSPFRQEDDESDPVSSPGSIGDFQDIYDHYTQSSGDWEK 449
              +S       +  +  +  + P +Q           GS+ DFQ+I+DHY ++S +W  
Sbjct: 418 SIQISE---GRRSASLPASYAQLPQQQ-----------GSLNDFQEIFDHYRKTSTEW-- 461

Query: 450 EMGIEKSKALE 460
             G E +K ++
Sbjct: 462 --GTENTKYVD 470

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (90%)

Query: 24 DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKF 67
          +KRKS+VLIAA+SLD EI++VKNLKRLSIGSMDL+ DPEL+ K 
Sbjct: 51 EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVFDPELEFKL 94

>Kwal_27.10318 s27 (284806..287583) [2778 bp, 925 aa] {ON} YMR273C
           (ZDS1) - peripheral plasma membrane protein [contig 36]
           FULL
          Length = 925

 Score =  171 bits (434), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 89/100 (89%)

Query: 820 VLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRLS 879
            LPPRKLTF+DV K E+PN+P++F+DS+FGFPLP LT+STVVM DHRL INVERAIYRLS
Sbjct: 810 TLPPRKLTFSDVVKPERPNSPMKFSDSSFGFPLPPLTISTVVMIDHRLTINVERAIYRLS 869

Query: 880 HLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQAGHD 919
           HLKL + KRELR+QV+LSNFMYAYLNLVNH+LY++Q   D
Sbjct: 870 HLKLGDPKRELRQQVVLSNFMYAYLNLVNHSLYLQQLEED 909

 Score =  160 bits (405), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 121/303 (39%), Positives = 146/303 (48%), Gaps = 54/303 (17%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIRLXXXXXXXXXXXXXXXXAHGETESYGNKENLNV 211
           WVPANQHPNVKP+NYLELVQDTL  + +                        GN   L  
Sbjct: 176 WVPANQHPNVKPENYLELVQDTLHTLSIDSEVEPPTDKTVE-----------GNNPYLAS 224

Query: 212 VNVNRGMP----RHGNASLIRRPSTLRRSYTEFDDSEGDIGQGDDDSMTVNKAKERTSRI 267
            N  +  P    R G  SL+RRPS LR+SYTE +D      Q D D    N   E  + I
Sbjct: 225 ANT-KASPSSQLRSGQNSLVRRPSGLRKSYTELEDLLQHEIQ-DSDENNENAQSELNNII 282

Query: 268 RERP------ISLRDITEELTKISNSAGLTDDDAITLARTLNMAGSYSDKGDGPRSEDSR 321
           + RP       SL+DITEELT+ISN AG TD DA+ LARTL+MA SY    DG       
Sbjct: 283 KNRPRATSSGSSLKDITEELTRISNKAGFTDGDAVCLARTLSMASSY----DG------- 331

Query: 322 VGYEEENAKVTGSQTETPDDVEYASNMPINNDSTGPERSSLKRSRFNTYRIRSHXXXXXX 381
              E+  A  + +   TPD  EYAS +   N    P RSSL+RS+FNTYRIR+       
Sbjct: 332 ---EQSQANQSANTDHTPDS-EYASTILTKNGLAIPARSSLRRSKFNTYRIRTPNGSSVT 387

Query: 382 XXXXXXXXXXDVSRLHLAENTIEIGINSPKSPFRQEDDESDPVSSPGSIGDFQDIYDHYT 441
                     +  R    E  IE               +SD + SP S+ DF +IYDHY 
Sbjct: 388 SSSLRSTSLPNEERKD-PEGYIE---------------KSDRLRSPTSVNDFNEIYDHYR 431

Query: 442 QSS 444
           Q S
Sbjct: 432 QGS 434

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 46/57 (80%)

Query: 11 RTTSNNRAAASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKF 67
          ++ S N   +++ +KRKSEVLIAAQSLD+E++ VKNLKR+S GSMDL +DPE++ + 
Sbjct: 18 QSVSGNTRRSARSEKRKSEVLIAAQSLDSELQHVKNLKRMSFGSMDLPLDPEMEFRM 74

>Ecym_2710 Chr2 (1373818..1376508) [2691 bp, 896 aa] {ON} similar to
           Ashbya gossypii AAL185W
          Length = 896

