Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_13.4228.773ON45845824400.0
YMR238W (DFG5)8.773ON45845822480.0
Smik_13.4468.773ON45845821740.0
Skud_13.4078.773ON45845821600.0
NDAI0K008408.773ON45944518630.0
CAGL0M05049g8.773ON45345418340.0
NCAS0C008108.773ON45145118120.0
SAKL0B05412g8.773ON45145118020.0
KAFR0B034908.773ON45145318000.0
Kpol_1030.208.773ON45145217840.0
TDEL0B033608.773ON43643517620.0
TBLA0B033208.773ON45044617580.0
Kwal_55.202668.773ON45744317090.0
KLLA0F24926g8.773ON45145317030.0
TPHA0J016008.773ON46145416950.0
KLTH0E04048g8.773ON45445316810.0
KNAG0J007008.773ON46343916790.0
ZYRO0F12210g8.773ON45345216010.0
AFR530W8.773ON45946015320.0
Ecym_14748.773ON45445415070.0
NCAS0A08740singletonON43439914800.0
ACL200WsingletonON46345814810.0
ACL201WsingletonON44843514590.0
NCAS0A08730singletonON63138114250.0
TBLA0C03850singletonON56738213560.0
ACL202WsingletonON45039613370.0
SAKL0D13574g2.570ON45145213021e-177
KLTH0D08008g2.570ON44843812841e-175
KLLA0E07723g2.570ON45045412651e-172
Suva_11.1802.570ON45044612611e-171
YKL046C (DCW1)2.570ON44943712571e-170
Smik_11.2022.570ON44944412541e-170
Skud_11.1832.570ON44944412481e-169
Kwal_26.82252.570ON44945312461e-169
NDAI0B015102.570ON44745212421e-168
TPHA0I024702.570ON45244212241e-165
KAFR0I017402.570ON44845312211e-165
NDAI0C006802.570ON45244312201e-165
NCAS0H029002.570ON45345412191e-165
NCAS0A127502.570ON44744512121e-164
TBLA0H02590singletonON45045211981e-162
TBLA0H02580singletonON44944311961e-161
KAFR0A021702.570ON44944611921e-161
TDEL0B065802.570ON44745011571e-155
CAGL0L01727g2.570ON44644311491e-154
TBLA0H026002.570ON44943511461e-154
Kpol_1056.42.570ON45042911241e-150
Ecym_45772.570ON45043511241e-150
ABR060W2.570ON45143411241e-150
ZYRO0E06380g2.570ON45344411101e-148
KNAG0A071802.570ON46340511101e-148
SAKL0C05918g1.199ON875100713.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_13.422
         (458 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238...   944   0.0  
YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putat...   870   0.0  
Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238...   842   0.0  
Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238...   836   0.0  
NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {...   722   0.0  
CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} simil...   711   0.0  
NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {O...   702   0.0  
SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly...   698   0.0  
KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.7...   697   0.0  
Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 b...   691   0.0  
TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {O...   683   0.0  
TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {O...   681   0.0  
Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {...   662   0.0  
KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]...   660   0.0  
TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {...   657   0.0  
KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {...   652   0.0  
KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {...   651   0.0  
ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} simila...   621   0.0  
AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic ...   594   0.0  
Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar t...   585   0.0  
NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON}            574   0.0  
ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic ...   575   0.0  
ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic ...   566   0.0  
NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON}            553   0.0  
TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON}              526   0.0  
ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic ho...   519   0.0  
SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} high...   506   e-177
KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly...   499   e-175
KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {...   491   e-172
Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {...   490   e-171
YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON} ...   488   e-170
Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {...   487   e-170
Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {...   485   e-169
Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C...   484   e-169
NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {O...   483   e-168
TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.5...   476   e-165
KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {O...   474   e-165
NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {O...   474   e-165
NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570    474   e-165
NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON} Anc_2...   471   e-164
TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {O...   466   e-162
TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {O...   465   e-161
KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.5...   463   e-161
TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON} Anc_2...   450   e-155
CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa] ...   447   e-154
TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {O...   446   e-154
Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON} ...   437   e-150
Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {O...   437   e-150
ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic ho...   437   e-150
ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} simila...   432   e-148
KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON}            432   e-148
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    32   3.8  

>Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  944 bits (2440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/458 (100%), Positives = 458/458 (100%)

Query: 1   MIVKASMKIALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGT 60
           MIVKASMKIALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGT
Sbjct: 1   MIVKASMKIALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGT 60

Query: 61  VGMFQSPYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEG 120
           VGMFQSPYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEG
Sbjct: 61  VGMFQSPYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEG 120

Query: 121 NDDQGIWGITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTW 180
           NDDQGIWGITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTW
Sbjct: 121 NDDQGIWGITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTW 180

Query: 181 NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGA 240
           NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGA
Sbjct: 181 NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGA 240

Query: 241 EIDTNCTDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMY 300
           EIDTNCTDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMY
Sbjct: 241 EIDTNCTDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMY 300

Query: 301 ESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDG 360
           ESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDG
Sbjct: 301 ESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDG 360

Query: 361 HTCGLDWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSST 420
           HTCGLDWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSST
Sbjct: 361 HTCGLDWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSST 420

Query: 421 TSVLQNNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458
           TSVLQNNLNITKGDRAGAAIITAVILSVLIGGAVWMLF
Sbjct: 421 TSVLQNNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458

>YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putative
           mannosidase, essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis in bud formation, involved in filamentous
           growth, homologous to Dcw1p
          Length = 458

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/458 (90%), Positives = 438/458 (95%)

Query: 1   MIVKASMKIALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGT 60
           MIV  S K+ L +CFT LSFFKAT AMDLDTTS TSICDATALIQ GMLDYYEGTRYGGT
Sbjct: 1   MIVNISAKMILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGT 60

Query: 61  VGMFQSPYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEG 120
           VGMFQSPYYWWHAGEAFGGM+ENW+LC+NDTYQ LLYDALLAQTG++YDYIP+NQTMVEG
Sbjct: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEG 120

Query: 121 NDDQGIWGITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTW 180
           NDDQGIWGITVMGAVERNFT+P +G PGWLAMVQAVFNTMYSRWDSE+CGGGLRWQIFTW
Sbjct: 121 NDDQGIWGITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180

Query: 181 NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGA 240
           NSGYNYKNT+SNACLFQIAARLGRYTGNTTYL+VAEQVFDWLVDVGYVVLNDTANV+DGA
Sbjct: 181 NSGYNYKNTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGA 240

Query: 241 EIDTNCTDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMY 300
           EIDTNCTDITKIEWTYNHGIVLGG+AYMYNATNGT EW+TSL ++LNGA SYFFKD IMY
Sbjct: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMY 300

Query: 301 ESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDG 360
           ESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFT DTID LIKTSAEAAAKSC+GGTDG
Sbjct: 301 ESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDG 360

Query: 361 HTCGLDWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSST 420
           HTCGL+W+K+TNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSST
Sbjct: 361 HTCGLNWQKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSST 420

Query: 421 TSVLQNNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458
           T+VLQNNLNI KGDRAGAAIITAVILSVL GGAVWMLF
Sbjct: 421 TNVLQNNLNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458

>Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  842 bits (2174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/458 (89%), Positives = 437/458 (95%)

Query: 1   MIVKASMKIALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGT 60
           MI+K+SM++   +CFTLLSFF+   AM+LD+TS TSICDATALIQDGMLDYYEGTRYGG 
Sbjct: 1   MILKSSMEMIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGA 60

Query: 61  VGMFQSPYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEG 120
           VGMFQSPYYWWHAGEAFGGM+ENW+LC+NDTYQ LLYDALLAQTG++YDYIPANQTMVEG
Sbjct: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEG 120

Query: 121 NDDQGIWGITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTW 180
           NDDQGIWGITVMGAVERNFT+P +G PGWLAMVQAVFNTMYSRWDSE+CGGGLRWQIFTW
Sbjct: 121 NDDQGIWGITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180

Query: 181 NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGA 240
           NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANV+DGA
Sbjct: 181 NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGA 240

Query: 241 EIDTNCTDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMY 300
           EIDTNCTDITKIEWTYNHGIVLGG+AYMYNATNGTSEW+TSL ++LNGA SYFFKD IMY
Sbjct: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMY 300

Query: 301 ESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDG 360
           ESACQDY TCNTDQRTFKSIFSRMLGLTSVMAP+TSDTID LIKTSAEAAAKSCDGG DG
Sbjct: 301 ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDG 360

Query: 361 HTCGLDWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSST 420
           HTCGL+W K+TNDGYYGLGEQM+ALEVIQNLLIHDRPAPYKE NGGTSKGDANAGMNSST
Sbjct: 361 HTCGLNWGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST 420

Query: 421 TSVLQNNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458
           T+VLQNNLNI  GDRAGAAIITA+ILSVLIGGAVWMLF
Sbjct: 421 TNVLQNNLNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458

>Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/458 (89%), Positives = 435/458 (94%)

Query: 1   MIVKASMKIALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGT 60
           MIV +SM++   +CFT LSF   + AMDLDTTS TSICDATALIQDGMLDYY+GTRYGG 
Sbjct: 1   MIVDSSMRMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGA 60

Query: 61  VGMFQSPYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEG 120
           VGMFQSPYYWWHAGEAFGGM+ENW+LC+N+TYQ LLYDALLAQTG++YDYIPANQTMVEG
Sbjct: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEG 120

Query: 121 NDDQGIWGITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTW 180
           NDDQGIWGITVMGAVERNFT+PD G PGWLAMVQAVFNTMYSRWDSE+CGGGLRWQIFTW
Sbjct: 121 NDDQGIWGITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180

Query: 181 NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGA 240
           NSGYNYKNT+SNACLFQIAARLGRYTGN+TYLDVAEQVFDWLVDVGYVVLNDTANV+DGA
Sbjct: 181 NSGYNYKNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGA 240

Query: 241 EIDTNCTDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMY 300
           EIDTNCTDITKIEWTYNHGIVLGG+AYMYNATNGTSEW+T L Q+LNGA +YFFKD IMY
Sbjct: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMY 300

Query: 301 ESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDG 360
           ESACQDY TCNTDQRTFKSIFSRMLGLTSVMAPFTSDTID LIKTSAEAAAKSC+GGTDG
Sbjct: 301 ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDG 360

Query: 361 HTCGLDWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSST 420
           HTCGLDW K+T+DGYYGLGEQMSALEVIQNLLIHDRPAPYKE NGGTSKGDANAGMNSST
Sbjct: 361 HTCGLDWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST 420

Query: 421 TSVLQNNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458
           T+VLQNNLNITKG RAGAAIITA+ILSVLIGGAVWMLF
Sbjct: 421 TNVLQNNLNITKGGRAGAAIITAIILSVLIGGAVWMLF 458

>NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {ON}
           Anc_8.773
          Length = 459

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/445 (76%), Positives = 396/445 (88%), Gaps = 1/445 (0%)

Query: 15  FTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAG 74
           F LL     T A+DLD TS  SICDAT+LIQ GM+DYY GT+YGGTVGMFQ PYYWW AG
Sbjct: 15  FQLLLTVHNTQAIDLDITSKESICDATSLIQGGMMDYYWGTQYGGTVGMFQPPYYWWEAG 74

Query: 75  EAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGA 134
           EAFGGM+ENWYLCQNDTY+ +L  ALLAQTG++YDYIPANQ+MVEGNDDQG+WG+T+MGA
Sbjct: 75  EAFGGMIENWYLCQNDTYEDMLKSALLAQTGSNYDYIPANQSMVEGNDDQGVWGLTLMGA 134

Query: 135 VERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNAC 194
            ERNFT+PD+G PGWLAM QAVFNTM +RWDS +CGGGLRWQIFTWNSGYNYKNTISNAC
Sbjct: 135 AERNFTDPDDGTPGWLAMTQAVFNTMNARWDSAHCGGGLRWQIFTWNSGYNYKNTISNAC 194