 Score =  170 bits (431), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 89/101 (88%)

Query: 820 VLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRLS 879
            LPPR+LTF DV + EKPN+P++FT SAFGFPLP LT+STV+MFDHRLPI  ERAIYRLS
Sbjct: 790 ALPPRELTFDDVIRPEKPNSPMKFTPSAFGFPLPPLTISTVIMFDHRLPIYAERAIYRLS 849

Query: 880 HLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQAGHDK 920
           HLKLS+ KRELR+QVLLSNFMY+YLNLVNH+LY++Q   +K
Sbjct: 850 HLKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEEEK 890

 Score =  119 bits (299), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 88/225 (39%), Positives = 119/225 (52%), Gaps = 38/225 (16%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIRLXXXXXXXXXXXXXXXXAHGETESYGNKENLNV 211
           WVPA+QHPNVK +NYLELV DTL N++L                +             N 
Sbjct: 131 WVPADQHPNVKLENYLELVTDTLHNLQLVGREQLEKNPNSNYQLSQT-----------NS 179

Query: 212 VNVNRGMPRHGNASLIRRPSTLRRSYTEFDDSEGDIGQGDDDSMTVNKAKERTSRIRERP 271
            + +  +P     SL+R+PS LR+S+TE ++   D    D+D  T     E     R+R 
Sbjct: 180 TSAHEAIPSKN--SLVRKPSRLRKSFTEAENI--DDPNSDEDLNT-----ETPISKRKRV 230

Query: 272 ISLRDITEELTKISNSAGLTDDDAITLARTLNMAGSYSDKGDGPRSEDSRVGYEEENAKV 331
            SL++ITEELT+ISN+AGLTD DAITLARTL +          P + D R          
Sbjct: 231 SSLKEITEELTRISNNAGLTDSDAITLARTLGIG--------TPAATDRR--------NF 274

Query: 332 TGSQTETPDDV--EYASNMPINNDSTGPERSSLKRSRFNTYRIRS 374
           T +   + D++  EYASN+   N  +  + SSL+RS+F TYRIRS
Sbjct: 275 TNTDVASNDEIDEEYASNILTKNGLSISQGSSLRRSKFATYRIRS 319

>TPHA0C04720 Chr3 complement(1017585..1020803) [3219 bp, 1072 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1072

 Score =  169 bits (428), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 94/197 (47%), Positives = 117/197 (59%), Gaps = 25/197 (12%)

Query: 737  ESDTESLPKLQPAISVSSTK--------------SNPRDCEEVDAKKKNKEKRSNTGKHA 782
            ES    L  LQPAI++ +T+              + P      +   KN  +R  TG ++
Sbjct: 847  ESRNTPLNGLQPAITIKTTRQPDPHTHAVAPRAETPPSGKNSANLPTKNGRQRRKTGAYS 906

Query: 783  K--HVQKEMDHEQRGQXXXXXXXXXXXXXXXXXXLRHTSVLPPRKLTFADVKKSEKPNAP 840
                V K      RGQ                     TS LP RKLTFADV  + + N P
Sbjct: 907  TSTRVSKTPKRSSRGQQASTNGNGPAPV---------TSTLPLRKLTFADVPPTGRANGP 957

Query: 841  VQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRLSHLKLSNSKRELREQVLLSNFM 900
            VQF DS FGFPLPLLT ST++MF++RLPI+VERAIYRLSHLKL ++K+ELR+QVLLSNFM
Sbjct: 958  VQFMDSTFGFPLPLLTRSTIIMFENRLPISVERAIYRLSHLKLGDTKKELRQQVLLSNFM 1017

Query: 901  YAYLNLVNHTLYMEQAG 917
            YAYL+LVNH+LY+EQ G
Sbjct: 1018 YAYLHLVNHSLYLEQYG 1034

 Score =  120 bits (302), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 136/509 (26%), Positives = 202/509 (39%), Gaps = 126/509 (24%)

Query: 26  RKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGGE--------------- 70
           R   +L A Q LD EI++V +LKR SIGSMD+LIDPEL+ +                   
Sbjct: 14  RNPAMLKAVQYLDREIKNVNHLKRFSIGSMDMLIDPELEYRISNTVTKDIESEKPKRRSV 73