Query: 195 LFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTDITKIEW 254
           LFQ+AARLGRYTGNTTYL+VAE+VF WLVDVGYV+L+DTANV+DGAEID+NCTD+T+IEW
Sbjct: 195 LFQLAARLGRYTGNTTYLEVAEKVFTWLVDVGYVLLDDTANVFDGAEIDSNCTDMTQIEW 254

Query: 255 TYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFF-KDGIMYESACQDYGTCNTD 313
           TYNHG+VLGG AYMYNATNG+S+W++ + ++L GA +YFF  +GIM+E+ACQ+Y TCN D
Sbjct: 255 TYNHGVVLGGAAYMYNATNGSSDWESRVTKLLKGATTYFFDSNGIMFENACQEYNTCNND 314

Query: 314 QRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETND 373
           QR+FKSIFSRMLGLTSV+APFTSDT+D LIKTSA AAAKSC GGTDGHTCGL+W K ++D
Sbjct: 315 QRSFKSIFSRMLGLTSVLAPFTSDTVDPLIKTSAAAAAKSCTGGTDGHTCGLNWAKGSHD 374

Query: 374 GYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNLNITKG 433
           GYYGLGEQM ALEV+QNLLIHDRPAP   + GG+SKGDA AG+NS+TT+VL+N + IT G
Sbjct: 375 GYYGLGEQMCALEVMQNLLIHDRPAPLTGNTGGSSKGDALAGLNSTTTNVLENKMTITNG 434

Query: 434 DRAGAAIITAVILSVLIGGAVWMLF 458
           DRAGAAI+TA+IL VL GGAVWM F
Sbjct: 435 DRAGAAIVTAIILGVLTGGAVWMFF 459

>CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046c or
           uniprot|Q05031 Saccharomyces cerevisiae YMR238w DFG5
          Length = 453

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/454 (74%), Positives = 388/454 (85%), Gaps = 3/454 (0%)

Query: 7   MKIALPLCFTLL--SFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMF 64
           MK+   L   +L  + F    A++L   +  SIC ATALIQ GMLDYYEGTRYGGTVGMF
Sbjct: 1   MKLLFSLQLWVLIGTLFPDAGAINLQD-NKDSICAATALIQGGMLDYYEGTRYGGTVGMF 59

Query: 65  QSPYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQ 124
           Q PYYWW AG AFGGM+ENW+LCQNDTY+ LL +AL+AQTG +YDYIPANQT VEGNDDQ
Sbjct: 60  QPPYYWWQAGVAFGGMLENWFLCQNDTYKDLLMNALVAQTGPNYDYIPANQTTVEGNDDQ 119

Query: 125 GIWGITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGY 184
           G+WG+T++ AVERNF+ P +G PGWLAM Q +FNTMY+RWD ++C GGLRWQIFTWNSGY
Sbjct: 120 GVWGLTILDAVERNFSAPIDGKPGWLAMSQGIFNTMYARWDMQSCNGGLRWQIFTWNSGY 179

Query: 185 NYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDT 244
           NYKNTISNACLFQIAARLGRYTGNTTYLDVAE+VFDWLV VGY+VL++  NVYDGA+++ 
Sbjct: 180 NYKNTISNACLFQIAARLGRYTGNTTYLDVAERVFDWLVGVGYIVLSEKGNVYDGAKVED 239

Query: 245 NCTDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESAC 304
           NCTDIT IEWTYNHG+VLGG+AYMYNATNG+S W++ L  VL GA +YFF+D IMYESAC
Sbjct: 240 NCTDITAIEWTYNHGVVLGGLAYMYNATNGSSVWQSRLTSVLGGATAYFFQDDIMYESAC 299

Query: 305 QDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCG 364
           Q Y TCN DQR FKSIFSRMLG TSV+APFTSDTID L+K SA AAA SCDGGTDGHTCG
Sbjct: 300 QPYKTCNNDQRCFKSIFSRMLGFTSVLAPFTSDTIDPLLKASAMAAAGSCDGGTDGHTCG 359

Query: 365 LDWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVL 424
           LDW+ +TNDGYYGLGEQMSALEVIQ LLIH+RPAPY+ DNGGTS GDA AG+NS+TT+VL
Sbjct: 360 LDWQLKTNDGYYGLGEQMSALEVIQQLLIHERPAPYRADNGGTSVGDAAAGLNSTTTNVL 419

Query: 425 QNNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458
           +NNL IT GDRAGAAI+T ++L ++IGGA WM+F
Sbjct: 420 KNNLKITGGDRAGAAIVTTIVLGIIIGGAAWMMF 453

>NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {ON}
           Anc_8.773
          Length = 451

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/451 (72%), Positives = 384/451 (85%), Gaps = 6/451 (1%)

Query: 9   IALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPY 68
           I+  L   LL       ++DLD TS  SIC ATALIQ GMLDYYEG RYGG VGMFQ PY
Sbjct: 6   ISFVLLLPLL-----VQSIDLDVTSKDSICAATALIQKGMLDYYEGERYGGAVGMFQPPY 60

Query: 69  YWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWG 128
           YWW+ G AFGGM+EN YLC+N+T++ LL DAL+AQTG +YDYIP+NQ+MVEGNDDQG+WG
Sbjct: 61  YWWNGGVAFGGMLENMYLCENNTFESLLMDALVAQTGDNYDYIPSNQSMVEGNDDQGVWG 120

Query: 129 ITVMGAVERNFTNPD-NGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYK 187
           +T+M AVERNFT P+ +G PGWLAM QAVFNTMY+RWD ++CGGGLRWQIFTWNSGYNYK
Sbjct: 121 LTIMDAVERNFTAPNKSGVPGWLAMAQAVFNTMYARWDPDHCGGGLRWQIFTWNSGYNYK 180

Query: 188 NTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCT 247
           NTI+NACLFQ+AARLGRYTGN TYLDVAE+VFDW+VD+ Y+VLND ANV+DGA+ID NCT
Sbjct: 181 NTIANACLFQMAARLGRYTGNQTYLDVAEKVFDWMVDINYIVLNDKANVFDGADIDENCT 240

Query: 248 DITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDY 307
           DIT +EWTYNHG+VLGG AYMYNATNG+S W+T + ++L GA  YFF+D +M ESACQ Y
Sbjct: 241 DITTLEWTYNHGVVLGGCAYMYNATNGSSTWETRVNKILAGAQEYFFQDNVMLESACQSY 300

Query: 308 GTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDW 367
            TCN DQR FKSIFSRMLG TSV+APFT++TID LIK SAEAAA SC GG DGHTCGLDW
Sbjct: 301 NTCNNDQRCFKSIFSRMLGFTSVLAPFTAETIDPLIKASAEAAATSCTGGKDGHTCGLDW 360

Query: 368 EKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNN 427
            K +NDGYYGLGEQM+ALE++ NLLIHDRPAP   + GGTS+GDA+AG+NS+TT+VL+N 
Sbjct: 361 TKGSNDGYYGLGEQMNALEIMSNLLIHDRPAPLTANTGGTSEGDASAGLNSTTTNVLENK 420

Query: 428 LNITKGDRAGAAIITAVILSVLIGGAVWMLF 458
           L IT+GDRAGAAI+TAVIL + +GGAVWMLF
Sbjct: 421 LKITQGDRAGAAIVTAVILGIFVGGAVWMLF 451

>SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/451 (72%), Positives = 382/451 (84%), Gaps = 2/451 (0%)

Query: 9   IALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPY 68
           I+L +    +S      A+DLDT+S  SIC AT+LIQ GMLDYYEGT+YGGTVGMFQ PY
Sbjct: 2   ISLLISLIYMSL-NIVHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPY 60

Query: 69  YWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWG 128
           YWW AGEAFGGM++N YLC N+TY+ L+YDA++AQTG +YDYIPANQ+MVEGNDDQG+WG
Sbjct: 61  YWWQAGEAFGGMLDNIYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWG 120

Query: 129 ITVMGAVERNFTNP-DNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYK 187
           IT+MGAVERNFTNP   G PGWLAMVQAVFNTMY+RWDS++CGGGLRWQIFTWNSGYNYK
Sbjct: 121 ITIMGAVERNFTNPTKEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYK 180

Query: 188 NTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCT 247
           NTI+N CLFQIAARLGRYTGN TYL+VA +V+DWL DVG+VVL D ANV+DGA I+ NC+
Sbjct: 181 NTIANGCLFQIAARLGRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCS 240

Query: 248 DITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDY 307
            I KIEWTYNHG+VLGG AYMYNATNG+  W+T L QVL+GA  +FF + IMYE ACQ  
Sbjct: 241 SIVKIEWTYNHGVVLGGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGS 300

Query: 308 GTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDW 367
           GTCN DQR+FKSIFSRMLGLTSV+APFT DTID LIK SAE AA+SC GGTDGHTCGLDW
Sbjct: 301 GTCNNDQRSFKSIFSRMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDW 360

Query: 368 EKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNN 427
               +DGYYGLGEQMSALE++QNLLI D P P+  DNGG+S GD NAG+NSS+ +VL+NN
Sbjct: 361 TLGHHDGYYGLGEQMSALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENN 420

Query: 428 LNITKGDRAGAAIITAVILSVLIGGAVWMLF 458
           L+IT  DR GAAIITA++L V+IGG+VWM+F
Sbjct: 421 LSITHKDRVGAAIITAIVLGVMIGGSVWMVF 451

>KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.773
           YMR238W
          Length = 451

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/453 (72%), Positives = 386/453 (85%), Gaps = 5/453 (1%)

Query: 9   IALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPY 68
           + + L F LL       A+DLDT+S TSICDATALIQDGMLDYYEG RYGGTVGMFQSPY
Sbjct: 1   MMITLLFPLL--LTVAKAIDLDTSSKTSICDATALIQDGMLDYYEGIRYGGTVGMFQSPY 58

Query: 69  YWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWG 128
           YWW AGEAFGGM+ENW+LC+NDT++ ++YDA+LAQTG+DYD++P NQTMVEGNDDQ +WG
Sbjct: 59  YWWEAGEAFGGMLENWFLCENDTFKEIIYDAILAQTGSDYDFMPENQTMVEGNDDQCVWG 118

Query: 129 ITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKN 188
           +T+M AVERNFT+P +G+PGWL M QA+FN M+SRWDS NCGGGLRWQIFTWNSGY+YK+
Sbjct: 119 LTIMDAVERNFTDPTDGSPGWLYMTQAIFNEMWSRWDSANCGGGLRWQIFTWNSGYDYKS 178

Query: 189 TISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYV-VLNDTANVYDGAEIDTNCT 247
           TISN CLFQ+A+RLGRYTGN TYLDVAE V+DWLVDVG++ V N TA VYDGA+I  NCT
Sbjct: 179 TISNVCLFQLASRLGRYTGNDTYLDVAESVYDWLVDVGFINVANGTAYVYDGADISENCT 238

Query: 248 DITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDY 307
           DIT I+W+YNHGI+LGG AY YNATNG+S W++ +  ++ GA S FF DGIMYESACQDY
Sbjct: 239 DITTIDWSYNHGILLGGAAYAYNATNGSSVWESRVTDIVEGAKSIFFSDGIMYESACQDY 298

Query: 308 GTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDW 367
            TCN DQR+FKSIFSRMLG TSV+APFT+ TID LIK+SA A A SCDGGTDGHTCGL+W
Sbjct: 299 DTCNNDQRSFKSIFSRMLGFTSVLAPFTASTIDPLIKSSAAACALSCDGGTDGHTCGLNW 358

Query: 368 EKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTS--VLQ 425
           + +T DG YGLGEQMSALEVIQNLLIHDRPAPY    GG+S GDA+AG+N++T+S  VL+
Sbjct: 359 QDKTCDGNYGLGEQMSALEVIQNLLIHDRPAPYTASTGGSSVGDASAGLNTTTSSADVLE 418

Query: 426 NNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458
           NNL IT  DRAGAAIITAVIL  + GGA+WMLF
Sbjct: 419 NNLTITSKDRAGAAIITAVILGCMAGGAIWMLF 451

>Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 bp,
           451 aa] {ON} complement(37060..38049,38052..38417) [1356
           nt, 452 aa]
          Length = 451

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/452 (72%), Positives = 380/452 (84%), Gaps = 1/452 (0%)

Query: 7   MKIALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQS 66
           M + L +     +F     A+DLD  S  SIC AT+LIQ GMLDYYEGTRYGGTVGMFQ 
Sbjct: 1   MVLLLTVLLQAFNFITTVTAIDLDVNSKDSICAATSLIQGGMLDYYEGTRYGGTVGMFQP 60

Query: 67  PYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGI 126
           PYYWW AGEAFGGM+ENW+LCQNDTY  ++YDALLAQTG++YDY+PANQT VE    + +
Sbjct: 61  PYYWWEAGEAFGGMIENWFLCQNDTYHDIIYDALLAQTGSNYDYVPANQTFVEVMMIK-V 119

Query: 127 WGITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNY 186
           +G TVM A ERNFT P +G P WLAM QAVFNTMY+RWDS NCGGGLRWQI+TWNSGYNY
Sbjct: 120 FGGTVMDAAERNFTAPSDGKPDWLAMAQAVFNTMYARWDSANCGGGLRWQIYTWNSGYNY 179

Query: 187 KNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNC 246
           KNT+SNACLFQIAARLGRYTGN TYL+VAE+VFDWLVDV +VVLND ANV+DGA I +NC
Sbjct: 180 KNTVSNACLFQIAARLGRYTGNDTYLEVAEKVFDWLVDVNFVVLNDEANVFDGANITSNC 239

Query: 247 TDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQD 306
           + + K+EW+YNHGIVLGG+AYMYNATNGTS+W++ L +VLNGA S FFK+ IMYE ACQD
Sbjct: 240 SAVVKLEWSYNHGIVLGGLAYMYNATNGTSKWESGLTKVLNGAKSIFFKNNIMYEQACQD 299

Query: 307 YGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLD 366
           + TCNTDQR+FKSIFSRMLGLTSV+AP+TSDTI  LI+ SAE AAKSCDGGTDGHTCGL+
Sbjct: 300 HNTCNTDQRSFKSIFSRMLGLTSVLAPYTSDTITPLIQASAEGAAKSCDGGTDGHTCGLN 359

Query: 367 WEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQN 426
           W   TNDG YGLGEQM ALE++ NLLI +RPAPY   NGGTS GD +AG+N+++TSVL N
Sbjct: 360 WNLGTNDGKYGLGEQMCALEIMSNLLILNRPAPYTMHNGGTSVGDPSAGLNATSTSVLSN 419

Query: 427 NLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458
           NL+I + DRAGAAI+TAVIL VL+GG+VWMLF
Sbjct: 420 NLDIKQKDRAGAAIVTAVILFVLLGGSVWMLF 451

>TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {ON}
           Anc_8.773 YMR238W
          Length = 436

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/435 (74%), Positives = 371/435 (85%), Gaps = 2/435 (0%)

Query: 26  AMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMVENWY 85
            +DLD +S  SIC ATALIQ GMLDYYEGTR GGTVGMFQSPYYWW AGEAFGGM++NWY
Sbjct: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61

Query: 86  LCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTNPDNG 145
            C+N T++ L+YD +LAQTG  YDY+P NQTMVEGNDDQG+WG+T+MGAVERNFTNP NG
Sbjct: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121

Query: 146 APGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRY 205
           APGWLAM QA+FN + SRWD+ NCGGGLRWQIFTWN GYNYKNTISNACLFQIAARLGRY
Sbjct: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181

Query: 206 TGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTDITKIEWTYNHGIVLGGM 265
           TGN TYL+VAE VFDWLVDVGYVVL D  NV+DGAEID NCT I K+EW+YNHG+VLGG+
Sbjct: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241

Query: 266 AYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYG--TCNTDQRTFKSIFSR 323
           A+MYNATNG+SEW+T + Q+L GA SYFFKD IMYES CQ  G  TCN+DQR+FK+IFSR
Sbjct: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301

Query: 324 MLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGYYGLGEQMS 383
           MLGLTSV+ P T   +D L+K SA AAA SC GGTDGHTCGL+W K+ NDGYYGLGEQMS
Sbjct: 302 MLGLTSVLVPSTQSKVDDLLKQSALAAAASCSGGTDGHTCGLNWNKQANDGYYGLGEQMS 361

Query: 384 ALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNLNITKGDRAGAAIITA 443
           ALEV+Q LLIH + AP+ E  GG+S GDANAG+N+S+ +VLQN L+I   DRAGAAIITA
Sbjct: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITA 421

Query: 444 VILSVLIGGAVWMLF 458
           VIL VL+GG++WMLF
Sbjct: 422 VILMVLVGGSIWMLF 436

>TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {ON}
           Anc_8.773 YMR238W
          Length = 450

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/446 (72%), Positives = 376/446 (84%), Gaps = 1/446 (0%)

Query: 13  LCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWH 72
           L  + LSF   T AMDLDT+S  SIC AT+LI  GMLDYY GT+YGGTVGMFQ PYYWW 
Sbjct: 6   LILSALSFVSFTFAMDLDTSSKESICGATSLIIKGMLDYYWGTQYGGTVGMFQPPYYWWE 65

Query: 73  AGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVM 132
           AGEAFGGM+ENWYLCQNDTY  LL+DAL AQTG DYDYIP NQTMVEGNDDQ IWG+TVM
Sbjct: 66  AGEAFGGMLENWYLCQNDTYADLLFDALTAQTGPDYDYIPQNQTMVEGNDDQCIWGLTVM 125

Query: 133 GAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISN 192
            AVERNFTNP  G PGWLAM QAVFNTM+SRWD+ +CGGGLRWQIFTWNSGY+YKNTISN
Sbjct: 126 DAVERNFTNPTEG-PGWLAMGQAVFNTMWSRWDAADCGGGLRWQIFTWNSGYDYKNTISN 184

Query: 193 ACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTDITKI 252
           ACLFQ+AARLGRYTGN TYLDVA  VFDWL  VGYV +++ A VYDGA+I  NCTDITK 
Sbjct: 185 ACLFQMAARLGRYTGNNTYLDVANDVFDWLTGVGYVNMDNAAEVYDGADISENCTDITKY 244

Query: 253 EWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNT 312
           +W+YN+G +LGG AYMYNATNG+S W+T + Q+LNGA +YFF+D IMYESACQ   TCN 
Sbjct: 245 QWSYNNGCMLGGAAYMYNATNGSSIWETRVTQLLNGAKAYFFQDDIMYESACQTAKTCNN 304

Query: 313 DQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETN 372
           DQR+FKS+FSRMLG TSV+ P T D ID LI  SA+ AA++C+GGTDGHTCGL+W+  T+
Sbjct: 305 DQRSFKSLFSRMLGFTSVLVPSTRDIIDPLILASAQGAARTCNGGTDGHTCGLNWQASTH 364

Query: 373 DGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNLNITK 432
           DGYYGLGEQMSALEVIQNLLIHDRPAPY   +GG+S+GDANAG+N ++ +VL N+L+I  
Sbjct: 365 DGYYGLGEQMSALEVIQNLLIHDRPAPYTSIDGGSSEGDANAGLNKTSKNVLSNDLDIKT 424

Query: 433 GDRAGAAIITAVILSVLIGGAVWMLF 458
           GD+ GAAI+TA +L++L+GGA+WMLF
Sbjct: 425 GDKVGAAILTAGVLAILVGGAIWMLF 450

>Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {ON}
           YMR238W (DFG5) - involved in pseudohyphal growth [contig
           152] FULL
          Length = 457

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/443 (69%), Positives = 371/443 (83%), Gaps = 4/443 (0%)

Query: 20  FFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGG 79
           F     A+DLDT+S  SICDAT+LIQ G++DYYEG R+GGTVGMFQ PYYWW AGE FGG
Sbjct: 15  FTSQVSAIDLDTSSKDSICDATSLIQKGVMDYYEGNRFGGTVGMFQQPYYWWEAGEVFGG 74

Query: 80  MVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAVERNF 139
           M+ENW+LCQNDTY+  LYDA++AQ G DYD++P+NQ+MVEGNDDQG+WG+T+M AVERNF
Sbjct: 75  MMENWFLCQNDTYEKTLYDAMIAQAGPDYDFMPSNQSMVEGNDDQGVWGLTLMSAVERNF 134

Query: 140 TNP-DNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACLFQI 198
           TNP + G PGWLAMVQ VFNTM+SRWDS++CGGGLRWQIFTWNSGYNYKNT+SNACLFQ+
Sbjct: 135 TNPTEKGVPGWLAMVQGVFNTMWSRWDSDHCGGGLRWQIFTWNSGYNYKNTVSNACLFQL 194

Query: 199 AARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDT--ANVYDGAEIDTNCTDITKIEWTY 256
           AARLGRYTGN TYL  AE V++WLVD+G+V  N++  ANVYDGA ID NCTDI +IEW+Y
Sbjct: 195 AARLGRYTGNETYLTKAETVWNWLVDIGFVRFNESGNANVYDGATIDKNCTDIVEIEWSY 254

Query: 257 NHGIVLGGMAYMYNAT-NGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNTDQR 315
           N GIVLGG AYMYNAT NGTS+W++ L Q++ G+   FF++ IMYE+ CQD G CN DQR
Sbjct: 255 NQGIVLGGAAYMYNATHNGTSDWESRLNQIVGGSTDIFFRNKIMYEATCQDSGKCNQDQR 314

Query: 316 TFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGY 375
           +FKSIFSRML LT  +AP+T+D ID L+K SAE AAKSC GGTDGHTCGL+WEK  +DG+
Sbjct: 315 SFKSIFSRMLSLTRTLAPYTADKIDPLMKASAEGAAKSCTGGTDGHTCGLNWEKGEHDGW 374

Query: 376 YGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNLNITKGDR 435
           YGLGEQ  ALE IQ+ L   RPAPY  DNGGTS GD  AG+N ++T+VL ++LNIT+ D+
Sbjct: 375 YGLGEQACALEGIQSQLYSMRPAPYTADNGGTSVGDTEAGLNKTSTNVLHSDLNITQKDK 434

Query: 436 AGAAIITAVILSVLIGGAVWMLF 458
            GA+IITAV+L+VL+GG++WM+F
Sbjct: 435 VGASIITAVLLAVLVGGSIWMIF 457

>KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]
           {ON} similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/453 (70%), Positives = 372/453 (82%), Gaps = 3/453 (0%)

Query: 7   MKIALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQS 66
           MKI+ PL ++L     +  A+DLDT+S +SIC ATALIQ G+ DYYEG  YGGTVGMF S
Sbjct: 1   MKIS-PL-YSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVS 58

Query: 67  PYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGI 126
           PYYWW AG  FGGM+ENWYLCQN +Y+ +LYDAL+AQTG+DYDY+P+NQTMVEGNDDQG+
Sbjct: 59  PYYWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGV 118

Query: 127 WGITVMGAVERNFTNP-DNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYN 185
           W +TVM AVERNFTNP ++G PGWLAMVQAVFN MYSRWDS++C GGLRWQIFTWNSGYN
Sbjct: 119 WALTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYN 178