Query: 71  ---SNXXXXXXXXXXXXXXXPNVTRSMNNTRYSDPTPLEKLHVQSSTETESYERCRQG-N 126
              +                PN+    +N  YS+   L  + +Q    +      RQ   
Sbjct: 74  LLLNTFASSDDVPTKAHSKAPNIGIMQSNIDYSND--LVNMSIQRRRSS-----TRQFPT 126

Query: 127 YTGHKKVVHSPSRXXXXXXXXXXXXWVPANQHPNVKPDNYLELVQDTLQNIRLXXXXXXX 186
           ++ +K+ V  P              WV A+QHPNV P   L  V   L+N+         
Sbjct: 127 FSKYKESV--PVYNEEKVDSTNAVKWVRADQHPNVSPSKQLNEV---LENL--------- 172

Query: 187 XXXXXXXXXAHGETESYGNKENLNVVNVNRGMPRHGNASLIRRPSTLRRSYTE--FD--- 241
                     H E +    K+ L++        +   +S++RRPS LR S  +  FD   
Sbjct: 173 ----------HIEDKQVTKKDRLSITY------KKNKSSIVRRPSKLRHSSNDESFDSDI 216

Query: 242 --------------DSEGDIGQGDDDSMTVNKAKER----TSRIRERPISLRDITEELTK 283
                         ++E      D   +++ +   R    ++      +SL++IT+ELT+
Sbjct: 217 EDPSFTKDHDTFSFENESSFSTNDQTDISITRFDSRDTINSNGNSNHRLSLKNITDELTR 276

Query: 284 ISNSAGLTDDDAITLARTLNMAGSYS--------DKG----DGPRSEDSRVGYEEENAKV 331
           ISN AGL D DAI LA++L +  SY         DK     D   +E S +    E  K+
Sbjct: 277 ISNDAGLVDSDAINLAQSLGLTSSYQNNINDFYDDKNLAIYDSTINESSNMETFNEQDKI 336

Query: 332 TGSQTETPDDVEYASN-MPINNDSTGPERSSLKRSRFNTYRIRSHXXXXXXXXXXXXXXX 390
               +E      +A N M +      P RSSL+RS+FNTYR   +               
Sbjct: 337 LNLNSENSKGGTFAVNGMKV------PMRSSLRRSKFNTYRYSRNNQKDSDIPEKKEIEN 390

Query: 391 XDVSRLHLAE---NTIEIGI------NSPKSPFRQEDD-------------------ESD 422
             +   H++E   +  EI +      N+  SP R  D                    ++D
Sbjct: 391 PYMGSQHISEEKSDVTEIQVALSNNQNALVSPERNNDKISFKDSQKDYLTKPIEEKADAD 450

Query: 423 PVSSPGSIGDFQDIYDHYTQSSGDWEKEM 451
             S    + DFQDIYDHY Q S +WE E+
Sbjct: 451 EQSGSSPVSDFQDIYDHYRQPSSEWEDEI 479

>CAGL0J06688g Chr10 complement(640041..642527) [2487 bp, 828 aa]
           {ON} similar to uniprot|P54786 Saccharomyces cerevisiae
           YML109w ZDS2 or uniprot|P50111 Saccharomyces cerevisiae
           YMR273c ZDS1
          Length = 828

 Score =  168 bits (425), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 76/99 (76%), Positives = 87/99 (87%)

Query: 823 PRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRLSHLK 882
           P+KLTF DVKK E+ NAP++FTDSAFGFPLP LT+STV+M DHRL INVERAIYRLSHLK
Sbjct: 696 PKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERAIYRLSHLK 755

Query: 883 LSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQAGHDKE 921
           LS + RELR+QVLLSNFMYAYLNLV HTL +E+A  DK+
Sbjct: 756 LSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEAEQDKQ 794

 Score =  137 bits (344), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 129/223 (57%), Gaps = 25/223 (11%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIRLXXXXXXXXXXXXXXXXAHGETESYGNKENLNV 211
           WVPANQHPNVKP+NYLELV++TL  IR                  +   E   NKEN+N 
Sbjct: 176 WVPANQHPNVKPENYLELVKETLNKIR-------DINTDGKEKSENNSEEEVSNKENINE 228