Query: 186 YKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTN 245
           YKNTISN CLFQ+AARLGRYTGNTTYL+VAE+VFDWLVD+ +VV+ + ANV+DGA ID N
Sbjct: 179 YKNTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDN 238

Query: 246 CTDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQ 305
           CT I K EW+YNHG+VLGG AYMYNATNG+  W+T  +Q+L GA S+FF+D IMYES CQ
Sbjct: 239 CTSIVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQ 298

Query: 306 DYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGL 365
               CNTDQR FK+IFSRMLG TSV+APFT+DTI  LI TSA AAAKSC GGTDGHTCGL
Sbjct: 299 ASNKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSAAAAAKSCSGGTDGHTCGL 358

Query: 366 DWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQ 425
           +W     DG YGLGEQ  ALE+I  LL+HD PAP  E  GG+S GDA+AG+N STT+VLQ
Sbjct: 359 NWFTGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTGGSSSGDASAGLNVSTTNVLQ 418

Query: 426 NNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458
            N+NIT GD+AGA IIT ++L VL+ G VWM+ 
Sbjct: 419 KNINITAGDKAGAGIITTIVLGVLVLGTVWMVL 451

>TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {ON}
           Anc_8.773 YMR238W
          Length = 461

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/454 (69%), Positives = 377/454 (83%), Gaps = 13/454 (2%)

Query: 17  LLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGEA 76
           L+S      A+ LD  S  S+C+ATALIQ GMLDYY+GTRYGGTVGMFQ PYYWW AGEA
Sbjct: 9   LISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEA 68

Query: 77  FGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAVE 136
           FGGM+ENWYLCQNDT++ L+ DAL+ Q G++YDYIP+NQT+VEGNDDQG+WG+TV+GAVE
Sbjct: 69  FGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVE 128

Query: 137 RNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACLF 196
           RN  + D G PGWLA+ QAVFNTMY+RWD+  CGGGLRWQI+TWNSGYNYKNTISNACLF
Sbjct: 129 RNLPDRD-GVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACLF 187

Query: 197 QIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTDITKIEWTY 256
           QIAARLGRYTGN TYL+VAE+VFDW+VDV Y+VL D ANVYDGA  + NC+DI + EW+Y
Sbjct: 188 QIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYEWSY 247

Query: 257 NHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNTDQRT 316
           NHG+VLGG+AYMYNATNGTS+W+T+L QVL+GA +YFFK+ IMYESACQ+  TCNTDQR+
Sbjct: 248 NHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNTDQRS 307

Query: 317 FKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGYY 376
           FKSIFSRMLG T V+AP+T+ T+D LI+TSA+AAA SCDGGTDG TCGL W   TNDGYY
Sbjct: 308 FKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGYY 367

Query: 377 GLGEQMSALEVIQNLLI------------HDRPAPYKEDNGGTSKGDANAGMNSSTTSVL 424
           GLGEQMSALE+I  LL+                +PY   +GG S GDA+AG+N+++T+VL
Sbjct: 368 GLGEQMSALEIINQLLVSSSGAAAEAASSGSASSPYTSSSGGNSTGDASAGLNTTSTNVL 427

Query: 425 QNNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458
           QNNL+I   D+AGAA+ TAVIL+VL+GG+VWMLF
Sbjct: 428 QNNLDIESKDKAGAAVATAVILAVLVGGSVWMLF 461

>KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {ON}
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 454

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/453 (67%), Positives = 371/453 (81%), Gaps = 7/453 (1%)

Query: 10  ALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYY 69
           +  LC  LL   +    +DLDT+ ++SICDAT+LIQ G++DYY GTR GGTVGMFQ PYY
Sbjct: 5   SFALCALLL---QPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYY 61

Query: 70  WWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGI 129
           WW AGE FGGM+ENW+LCQNDTY  ++YDA++ Q G DYD++P+NQ+MVEGNDDQG+WG+
Sbjct: 62  WWEAGEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGL 121

Query: 130 TVMGAVERNFTNP-DNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKN 188
           TVM A ERNFTNP ++G PGWLAM Q VFNTM+ RWDSE+CGGG+RWQIFTWNSGYNYKN
Sbjct: 122 TVMSAAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKN 181

Query: 189 TISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDT--ANVYDGAEIDTNC 246
           T+SNAC+FQ+AARLGRYTGN TYL  AE V+DWLVDVG+VVLN+   ANVYDGA ID NC
Sbjct: 182 TVSNACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNC 241

Query: 247 TDITKIEWTYNHGIVLGGMAYMYNAT-NGTSEWKTSLQQVLNGAASYFFKDGIMYESACQ 305
           TDI K EW+YN GIVLGG AYMYNAT N TS WK+ L Q++ G+  +FFKD +MYES CQ
Sbjct: 242 TDIVKNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQ 301

Query: 306 DYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGL 365
           D  TCN DQR+FKSIFSRML LT  +AP+T++TID L++ SAE AAKSC GGTDGHTCGL
Sbjct: 302 DSKTCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGL 361

Query: 366 DWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQ 425
           +W+   +DGYYGLGEQ  ALE IQ+L+   RPAPY  DNGG+S GD  A +NS++T+VLQ
Sbjct: 362 NWQLGYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQ 421

Query: 426 NNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458
           +++ IT  D+ GA+IITAVIL+VL+GG++WM+F
Sbjct: 422 SDIKITHKDKVGASIITAVILAVLVGGSIWMIF 454

>KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {ON}
           Anc_8.773 YMR238W
          Length = 463

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/439 (69%), Positives = 364/439 (82%), Gaps = 6/439 (1%)

Query: 21  FKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGM 80
           F    A+ LD      +C ATAL+ DG+LDYY GTRYGGTVGMFQ PYYWWHAGEAFGGM
Sbjct: 30  FTGASALSLD-----PVCSATALVTDGLLDYYSGTRYGGTVGMFQPPYYWWHAGEAFGGM 84

Query: 81  VENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAVERNFT 140
           +ENW+LCQN TY+ LL DA +AQTG +YDYIP NQTMVEGNDDQGIWG+T+M AVERNFT
Sbjct: 85  IENWFLCQNSTYETLLMDAFIAQTGNNYDYIPENQTMVEGNDDQGIWGLTIMDAVERNFT 144

Query: 141 NP-DNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACLFQIA 199
            P  +G PGWLAM QAVFNTM++RWD+++CGGGLRWQIFTWNSGYNYKNTISNACLF +A
Sbjct: 145 KPTKDGVPGWLAMSQAVFNTMWARWDTQHCGGGLRWQIFTWNSGYNYKNTISNACLFNLA 204

Query: 200 ARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTDITKIEWTYNHG 259
           ARLGRYTGN+TYLDVA+QVFDW+V VGYVVL DTANV+DGA I+ NCT IT  EW+YNHG
Sbjct: 205 ARLGRYTGNSTYLDVADQVFDWMVSVGYVVLGDTANVFDGANIEDNCTTITTFEWSYNHG 264

Query: 260 IVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNTDQRTFKS 319
           +VLGG A+MYNATNG+S W+  + ++L GA +YFF+D IM+ESACQD G CN DQRTFK+
Sbjct: 265 VVLGGTAFMYNATNGSSVWEDRVNRILKGATTYFFRDSIMFESACQDTGKCNNDQRTFKA 324

Query: 320 IFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGYYGLG 379
           IFSRML  T+V+ P T+ TID L+++SA+AAA+SC GGTDGHTCGL+W+    DG YGLG
Sbjct: 325 IFSRMLSFTAVLVPSTASTIDPLMQSSAQAAAQSCSGGTDGHTCGLNWQHSGWDGMYGLG 384

Query: 380 EQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNLNITKGDRAGAA 439
           EQMSALEV+  LL+HDRPAPY    GG+S GDA+AG+NS+ T+V  N+LNI   D+AGAA
Sbjct: 385 EQMSALEVMNYLLVHDRPAPYTAAAGGSSVGDASAGLNSTATNVFANSLNIRGKDKAGAA 444

Query: 440 IITAVILSVLIGGAVWMLF 458
           I+T VIL  L GG++WMLF
Sbjct: 445 IVTTVILGTLAGGSIWMLF 463

>ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} similar
           to uniprot|Q05031 Saccharomyces cerevisiae YMR238W DFG5
           Mannosidase essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis involved in filamentous growth homologous to
           Dcw1p
          Length = 453

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/452 (65%), Positives = 357/452 (78%), Gaps = 6/452 (1%)

Query: 9   IALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPY 68
           I + L F+L   +    A+DL      S+C ATALIQ GMLDYY G +YGG +GMFQ PY
Sbjct: 6   ILVWLVFSLSPIW----AVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPY 61

Query: 69  YWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWG 128
           YWW AGEAFGGM++NW+ C+N+T++ L+ +A+L Q G  YDY+P NQTMVEGNDDQG+WG
Sbjct: 62  YWWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWG 121

Query: 129 ITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKN 188
           +TVM AVERNFT+P +G PGWLAM QAVFN +  RWD ++C GG+RWQIFTWNSGYNYKN
Sbjct: 122 LTVMEAVERNFTDPGDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKN 181

Query: 189 TISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTD 248
           TISN C FQ+AARLGRYT N TYL+VAE+VFDWL DVG+VVL D  NV+DGA  D NCT 
Sbjct: 182 TISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQ 241

Query: 249 ITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQ--D 306
           +T++EWTYNHGI+LGG AYMYNATNG+S+W+  + Q+LNGA+ YFF+D +MYES CQ  D
Sbjct: 242 VTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGD 301

Query: 307 YGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLD 366
              CN DQR+FKSIFSRMLGLTSV+ P  SD +D L+  SAE AAKSC GG DGHTCGL+
Sbjct: 302 SSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLN 361

Query: 367 WEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQN 426
           W K + D  YGLGEQMSALEVIQN LIH+   PY+E  GG+SKGD+ AG+N++TT+VLQ 
Sbjct: 362 WFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQK 421

Query: 427 NLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458
            L I   DRAGAAIIT V+L V++GG+VWMLF
Sbjct: 422 KLKIQSKDRAGAAIITGVVLMVVVGGSVWMLF 453

>AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5)
          Length = 459

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/460 (60%), Positives = 348/460 (75%), Gaps = 3/460 (0%)

Query: 1   MIVKASMKIALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGT 60
           M + A M   L   F L+     + A+DLD +S   +C  T  IQ G++DYY G++YGG 
Sbjct: 1   MYLSAGMTGLLVGLFLLMQGM-LSRALDLDLSSREDVCHFTNEIQKGIMDYYWGSKYGGI 59

Query: 61  VGMFQSPYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEG 120
           VGMFQ PYYWW AGE FGGM+ENWYLC N  Y+ +L ++++AQTG  +DYIPANQ+  EG
Sbjct: 60  VGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESMIAQTGDKFDYIPANQSTTEG 119

Query: 121 NDDQGIWGITVMGAVERNFTNPDN-GAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFT 179
           NDDQG+W + +MGAVERNF +P+  G PGWL MVQ VFN M +RWD+ENCGGGLRWQIF 
Sbjct: 120 NDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNKMEARWDAENCGGGLRWQIFQ 179

Query: 180 WNSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDG 239
           WN+GY YKNTI+N CLFQ+AARLGRYTGN TYLDVA +VF WLVDV Y+VL D A V+DG
Sbjct: 180 WNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVFQWLVDVKYIVLEDKARVFDG 239

Query: 240 AEIDTNCTDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIM 299
           A I  NC+DI  IEW+YNHGI+L G AYMYNAT G+ EW++ + ++L GAA ++F+D IM
Sbjct: 240 AHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGSPEWESHVTKILAGAADFYFRDKIM 299

Query: 300 YESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTD 359
           YE ACQDY TC+ DQR+FKSIFSRML +TSV+APFT  TID LI  SA AA+KSC+ GT 
Sbjct: 300 YERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFTRGTIDELIYASATAASKSCEQGTH 359