Query: 212 VNVNRGMPRHGNASLIRRPSTLRRSYTEFDDSEGDIGQGDDDSMTVNKAKERTSRIRERP 271
               RG       S++RRPS LR+SYTEF   + ++    D +++ N+     +    + 
Sbjct: 229 NGRLRG-------SIVRRPSKLRKSYTEFSSEDLELL---DKALSNNRIISTRNTTNSKR 278

Query: 272 ISLRDITEELTKISNSAGLTDDDAITLARTLNMAGSYSDKGDGPRSEDSRVGYEEENAKV 331
           +SL++IT EL K SN AGLTDD+A+TLARTL++A S +++ +  R++ S    ++     
Sbjct: 279 LSLKEITNELVKHSNKAGLTDDNAVTLARTLSIASSVTNQNETGRNDQSNTEQQK----- 333

Query: 332 TGSQTETPDDVEYASNMPINNDSTGPERSSLKRSRFNTYRIRS 374
              Q+E  DD  +A+ +  N+ S     SSL+RS+FNTYR+++
Sbjct: 334 ---QSEDADDDTFATAVVGNSHSLASNTSSLRRSKFNTYRVKA 373

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/53 (56%), Positives = 39/53 (73%)

Query: 17 RAAASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGG 69
          R+   + D   SE L AAQSLD E+++VKNLKRLSIGS+DL+ DPEL++   G
Sbjct: 10 RSRVQKTDGVSSEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTVTG 62

>TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1086

 Score =  164 bits (415), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 75/99 (75%), Positives = 86/99 (86%), Gaps = 2/99 (2%)

Query: 823  PRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRLSHLK 882
            P KL+F+DVK+ +KPN  + FTDSAFGFPLPLLT STV+MFD+RLPI+VERAIYRLSHLK
Sbjct: 968  PHKLSFSDVKRLDKPNGTMIFTDSAFGFPLPLLTNSTVIMFDYRLPISVERAIYRLSHLK 1027

Query: 883  LSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQAG--HD 919
            LS  KR LR+QVLLSNFMYAYL+LVNHTLYME+    HD
Sbjct: 1028 LSEPKRTLRQQVLLSNFMYAYLHLVNHTLYMEKYAKSHD 1066

 Score =  141 bits (356), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 125/375 (33%), Positives = 177/375 (47%), Gaps = 50/375 (13%)

Query: 26  RKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGGESNXXXXXXXXXXXXX 85
           R+ E+LIAAQ+LD E++SVK LKR SIGS DL+ DPEL+  F   +N             
Sbjct: 36  REDELLIAAQTLDFEVQSVKELKRFSIGSNDLVGDPELE--FRVNTNVNDLSTNDVSLVK 93

Query: 86  XXPNVTRSMNNTRYSDPTPLEKLHVQSSTETESYERCRQGNYTGHKKVVHSPSRXXXXXX 145
              +++R    ++ +  T L +   QS+++     R      +  K+  H          
Sbjct: 94  RSASLSRGSTISKRTANTSLRR--GQSTSKVSYNGRISYNKSSMPKQHTHQTLDDDIDNE 151

Query: 146 X---XXXXXWVPANQHPNVKPDNYLELVQDTLQNIRLXXXXXXXXXXXXXXXXAHGETES 202
                    WVPA+QHPN KP N   + QD+L N  L                   + E 
Sbjct: 152 NVPISKNLLWVPASQHPNAKPKN---INQDSLLNNGLVQDSNSDLDT---------QEEL 199

Query: 203 YGNKENLNVVNVNRGMPRHGNASLIRRPSTLRRSYTEFDDSEGDIGQG------------ 250
             NK  LN         R  N SL+R+PSTLR+SYT+F D + D  +             
Sbjct: 200 QRNKSYLN--------SRRKNNSLVRKPSTLRKSYTDFTDDDSDYNRSREANTSNNSRNT 251

Query: 251 DDDSMTVNKAKERTSRIRERPISLRDITEELTKISNSAGLTDDDAITLARTLNMAGSYSD 310
            D+ M   KA    S   +   SL DI EEL+KISNSAGLT+ +A TLAR+L++ G Y +
Sbjct: 252 SDNEMNNLKASHGNSPSADSTFSLNDIKEELSKISNSAGLTETNAATLARSLSITGKYIN 311