Query: 360 GHTCGLDWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNS- 418
           G+TCGL+W K T DG YGLGEQ SALE+IQN+LIH +  P   D GG S+G+ +AG++  
Sbjct: 360 GYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKAPPLTADTGGQSEGNPDAGLDHD 419

Query: 419 STTSVLQNNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458
           S  ++L+   NIT  DR GA++ITA+ L +++G A+WM+F
Sbjct: 420 SQPAILRGMHNITGKDRVGASLITAISLGLMLGCALWMIF 459

>Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar to
           Ashbya gossypii AFR530W
          Length = 454

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/454 (62%), Positives = 340/454 (74%), Gaps = 2/454 (0%)

Query: 7   MKIALPL-CFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQ 65
           M+I + L    LL        + LD  S  SIC AT  IQ G++DYY G+  GG VGMF 
Sbjct: 1   MRIIVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFI 60

Query: 66  SPYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQG 125
            PYYWW AG  F GM+ENWYLC N  Y   LY++++AQTGA+YDYIP+NQ+M EGNDDQG
Sbjct: 61  QPYYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQG 120

Query: 126 IWGITVMGAVERNFTNPDNG-APGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGY 184
           IWG+ +MGAVERNF +   G  PGWL M QAVFNTMY+RWDS++CGGGLRWQIFTWN GY
Sbjct: 121 IWGLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGY 180

Query: 185 NYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDT 244
           +YKNTI+N CLFQ+AARLGRYTGN+TYLD+A + F WLVDV +VVL D ANV+DGA I  
Sbjct: 181 DYKNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGD 240

Query: 245 NCTDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESAC 304
           NC DI  IEWTYNHG++LGG AYMYNATNG   W+T L+Q+L GA ++FF++ IMYE AC
Sbjct: 241 NCQDIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERAC 300

Query: 305 QDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCG 364
           QD   CN DQR+FKSIFSRML +TSV+APFT +TID L++ SA AAA SC GG DG TCG
Sbjct: 301 QDNKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEASAAAAAASCSGGKDGETCG 360

Query: 365 LDWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVL 424
           LDW   + DGYYGLGEQ SALEVIQNLLIH +  P  ++ GGTS GD  AG+ +   +VL
Sbjct: 361 LDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVL 420

Query: 425 QNNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458
            + LNI   DR  AA+ITAV L +L+G A+WM+ 
Sbjct: 421 HSRLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454

>NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/399 (68%), Positives = 321/399 (80%), Gaps = 10/399 (2%)

Query: 26  AMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMVENWY 85
           ++ L+ TS TSICDAT++I  G+LDYYEGTR+ GTVGMFQ PYYWW AG AFGGM+ENWY
Sbjct: 26  SIKLNVTSNTSICDATSIITKGILDYYEGTRFNGTVGMFQQPYYWWKAGSAFGGMLENWY 85

Query: 86  LCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTNPD-N 144
           LCQNDT++ LL DA+L Q G DYDY+P NQTMVE NDDQG+WG+T+MGAVERNFT+P   
Sbjct: 86  LCQNDTFESLLTDAMLHQAGKDYDYLPENQTMVEANDDQGVWGLTIMGAVERNFTDPQGK 145

Query: 145 GAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGR 204
             PGWLAM Q++FN MYSRWD+ +CGGGLRWQI+ WN GYNYKNTIS ACLFQ+AARLGR
Sbjct: 146 DVPGWLAMAQSIFNQMYSRWDTGSCGGGLRWQIYDWNKGYNYKNTISTACLFQMAARLGR 205

Query: 205 YTGNTTYLDVAEQVFDWLVDVGYVVLNDTA-NVYDGAEIDTNCTDITKIEWTYNHGIVLG 263
           YTGN+TYL VA++ F W+VD+GY+ LN ++  V+DGA I++NC+DITK+EW+YNHGIVLG
Sbjct: 206 YTGNSTYLKVADKTFQWMVDIGYIQLNTSSGRVFDGAHIESNCSDITKLEWSYNHGIVLG 265

Query: 264 GMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQ--DYGTCNTDQRTFKSIF 321
           G AYMYNAT  + EW  +  ++LNGA +YFF++  M E+ACQ  D   CN DQRTFKSIF
Sbjct: 266 GCAYMYNATK-SPEWGMNTIKILNGATTYFFQNKTMLETACQRPDRVFCNNDQRTFKSIF 324

Query: 322 SRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGYYGLGEQ 381
           SRMLGLTSVMAPFTS+ ID LI  SAEAAA SC GG D  TCGL+W +  NDGYYGLGEQ
Sbjct: 325 SRMLGLTSVMAPFTSERIDPLIVQSAEAAALSCTGGFDNETCGLNWLEGKNDGYYGLGEQ 384

Query: 382 MSALEVIQNLLIHDRPAPY-----KEDNGGTSKGDANAG 415
           +SALEVIQNLLIH RP PY     K   GG SKGD  AG
Sbjct: 385 LSALEVIQNLLIHKRPPPYMAKTDKNKVGGVSKGDPAAG 423

>ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 463

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/458 (60%), Positives = 335/458 (73%), Gaps = 4/458 (0%)

Query: 2   IVKASMKIALPLCFTLLSF-FKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGT 60
            V+   + +LP+   L+      ++A+D+D  S+ SICDAT LIQ G+LDYYEG R GG 
Sbjct: 5   FVRVGAEPSLPMYVLLVILNIVLSNALDVDFNSSESICDATKLIQVGILDYYEGLRPGGR 64

Query: 61  VGMFQSPYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEG 120
           VG FQ PYYWW AGEAFGGMVENWYLC N  YQ LL DA+++Q G + DY+P++Q M+EG
Sbjct: 65  VGFFQKPYYWWMAGEAFGGMVENWYLCNNTEYQDLLTDAMVSQIGENKDYVPSHQKMIEG 124

Query: 121 NDDQGIWGITVMGAVERNFTN-PDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFT 179
           NDDQGIWG+ VMGA ERNF + P   APGWLA+ QAVFNTM++RWD ENCGGGLRWQIF 
Sbjct: 125 NDDQGIWGLLVMGAAERNFPDAPPERAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFP 184

Query: 180 WNSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDG 239
           WN+GY+YKNTISNACLFQIAARL R+TGN+TY DVAE VFDWLVD   V L + A V DG
Sbjct: 185 WNNGYDYKNTISNACLFQIAARLARFTGNSTYQDVAETVFDWLVDSKLVQLENDAKVLDG 244

Query: 240 AEIDTNCTDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIM 299
           A I   C D +K+EWTYNHG+VL G AYMYN TNG++ W   L +VLNG+   FF +GI+
Sbjct: 245 AHISERCEDHSKLEWTYNHGVVLAGCAYMYNITNGSAVWGDRLNKVLNGSL-LFFPNGIL 303

Query: 300 YESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTD 359
           YE ACQD   CN DQR+F+SIFSRML LTSV+AP T   I+  I+ SAEAAAKSC GG D
Sbjct: 304 YERACQDVQKCNDDQRSFRSIFSRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRD 363

Query: 360 GHTCGLDWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSS 419
           GHTCG+ W   T DG YGLGEQ+SALE+IQN LIH +P P   + G  SKGD +AG+  +
Sbjct: 364 GHTCGMVWRNYTWDGKYGLGEQLSALEIIQNTLIHTKPPPTTANEGAKSKGDPSAGLYDN 423

Query: 420 TTSVLQ-NNLNITKGDRAGAAIITAVILSVLIGGAVWM 456
           + +++  +   I   DR GA  +T V+L   I G++WM
Sbjct: 424 SPNIITLSTRQIGLKDRVGAGFMTVVLLIPFITGSIWM 461

>ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 448

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/435 (62%), Positives = 320/435 (73%), Gaps = 3/435 (0%)

Query: 24  TDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMVEN 83
           ++A+D+D  S+ SICDAT LIQ G+LDYYEG + GG  G    PYYWW AGEAFGGMVEN
Sbjct: 13  SNALDVDFNSSESICDATKLIQVGILDYYEGAKPGGRAGFLVKPYYWWMAGEAFGGMVEN 72

Query: 84  WYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTN-P 142
           WYLC N  YQ LL DA+++Q G + DY+P++Q MVEGNDDQGIWG+ VMGA ERNF + P
Sbjct: 73  WYLCNNTEYQDLLTDAMVSQIGENKDYMPSHQKMVEGNDDQGIWGLLVMGAAERNFPDAP 132

Query: 143 DNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARL 202
              APGWLA+ QAVFNTM++RWD ENCGGGLRWQIF WN GY+YKNTISNACLFQIAARL
Sbjct: 133 PERAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFPWNGGYDYKNTISNACLFQIAARL 192

Query: 203 GRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTDITKIEWTYNHGIVL 262
            R+TGN+TY DVAE VFDWLVDV  V L + A V DGA I   C D +++EWTYNHG+VL
Sbjct: 193 ARFTGNSTYQDVAETVFDWLVDVKLVELENDARVLDGAHISERCEDHSQLEWTYNHGVVL 252

Query: 263 GGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNTDQRTFKSIFS 322
           GG AYMYN TNG++ W   L +VLNG+   FF++GI+YE ACQD   CN DQR+F+SIFS
Sbjct: 253 GGCAYMYNITNGSAVWGDRLNKVLNGSL-LFFENGILYERACQDVNKCNDDQRSFRSIFS 311

Query: 323 RMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGYYGLGEQM 382
           RML LTSV+AP T   I+  I+ SAEAAAKSC GG DGHTCG+ W   T DG YGLGEQ+
Sbjct: 312 RMLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWRNYTWDGKYGLGEQL 371

Query: 383 SALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMN-SSTTSVLQNNLNITKGDRAGAAII 441
           SALE+IQN LIH +P P   + G  S+GD  AG+  SS  S+      I   DR GA   
Sbjct: 372 SALEIIQNTLIHTKPPPTTANEGAKSQGDPGAGLQLSSPNSITLPTRQIRLKDRVGAGFA 431

Query: 442 TAVILSVLIGGAVWM 456
           T V L   I G++WM
Sbjct: 432 TVVFLLPFITGSIWM 446

>NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/381 (64%), Positives = 307/381 (80%), Gaps = 2/381 (0%)

Query: 20  FFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGG 79
           F   T ++ LD TS+ SICDAT+L+Q G+LDYYEGT YGGTVGMFQ+PYYWWH+G AFG 
Sbjct: 22  FIGKTLSLTLDQTSSKSICDATSLLQKGILDYYEGTTYGGTVGMFQAPYYWWHSGCAFGS 81

Query: 80  MVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAVERNF 139
           M+ENWYLCQ+DTY+ L+ DA+LAQ G +YD++P NQTMVEGNDDQG+WG+ +M A ER F
Sbjct: 82  MIENWYLCQDDTYESLITDAILAQAGDNYDFVPQNQTMVEGNDDQGVWGLALMDAAEREF 141

Query: 140 TNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACLFQIA 199
                G P WL M + +F +M++RWD+ NCGGGLRWQI++WN+GY+YKNT+S  CLFQ+A
Sbjct: 142 PQV-KGQPSWLTMAENIFESMFARWDNANCGGGLRWQIYSWNNGYDYKNTVSTTCLFQLA 200

Query: 200 ARLGRYTGNTTYLDVAEQVFDWLVDVGYVVL-NDTANVYDGAEIDTNCTDITKIEWTYNH 258
           ARLGRYTGN TY+  A Q FDWL  VG+V+  N+   V+DGA+I TNCT+I K EW+YNH
Sbjct: 201 ARLGRYTGNETYVKAANQAFDWLQGVGFVMFKNNDGYVFDGADISTNCTNIKKYEWSYNH 260

Query: 259 GIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNTDQRTFK 318
           GIVLGG AYMYN T+G+S W+T   Q+LN A+SYFF++GIM+E+ CQ    CN DQR+F+
Sbjct: 261 GIVLGGAAYMYNLTDGSSTWETRTSQLLNLASSYFFQNGIMFEAECQTSNICNNDQRSFR 320

Query: 319 SIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGYYGL 378
           SIF+RMLG TS+MAPFT++TID L+KT+++AAA +C GG DGHTCGL+W     DG YGL
Sbjct: 321 SIFARMLGKTSIMAPFTAETIDPLLKTTSKAAANACSGGKDGHTCGLNWLNSNFDGNYGL 380

Query: 379 GEQMSALEVIQNLLIHDRPAP 399
           GE+MSA+EVIQNLLIH RPAP
Sbjct: 381 GEEMSAMEVIQNLLIHQRPAP 401

>TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 237/382 (62%), Positives = 299/382 (78%), Gaps = 2/382 (0%)

Query: 27  MDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMVENWYL 86
           +++DT S  SIC+AT+LIQDG+LDYYEG RYGGTVG+FQ PYYWW +GEAFG ++ NWYL
Sbjct: 17  IEIDTHSKESICNATSLIQDGLLDYYEGNRYGGTVGIFQPPYYWWQSGEAFGSLLNNWYL 76

Query: 87  CQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTNPDNGA 146
           CQNDTY+ L+YDA+LAQ G +YD++P NQTMVEGNDDQG++ +T++ A+ERNFT P  G+
Sbjct: 77  CQNDTYEKLIYDAILAQAGPNYDFVPKNQTMVEGNDDQGVFDMTILDAMERNFTAPPKGS 136

Query: 147 PGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRYT 206
           P WL M Q VFN+MY RWD+ +C GG+RWQI++WN+GY+YKN +S   LF IAARL RYT
Sbjct: 137 PSWLDMNQRVFNSMYDRWDTTSCNGGIRWQIYSWNNGYDYKNAVSTGSLFHIAARLARYT 196

Query: 207 GNTTYLDVAEQVFDWLVDVGYVVLNDT-ANVYDGAEIDTNCTDITKIEWTYNHGIVLGGM 265
           GN +Y  VA+ +FDWL  V YV+ +D    V DGA I+ NCTDIT+IEWTYN GI++ G 
Sbjct: 197 GNASYFQVADTIFDWLTSVNYVMFDDKYGYVMDGASIEQNCTDITRIEWTYNFGIIMDGC 256

Query: 266 AYMYNATNGTSEWKTSLQQVLNGAASYFF-KDGIMYESACQDYGTCNTDQRTFKSIFSRM 324
           AY+YNATNG+++W+    ++L GA   FF K+ IMYE+ACQ    CN DQR+FK++ +R 
Sbjct: 257 AYLYNATNGSAKWEQCTTKLLAGAKDDFFDKNDIMYEAACQTNNKCNNDQRSFKALLARF 316

Query: 325 LGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGYYGLGEQMSA 384
           LG TSV+AP+T  TI  +I  SA  AAKSC+GG DGHTCGL W+K TNDGYYG+GEQMSA
Sbjct: 317 LGTTSVLAPYTESTIKPMINASAIGAAKSCNGGYDGHTCGLSWQKGTNDGYYGMGEQMSA 376

Query: 385 LEVIQNLLIHDRPAPYKEDNGG 406
           LE+IQNLLI+D P P    NGG
Sbjct: 377 LEIIQNLLINDYPPPLVAPNGG 398

>ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 450

 Score =  519 bits (1337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/396 (62%), Positives = 297/396 (75%), Gaps = 2/396 (0%)

Query: 25  DAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMVENW 84
           +A+D++  S+ SIC+AT LIQ G+LDYYEG R GG VG FQ PYYWW AG+ FGGMVENW
Sbjct: 13  NALDVNFNSSASICNATKLIQQGILDYYEGLRPGGRVGFFQEPYYWWMAGDVFGGMVENW 72

Query: 85  YLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTN-PD 143
           YLC N  Y+ LL +A+++Q G + DY+P +Q MVEGNDDQGIWG+ VM A ER+F + P 
Sbjct: 73  YLCDNTEYKDLLTEAMVSQIGENKDYVPWHQRMVEGNDDQGIWGLLVMDAAERDFPDAPP 132

Query: 144 NGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLG 203
           + APGWLA+ QAVFNTM++RWD +NC GGL WQI+ WN GY+YKNTISN  LFQIAARL 
Sbjct: 133 DQAPGWLALAQAVFNTMWARWDMDNCAGGLLWQIYPWNVGYDYKNTISNGYLFQIAARLA 192

Query: 204 RYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTDITKIEWTYNHGIVLG 263
           R+TGN+TY  VAE VFDWLVD   V L++ A V DGA + TNCTD T+ EWTYN+G+VLG
Sbjct: 193 RFTGNSTYGRVAETVFDWLVDSKLVQLDNVALVLDGAHVYTNCTDFTRYEWTYNYGVVLG 252

Query: 264 GMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNTDQRTFKSIFSR 323
           G AYMYN TNG+  W   L +VLNGA   FF++GIMYE  CQD   CN DQR FKSIF+R
Sbjct: 253 GCAYMYNFTNGSPVWANRLNRVLNGAL-LFFENGIMYERTCQDVDRCNNDQRFFKSIFTR 311

Query: 324 MLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGYYGLGEQMS 383
           ML LTSV+AP T   I+  I+ SAEAAAKSC+GG+DGHTCGL W   T DG  GLGEQ+ 
Sbjct: 312 MLALTSVLAPHTKARIEPNIRKSAEAAAKSCNGGSDGHTCGLVWRNYTWDGKAGLGEQLC 371

Query: 384 ALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSS 419
           ALE+IQN LIH +  P     G  SKGD  AG+NSS
Sbjct: 372 ALEIIQNTLIHTKRPPLTAKQGAKSKGDPAAGLNSS 407

>SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 451

 Score =  506 bits (1302), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 245/452 (54%), Positives = 323/452 (71%), Gaps = 6/452 (1%)

Query: 8   KIALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSP 67
           K+   LC +LL  +  T AMDLD     S+ +ATAL+  G++DYY G +YG T+GMF +P
Sbjct: 5   KLINVLCGSLL-LYSPTGAMDLDVDDLNSLKNATALVAYGLMDYYTGLQYGQTIGMFSNP 63

Query: 68  YYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIW 127
           YYWW AG A+G M++ W+  +NDTY  ++  ALL QTG D+DY+P NQ+  EGNDDQ  W
Sbjct: 64  YYWWEAGGAWGSMLDYWWYMENDTYNDIVKQALLYQTGDDHDYVPLNQSTTEGNDDQAFW 123

Query: 128 GITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYK 187
           G+ VM A ERNF+NPD   P WL + QAVFNTM  RWD+++CGGGLRWQIFTWNSGY+YK
Sbjct: 124 GLAVMAAAERNFSNPDPDQPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFTWNSGYDYK 183

Query: 188 NTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCT 247
           N++SN  LF IAARL RYTGN +Y+D AE+VFDW+ DVG +   D A V+DG  ID NCT
Sbjct: 184 NSVSNGALFHIAARLARYTGNQSYVDWAEKVFDWMRDVGLITEGDWAFVHDGVSIDDNCT 243

Query: 248 DITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDG-IMYESACQD 306
            +T  +WTYNHG+++ G AY+YN T G+  W    ++ L+ ++S FFK+G I++E+ACQ 
Sbjct: 244 SVTPYQWTYNHGLIMAGSAYLYNFT-GSEVWHNRTKEFLH-SSSVFFKNGSILWEAACQA 301

Query: 307 YGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLD 366
             TCNTDQR+FK+ FSR LGLT+ + P +   I   I++SA+ AA+SC GG DGHTCG++
Sbjct: 302 SNTCNTDQRSFKAYFSRFLGLTAQLVPESRSQIMEWIRSSAKGAAESCSGGRDGHTCGIN 361

Query: 367 WEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQN 426
           W   + DG+YGLGEQM+ALE+IQN+   DRPAPY    GG+S+GD+ AG  +  T++   
Sbjct: 362 WFNGSWDGFYGLGEQMAALEIIQNVRCLDRPAPYTSTTGGSSQGDSAAGTETHPTNLTP- 420

Query: 427 NLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458
            L IT G RAGA IITAVI   ++  AVW++ 
Sbjct: 421 -LTITAGSRAGAGIITAVIGISIVACAVWLVL 451

>KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 448

 Score =  499 bits (1284), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 239/438 (54%), Positives = 313/438 (71%), Gaps = 4/438 (0%)

Query: 21  FKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGM 80
           F+++ A+D D  +  SI +ATAL+  G+LDYY G +YG T+GMF +PYYWW AG A+G +
Sbjct: 15  FRSSQALDFDVDNEGSIKNATALVAGGLLDYYTGQQYGQTIGMFSNPYYWWEAGGAWGSI 74

Query: 81  VENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAVERNFT 140
           ++ W+  QNDTY  +L +ALL Q G ++DYIP NQ+  EGNDDQ  WG+ VM A ERNFT
Sbjct: 75  LDFWWYTQNDTYNAMLEEALLYQAGENHDYIPLNQSTTEGNDDQAFWGLVVMAAAERNFT 134

Query: 141 NPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACLFQIAA 200
           NP    P WL + QAVFNTM  RWD E+CGGGLRWQIFTWNSGY+YKNT+SN  LF +AA
Sbjct: 135 NPPETEPQWLYLAQAVFNTMALRWDDESCGGGLRWQIFTWNSGYDYKNTVSNGALFHLAA 194

Query: 201 RLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTDITKIEWTYNHGI 260
           RL RYTGN TY+D AE+VFDW+  +G +  ND + VYDGA++D NC+ ITK+ WTYN G+
Sbjct: 195 RLARYTGNNTYVDWAEKVFDWMKGIGLLTENDNSYVYDGAKVDGNCSTITKLIWTYNQGL 254

Query: 261 VLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNTDQRTFKSI 320
           ++ G AY+YN T G+  W T   + LN ++  FF + I+YE  CQ+  TCNTDQR+FK+ 
Sbjct: 255 LMSGCAYLYNYT-GSETWHTRTFEFLN-SSDIFFNNSILYERTCQEANTCNTDQRSFKAY 312

Query: 321 FSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGYYGLGE 380
           FSR LGLT+ + P   + I   I+ SA+ AA+SC GGTDGHTCGL+W  +  DG +GLGE
Sbjct: 313 FSRFLGLTAQLVPAARNQIMDWIRASAKGAAQSCSGGTDGHTCGLNWFYDGWDGKWGLGE 372

Query: 381 QMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNLNITKGDRAGAAI 440
           QM+ALE++QN+L  DRPAPY    GG+S G+  AG  +S T++  + L+IT G RA A I
Sbjct: 373 QMAALEIMQNVLCLDRPAPYTAATGGSSVGNGAAGTETSATNL--SPLDITTGSRAAAGI 430

Query: 441 ITAVILSVLIGGAVWMLF 458
           ITAVI   ++   VW++ 
Sbjct: 431 ITAVIGLSIVACTVWLVL 448

>KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {ON}
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 450

 Score =  491 bits (1265), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 241/454 (53%), Positives = 317/454 (69%), Gaps = 8/454 (1%)

Query: 7   MKIALPLCFTLLSFFKATD-AMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQ 65
           M++   L  +L++ F +    +DLD     S+ +AT+L+  G++DYY G +YG T+GMF 
Sbjct: 1   MRV-FKLVLSLVTLFSSVSFGLDLDVNDLNSLKNATSLVAYGLMDYYTGLQYGKTIGMFA 59

Query: 66  SPYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQG 125
           SP YWW AG A+G +++ W+  +NDTY  +L  ALL QTG ++DY+P NQT+ EGNDDQ 
Sbjct: 60  SPSYWWQAGGAWGSILDYWFYMENDTYNDILTQALLYQTGDNHDYMPLNQTVTEGNDDQA 119