Query: 311 K-----GDGPRSEDSRVGYEEENAKVTGSQT--ETPD----DVEYASNMPINNDSTGPER 359
           +      D   + D      + N  +    T  + PD    D E+AS++ +  +   P R
Sbjct: 312 RELLEEDDEASTSDDNNDANDINTSIEDKSTLKQIPDLNEVDGEFASHILLTKNVNVPVR 371

Query: 360 SSLKRSRFNTYRIRS 374
           SSL+R +FNTYR+RS
Sbjct: 372 SSLRRKKFNTYRVRS 386

 Score = 32.3 bits (72), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 46/114 (40%), Gaps = 36/114 (31%)

Query: 432 DFQDIYDHYTQSSGDWEKEMGIEKSKALE---------------GGK------------- 463
           D QDIY+HY Q S D E+ +   KSK  E               G +             
Sbjct: 505 DIQDIYNHYRQPSSDDEEILKYLKSKDNEETTHKEVETDFSHSSGSQESINISSSPSPET 564

Query: 464 ---VEDNAVE----QELEPQEESTGTVVSGTTDDSKETKRHR-RRNGWTWLNNK 509
              V DN++       +     ST        D   +++RH+ +R+GW+W++N+
Sbjct: 565 IVTVPDNSIAGLNTNAISNSNISTLKSTISNIDSKLQSRRHKHKRHGWSWVSNQ 618

>TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1682

 Score =  156 bits (394), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 83/92 (90%)

Query: 825  KLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRLSHLKLS 884
            KLTFADVK++ +PN+ + F +SAFGFPLP LT ST++M D+RLPINVERAIYRLSHLKLS
Sbjct: 1430 KLTFADVKRNLQPNSSMIFQESAFGFPLPPLTNSTIIMIDNRLPINVERAIYRLSHLKLS 1489

Query: 885  NSKRELREQVLLSNFMYAYLNLVNHTLYMEQA 916
            + KRELREQVLLSNFMY+YL+LVNHTLY+EQ 
Sbjct: 1490 DPKRELREQVLLSNFMYSYLHLVNHTLYLEQV 1521

 Score = 87.8 bits (216), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 97/358 (27%), Positives = 161/358 (44%), Gaps = 57/358 (15%)

Query: 152 WVPANQHPNVKPDNYLELVQDTLQNIRLXXXXXXXXXXXXXXXXAHGETESYGNKENLNV 211
           W   N+  ++KPDNY+ELV D + +                     G++  Y N  +   
Sbjct: 370 WSSVNKRSSLKPDNYIELVNDAINSSN--NVSVTTNSTPTANKIEQGDSY-YDNIPDSRK 426

Query: 212 VNVNRGMPRHGNASLIRRPSTLRRSYTEFD----------------DSEGDIGQGD---- 251
           V   R        S +RRPS+LR SYT+ D                +S  ++   D    
Sbjct: 427 VKYRRN-------SNVRRPSSLRNSYTDLDFNLADYEDNLNISNVSNSIDEVSNNDHQLT 479

Query: 252 -DDSMTVNKAKERTSRIRERPISLRDITEELTKISNSAGLTDDDAITLARTLNMAGSYSD 310
            DDS   N     T+      ++L+D+T+ELTK+SN+AGLTD DAITLA+TL++     D
Sbjct: 480 PDDSF--NFDANVTNNSVASNLTLKDLTDELTKLSNNAGLTDSDAITLAKTLSLNERLLD 537

Query: 311 KGDGPRSEDSRVGYEEENAKV-----------TGSQTE--TPDDVEYASNMPINNDSTGP 357
                 S  +   Y+     +             +Q E    DD EYASN+  +++    
Sbjct: 538 NTTTVNSNTNVKRYKSNKINLFNEDNINNIPNNMNQDEEIVEDDKEYASNLNYDDNINIS 597

Query: 358 ERSSLKRSRFNTYRIRSHXXXXXXXXXXXXXXXXDVS----RLHLAENTIEI--GINSPK 411
            RS+LKR++F +   R +                D S     + ++++TI++   I++ +
Sbjct: 598 NRSTLKRNKFKSATSRGNSSEESNLQLDLETIKRDPSNNMPNIIISKSTIDVNDSIDNAE 657

Query: 412 SPFRQEDDESDPVSSPGSIG-DFQDIYDHYTQSSGDWEKEMGIEKSKALEGGKVEDNA 468
           S  ++  D ++ +++  ++     +IYDHY Q+SGDW  ++     KA E  +V+ N 
Sbjct: 658 SNNKKFLDSNEMLNNQLNVSPSASEIYDHYRQTSGDWTDDLN----KAREQFQVDPNG 711

 Score = 61.6 bits (148), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%)

Query: 11 RTTSNNRAAASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDI 65
          R+ S NR +   R KR S+V IAAQSLD ++++VK LKR SIGS+DLL DP+L++
Sbjct: 20 RSKSQNRKSLLDRQKRNSDVRIAAQSLDLQVQNVKKLKRQSIGSIDLLADPDLEL 74

>Skud_14.8 Chr14 (9768..9905,9909..9914,9918..9926,9930..9998) [222
           bp, 74 aa] {ON} YMR273C (REAL)
          Length = 74

 Score = 72.0 bits (175), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 44/79 (55%), Positives = 52/79 (65%), Gaps = 7/79 (8%)

Query: 228 RRPSTLRRSYTEFDDSEGDIGQGDDDSMTVNKAKERTSRIRERPI--SLRDITEELTKIS 285
           RR STLR SYTEFDD E + GQ + DS  VNK +ERTSRIRE     +L++      KIS
Sbjct: 1   RRSSTLRSSYTEFDDIEDENGQRNKDSKFVNKVEERTSRIRENECHETLKN-----KKIS 55

Query: 286 NSAGLTDDDAITLARTLNM 304
           NSA LTD   I L RTL++
Sbjct: 56  NSASLTDIGVIALVRTLSI 74

>YOR274W Chr15 (837674..838960) [1287 bp, 428 aa] {ON}  MOD5Delta
           2-isopentenyl pyrophosphate:tRNA isopentenyl
           transferase; required for biosynthesis of the modified
           base isopentenyladenosine in mitochondrial and
           cytoplasmic tRNAs; gene is nuclear and encodes two
           isozymic forms; converts to a prion form, and prion
           conversion contributes to azole antifungal resistance by
           upregulating ergosterol biosynthesis
          Length = 428

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 47/87 (54%), Gaps = 10/87 (11%)

Query: 395 RLHLAENTIEIGINS-PKSPFRQEDDESDPVSSPGSIGDFQDIYDHYTQS--------SG 445
           ++ L  +T+ + + S P+  F++ DD  D +   G++ + + +Y++Y+Q+        +G
Sbjct: 194 KITLKFDTLFLWLYSKPEPLFQRLDDRVDDMLERGALQEIKQLYEYYSQNKFTPEQCENG 253

Query: 446 DWEKEMGIEKSKALEGGKVEDNAVEQE 472
            W+  +G ++      GK +DN V+ E
Sbjct: 254 VWQ-VIGFKEFLPWLTGKTDDNTVKLE 279

>TDEL0A02030 Chr1 (367215..367853) [639 bp, 212 aa] {ON} Anc_2.427
           YMR117C
          Length = 212

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 34/77 (44%)

Query: 392 DVSRLHLAENTIEIGINSPKSPFRQEDDESDPVSSPGSIGDFQDIYDHYTQSSGDWEKEM 451
           ++SRL +     E  +NS      Q  DES  + S   + DF    D   QS  D    +
Sbjct: 54  EISRLEIQLKNSESRVNSLSKDLNQIKDESQDLVSNNDVVDFVKELDELEQSIVDLRSNL 113

Query: 452 GIEKSKALEGGKVEDNA 468
           G + +K ++G +V  N 
Sbjct: 114 GEKVAKFVQGSEVSSNG 130

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.126    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 82,791,145
Number of extensions: 3378361
Number of successful extensions: 12798
Number of sequences better than 10.0: 75
Number of HSP's gapped: 13155
Number of HSP's successfully gapped: 138
Length of query: 931
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 812
Effective length of database: 39,836,145
Effective search space: 32346949740
Effective search space used: 32346949740
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 71 (32.0 bits)