Query: 126 IWGITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYN 185
            WG  VM A ERN+ NP +  P WL + QAVFNTM SRWD ++CGGGLRWQIFTWNSGY+
Sbjct: 120 FWGFAVMAAAERNYPNPPDDEPQWLYLAQAVFNTMSSRWDMDSCGGGLRWQIFTWNSGYD 179

Query: 186 YKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTAN--VYDGAEID 243
           YKN++SNA LF ++ARL RYTGN++Y + AE+++DW+ D+  +V  +     VYDGA I+
Sbjct: 180 YKNSVSNAALFHLSARLARYTGNSSYTEWAEKIYDWMQDIQLLVDEEPTQYYVYDGASIE 239

Query: 244 TNCTDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESA 303
            NCTD  K +WTYN G++L G AY+YN T  +  W    +  LN ++  FF + IMYE+A
Sbjct: 240 ENCTDTVKYQWTYNQGLMLSGSAYLYNFTE-SETWHERTKNFLN-SSGIFFNNSIMYEAA 297

Query: 304 CQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTC 363
           CQ  G CN DQR+FK+ FSR LGLT+ + P T DT+ AL++ SA+ AA SC GGTDGHTC
Sbjct: 298 CQGSGYCNNDQRSFKAYFSRFLGLTAQLVPETRDTVLALLQASAQGAADSCSGGTDGHTC 357

Query: 364 GLDWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSV 423
           GL+W     DG YGLGEQM+ALEV+QNL   DRPAPY  D+GGTS G+  AG   S T++
Sbjct: 358 GLNWFYGGWDGKYGLGEQMAALEVMQNLRCLDRPAPYTADDGGTSAGNPAAGTEQSPTNL 417

Query: 424 LQNNLNITKGDRAGAAIITAVILSVLIGGAVWML 457
               L I KGD+AGA IITAVI   +IG  VW++
Sbjct: 418 AP--LTIGKGDQAGAGIITAVIGITIIGSVVWLI 449

>Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {ON}
           YKL046C (REAL)
          Length = 450

 Score =  490 bits (1261), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 243/446 (54%), Positives = 312/446 (69%), Gaps = 4/446 (0%)

Query: 13  LCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWH 72
           L   L +  + T+A++LD  +  S+ +AT+LI  G++DYY G +YG TVGMF  PYYWW 
Sbjct: 9   LLSVLFATTRFTNAVELDLDNYQSLQNATSLIAYGLMDYYTGDQYGKTVGMFSDPYYWWE 68

Query: 73  AGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVM 132
           AG A+G M++ W+  +NDTY   +  A++ Q G D DYIP NQ+  EGNDDQ  WGI  M
Sbjct: 69  AGGAWGCMLDYWFFMENDTYNDEITAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAM 128

Query: 133 GAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISN 192
            A ERNFTNP +  P WL + QAVFNTM  RWD+++CGGGLRWQIF WNSGY+YKNT+SN
Sbjct: 129 TAAERNFTNPPSDEPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSN 188

Query: 193 ACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTDITKI 252
             LF IAARL RYTGN TY+D AE+V++W+V V  +       VYDG  ID NCT +T  
Sbjct: 189 GALFHIAARLARYTGNETYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIDDNCTKVTSY 248

Query: 253 EWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNT 312
           +WTYN G++L G AY+YN T G+  W T  ++ LN A+  FF DGI+YE+ACQ   +CNT
Sbjct: 249 QWTYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFLN-ASQVFFHDGIVYEAACQGPNSCNT 306

Query: 313 DQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETN 372
           DQR+FK+ F+R LG+T+ + P T   I + + TSA AAAKSC GGTDGHTCGL+W   T 
Sbjct: 307 DQRSFKAYFARFLGVTAQLVPETRSQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTW 366

Query: 373 DGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNLNITK 432
           DG YGLGEQM+ALEV+ N    DRP+PY  DNGG+S GD  AG  +  T++  + LNITK
Sbjct: 367 DGMYGLGEQMAALEVMVNTRALDRPSPYTADNGGSSVGDGAAGTQAQPTNL--SPLNITK 424

Query: 433 GDRAGAAIITAVILSVLIGGAVWMLF 458
           G +AGA IITAVI   ++  A+W++F
Sbjct: 425 GSKAGAGIITAVIGISIVACALWLVF 450

>YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON}
           DCW1Putative mannosidase, GPI-anchored membrane protein
           required for cell wall biosynthesis in bud
           formation;homologous to Dfg5p
          Length = 449

 Score =  488 bits (1257), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 241/437 (55%), Positives = 307/437 (70%), Gaps = 4/437 (0%)

Query: 22  KATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMV 81
           + T+A++LD  +  S+ +AT+LI  G++DYY G +YG TVGMF  PYYWW AG A+G M+
Sbjct: 17  RFTNAVELDLDNYESLQNATSLIAYGLMDYYTGNQYGKTVGMFSDPYYWWEAGGAWGCML 76

Query: 82  ENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTN 141
           + W+   NDTY   +  A++ Q G D DYIP NQ+  EGNDDQ  WGI  M A ERNFTN
Sbjct: 77  DYWFFMDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTN 136

Query: 142 PDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACLFQIAAR 201
           P    P WL + QAVFNTM  RWD+++CGGGLRWQIF WNSGY+YKNT+SN  LF IAAR
Sbjct: 137 PPENEPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAAR 196

Query: 202 LGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTDITKIEWTYNHGIV 261
           L RYTGN TY+D AE+V++W+V V  +       VYDG  ID NCT +T  +WTYN G++
Sbjct: 197 LARYTGNQTYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIDDNCTKVTSYQWTYNQGLL 256

Query: 262 LGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNTDQRTFKSIF 321
           L G AY+YN T G+  W T  ++ LN A+  FF DGI+YE+ACQ   +CNTDQR+FK+ F
Sbjct: 257 LAGSAYLYNFT-GSDLWHTRTKEFLN-ASQVFFHDGIVYEAACQGPNSCNTDQRSFKAYF 314

Query: 322 SRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGYYGLGEQ 381
           +R LG+T+ + P T + I + + TSA AAAKSC GGTDGHTCGL+W   T DG YGLGEQ
Sbjct: 315 ARFLGVTAQLVPETRNQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQ 374

Query: 382 MSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNLNITKGDRAGAAII 441
           MSALEV+ N    D+PAPY  +NGG+S GD  AG  +  T++    LNITKG +AGA II
Sbjct: 375 MSALEVMVNTRALDKPAPYTAENGGSSVGDGAAGTQAQPTNLAP--LNITKGSKAGAGII 432

Query: 442 TAVILSVLIGGAVWMLF 458
           TAVI   ++  A+W++F
Sbjct: 433 TAVIGISIVACALWLVF 449

>Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  487 bits (1254), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 241/444 (54%), Positives = 309/444 (69%), Gaps = 4/444 (0%)

Query: 15  FTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAG 74
            ++L   + T+A++LD  +  S+ +AT+L+  G++DYY G +YG T+GMF  PYYWW AG
Sbjct: 10  LSVLFATRFTNAVELDLDNYESLQNATSLVAYGLMDYYTGNQYGKTIGMFSDPYYWWEAG 69

Query: 75  EAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGA 134
            A+G M++ W+   NDTY   +  A++ Q G D DYIP NQ+  EGNDDQ  WGI  M A
Sbjct: 70  GAWGCMLDYWFFMDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTA 129

Query: 135 VERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNAC 194
            ERNFTNP    P WL + QAVFNTM  RWD+++CGGGLRWQIF WNSGY+YKNT+SN  
Sbjct: 130 AERNFTNPPEDDPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGA 189

Query: 195 LFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTDITKIEW 254
           LF IAARL RYTGN TY+D AE+V++W+V V  +       VYDG  ID NCT +T  +W
Sbjct: 190 LFHIAARLARYTGNQTYVDWAEKVYEWMVGVDLISNGTYKYVYDGVSIDDNCTKVTSYQW 249

Query: 255 TYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNTDQ 314
           TYN G++L G AY+YN T G+  W T  ++ LN A+  FF DGI+YE+ACQ   +CNTDQ
Sbjct: 250 TYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFLN-ASQVFFHDGIVYEAACQGPNSCNTDQ 307

Query: 315 RTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDG 374
           R+FK+ F+R LG+T+ + P T   I + + TSA AAAKSC GGTDGHTCGL+W   T DG
Sbjct: 308 RSFKAYFARFLGVTAQLVPETRHQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDG 367

Query: 375 YYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNLNITKGD 434
            YGLGEQMSALEV+ N    DRPAPY  +NGG+S GD  AG  +  T++    LNITKG 
Sbjct: 368 MYGLGEQMSALEVLVNTRALDRPAPYTAENGGSSVGDGAAGTQARPTNLAP--LNITKGS 425

Query: 435 RAGAAIITAVILSVLIGGAVWMLF 458
           +AGA IITAVI   ++  A+W++F
Sbjct: 426 KAGAGIITAVIGISIVACALWLVF 449

>Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  485 bits (1248), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 239/444 (53%), Positives = 310/444 (69%), Gaps = 4/444 (0%)

Query: 15  FTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAG 74
            ++L F K ++A++LD  +  S+ +AT+LI  G++DYY G +YG T+GMF  PYYWW AG
Sbjct: 10  LSVLFFTKFSNAVELDLDNYESLENATSLIAYGLMDYYTGNQYGKTIGMFSDPYYWWEAG 69

Query: 75  EAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGA 134
            A+G M++ W+   NDTY   +  A++ Q+G D DYIP NQ+  EGNDDQ  WGI  M A
Sbjct: 70  GAWGCMLDYWFFMDNDTYNDEIIAAMVHQSGDDNDYIPLNQSTTEGNDDQAFWGIAAMTA 129

Query: 135 VERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNAC 194
            ERNFTNP    P WL + QAVFNTM  RWD+++CGGGLRWQIF WNSGY+YKNT+SN  
Sbjct: 130 AERNFTNPPADEPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGA 189

Query: 195 LFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTDITKIEW 254
           LF IAARL RYTGN TY+D AE+V++W+V V  +       VYDG  I  NCT +T  +W
Sbjct: 190 LFHIAARLARYTGNQTYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIGDNCTKVTSYQW 249

Query: 255 TYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNTDQ 314
           TYN G++L G AY+YN T G+  W T  ++ LN ++  FF+DGI+YE+ACQ   +CNTDQ
Sbjct: 250 TYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFLN-SSQVFFQDGIVYEAACQGPNSCNTDQ 307

Query: 315 RTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDG 374
           R+FK+ F+R LG+T+ + P T + I   + TSA AAAKSC GGTDGHTCGL+W   T DG
Sbjct: 308 RSFKAYFARFLGVTAQLVPETRNQIMTWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDG 367

Query: 375 YYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNLNITKGD 434
            YGLGEQM+ALEV+ N    D+PAPY  D GG+S GD  AG  +  T++    LNITKG 
Sbjct: 368 MYGLGEQMAALEVMVNTRALDKPAPYTADEGGSSAGDGAAGTQAQPTNLAP--LNITKGS 425

Query: 435 RAGAAIITAVILSVLIGGAVWMLF 458
           +AGA IITAVI   ++  A+W++F
Sbjct: 426 KAGAGIITAVIGISIVACALWLVF 449

>Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C -
           Hypothetical ORF [contig 58] FULL
          Length = 449

 Score =  484 bits (1246), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 239/453 (52%), Positives = 312/453 (68%), Gaps = 5/453 (1%)

Query: 7   MKIALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQS 66
           M I+L   FTLL   + +  + LD  +  SI +ATAL+  G+LDYY G +YG T+GMF  
Sbjct: 1   MWISLTCVFTLLVTLRGSLGIYLDVNNTESIKNATALVAGGLLDYYTGLQYGETIGMFSD 60

Query: 67  PYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGI 126
           PYYWW AG A+G +++ W+  QNDTY  +L  ALL Q+G ++DYIP NQ+  EGNDDQ  
Sbjct: 61  PYYWWEAGGAWGSILDYWHYTQNDTYNKILEQALLYQSGENHDYIPLNQSTTEGNDDQAF 120

Query: 127 WGITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNY 186
           WG+ VM A ERNFTNP    P WL + QAVFNTM  RWD + CGGGLRWQIFTWNSGY+Y
Sbjct: 121 WGLVVMAAAERNFTNPPPDQPQWLYLAQAVFNTMALRWDEDTCGGGLRWQIFTWNSGYDY 180

Query: 187 KNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNC 246
           KNT+SN  LF +AARL RYTGN TY++ AE+VFDW+  +  +   +   VYDGA++D NC
Sbjct: 181 KNTVSNGALFHLAARLARYTGNDTYVEWAEKVFDWMKGIKLLTEENENFVYDGAKVDDNC 240

Query: 247 TDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQD 306
           T ITK+ WTYN G+++ G AY+YN T G  +W T   + LN ++  FF + ++YE ACQ 
Sbjct: 241 TVITKLIWTYNQGLLMSGSAYLYNYT-GAEKWHTRTFEFLN-SSHIFFNNSVLYERACQG 298

Query: 307 YG-TCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGL 365
              +CNTDQR+FK+ FSR +GLT+ + P +   I A I+ SA  AA+SC GG DGHTCGL
Sbjct: 299 VTVSCNTDQRSFKAYFSRFMGLTAQLVPESRSKIMAWIQASALGAAQSCSGGRDGHTCGL 358

Query: 366 DWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQ 425
           +W  +  DG +GLGEQMSALE++QNLL  DRPAPY  + GG+S G+  AG  +S T++  
Sbjct: 359 NWFYDGWDGKWGLGEQMSALEIMQNLLCLDRPAPYTAETGGSSVGNGAAGTETSATNL-- 416

Query: 426 NNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458
           + L IT G RA A IITAVI   ++   +W++ 
Sbjct: 417 SPLAITAGSRAAAGIITAVIGLSIVACTIWLVL 449

>NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  483 bits (1242), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 239/452 (52%), Positives = 306/452 (67%), Gaps = 5/452 (1%)

Query: 7   MKIALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQS 66
           MK    + F LL+F    +A+ LD  +  S+ + TAL+  G++DYY G +YG TVGMF +
Sbjct: 1   MKRVFNILF-LLTFTHRANALSLDLNNYQSLENDTALVAYGLMDYYNGDQYGQTVGMFSN 59

Query: 67  PYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGI 126
           PYYWW AG A+G M++ W+  +NDTY  L+  ALL QTG + DYIP NQ+  EGNDDQ  
Sbjct: 60  PYYWWEAGGAWGTMLDYWFFMENDTYNDLIMSALLHQTGENNDYIPLNQSTTEGNDDQAF 119

Query: 127 WGITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNY 186
           WGI  M A ERNFTNP   +P WL + QAVFNTM  RWD++NCGGGLRWQIF WNSGY+Y
Sbjct: 120 WGIAAMTAAERNFTNPPESSPQWLYLAQAVFNTMALRWDAQNCGGGLRWQIFVWNSGYDY 179

Query: 187 KNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNC 246
           KN++SN  LF +AARL RYTGN +Y+D AE+ +DW+ DVG +       VYDG  I+TNC
Sbjct: 180 KNSVSNGALFHLAARLARYTGNQSYVDWAEKTYDWMSDVGLISNGTQKYVYDGTSIETNC 239

Query: 247 TDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQD 306
           T IT  +W+YN G++L G AY+YN T G++ W      +L+ A S FF + IMYE ACQ 
Sbjct: 240 TTITSYQWSYNQGLMLAGAAYLYNFT-GSTIWLNRTMDLLD-ATSVFFNNSIMYEVACQP 297

Query: 307 YGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLD 366
            GTCN DQR+FKS  +R LGLT+ +   T   I   + TSA A A SC GGTDGHTCGL+
Sbjct: 298 TGTCNNDQRSFKSYLARFLGLTAQLVTITQSRIMNWLNTSAIAVAHSCSGGTDGHTCGLN 357

Query: 367 WEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQN 426
           W     DGYYGLGEQMSAL+V+ N  + DRPAPY   NGG+S GD  AG  ++ T++   
Sbjct: 358 WFDNGWDGYYGLGEQMSALDVLVNTRVLDRPAPYNSTNGGSSIGDGAAGTEATPTNLAP- 416

Query: 427 NLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458
            L+ITKG + GAA ITA I   ++  ++W++ 
Sbjct: 417 -LHITKGSKVGAAFITAAIGLSIVFTSIWIIL 447

>TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.570
           YKL046C
          Length = 452

 Score =  476 bits (1224), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 237/442 (53%), Positives = 306/442 (69%), Gaps = 5/442 (1%)

Query: 17  LLSFFKA-TDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGE 75
           +LS + + T A+ LD  +  S+ +ATAL+  G++DYY G +YG T+GMF  PYYWW AG 
Sbjct: 14  ILSLYSSLTSAVYLDLDNYESLQNATALVAYGLMDYYTGLQYGKTIGMFSDPYYWWEAGG 73

Query: 76  AFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAV 135
           A+G M++ W+  +NDTY  ++  ALL Q G   DY+P NQ+  EGNDDQ  WGI  M A 
Sbjct: 74  AWGCMLDYWFFMENDTYNDIIKQALLYQVGTANDYVPLNQSTTEGNDDQAFWGIAAMMAA 133

Query: 136 ERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACL 195
           ERNFTNP    P WL + QAVFNTM  RWD+++CGGGLRWQIF WNSGY+YKN++SN  L
Sbjct: 134 ERNFTNPAEDEPQWLYLAQAVFNTMALRWDTDSCGGGLRWQIFQWNSGYDYKNSVSNGAL 193

Query: 196 FQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTDITKIEWT 255
           F IAARL RYTGN +Y + AE+V+DW+VDV  +  +    VYDG + + NCT ITK +WT
Sbjct: 194 FHIAARLARYTGNDSYAEWAEKVYDWMVDVDLITQDQYYFVYDGVDSNDNCTTITKYQWT 253

Query: 256 YNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNTDQR 315
           YN G++L G AY+YN T G+  W T  +  L+ ++S FF D I+YE+ACQ+  TCNTDQR
Sbjct: 254 YNQGLILSGCAYLYNYT-GSELWHTRTKNFLS-SSSVFFNDTILYEAACQNQETCNTDQR 311

Query: 316 TFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGY 375
           +FK+ FSR LG+T+ + P T D I   I  SA  AA+SC GGTDGHTCG++W     DG 
Sbjct: 312 SFKAYFSRFLGVTAQLVPETRDNIMKWIDASAYGAAESCSGGTDGHTCGINWFYGGWDGK 371

Query: 376 YGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNLNITKGDR 435
           YGLGEQM+ALE++ N    DRPAPY   NGG+S GD  AG  +S T++  + LNIT G R
Sbjct: 372 YGLGEQMAALEILVNTRALDRPAPYTSSNGGSSTGDGAAGTETSATNL--SPLNITAGSR 429

Query: 436 AGAAIITAVILSVLIGGAVWML 457
           AGA IITAVI   ++  A W++
Sbjct: 430 AGAGIITAVIGISIVACACWLV 451

>KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {ON}
           Anc_2.570 YKL046C
          Length = 448

 Score =  474 bits (1221), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 240/453 (52%), Positives = 307/453 (67%), Gaps = 6/453 (1%)

Query: 7   MKIALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQS 66
           M I   +   L +F     +++LD  S  S+ +ATAL+  G++DYY G +YG TVGMF  
Sbjct: 1   MVINNLILLILSTFIGRVYSLELDLDSFESLQNATALVAYGLMDYYTGNQYGKTVGMFSD 60

Query: 67  PYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGI 126
           PYYWW AG A+G M++ WY   N+TY   +  ALL QTG D+DYIP NQ+  EGNDDQ  
Sbjct: 61  PYYWWEAGGAWGSMIDFWYYMDNNTYNDDIMAALLHQTGDDWDYIPLNQSTTEGNDDQAF 120

Query: 127 WGITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNY 186
           WGI VM A ERNFTNP +  P WL + QAVFNTM  RWD   CGGGLRWQIFTWNSGY+Y
Sbjct: 121 WGIAVMTAAERNFTNPPDDQPQWLYLAQAVFNTMALRWDDATCGGGLRWQIFTWNSGYDY 180

Query: 187 KNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTAN-VYDGAEIDTN 245
           KNT+SN  LF +AARL RYTGNT+Y+D AE+V++W+ D  Y++ N T   VYDGA +  N
Sbjct: 181 KNTVSNGALFHLAARLARYTGNTSYVDWAEKVYNWMEDT-YLISNGTQMFVYDGASVTDN 239

Query: 246 CTDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQ 305
           CT +TK +WTYN G++L G AY+YN T  +  W    +  LN A+  FF + IMYE+ACQ
Sbjct: 240 CTTVTKYQWTYNQGLLLSGSAYLYNFTE-SELWHERTKGFLN-ASVVFFNNSIMYEAACQ 297

Query: 306 DYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGL 365
              TCNTDQR+FK+ FSR LG T+ + P T DT+   + TSA AAA SC GGTDGHTCG+
Sbjct: 298 GPQTCNTDQRSFKAYFSRFLGATAQLVPETRDTVMHWVNTSAVAAATSCSGGTDGHTCGI 357

Query: 366 DWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQ 425
           +W     DGYYGLGEQMSALE++ N     +P PY  +NGG+S GD  AG  ++ T++  
Sbjct: 358 NWFYGGWDGYYGLGEQMSALEIMVNTRALHKPGPYTSENGGSSMGDGAAGTQATATNL-- 415

Query: 426 NNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458
           + LN+T G +A A IITAVI   +    +W+++
Sbjct: 416 SPLNVTPGSKAAAGIITAVIGISIFACVLWLIY 448

>NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {ON}
           Anc_2.570
          Length = 452

 Score =  474 bits (1220), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 236/443 (53%), Positives = 298/443 (67%), Gaps = 4/443 (0%)

Query: 16  TLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGE 75
           T L    +T A+++D     S+ +AT+L+  G++DYY G +YG T+GMF  PYYWW AG 
Sbjct: 14  TTLLLSHSTKALEIDLDDIDSLRNATSLVAYGLMDYYTGNQYGKTIGMFSDPYYWWEAGG 73

Query: 76  AFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAV 135
           A+G M++ WY   NDTY   +  ALL QTG + DY+P NQ+  EGNDDQ  WGI VM A 
Sbjct: 74  AWGSMLDYWYYMDNDTYNDEIMAALLHQTGDNNDYVPLNQSTTEGNDDQAFWGIAVMTAA 133

Query: 136 ERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACL 195
           ERNFTNP   +P WL + QAVFNTM  RWD + CGGGLRWQIF WNSGY+YKNT+SN  L
Sbjct: 134 ERNFTNPPEDSPQWLYLAQAVFNTMALRWDGDTCGGGLRWQIFVWNSGYDYKNTVSNGAL 193

Query: 196 FQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTDITKIEWT 255
           F +AARL RYTGN +Y+D AE+V+DW+ +VG V    +  VYDG  I  NC+ IT  +WT
Sbjct: 194 FHMAARLARYTGNQSYVDWAEKVYDWMYEVGLVSNGSSMFVYDGVNIANNCSTITPYQWT 253

Query: 256 YNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNTDQR 315
           YNHG+V+ G AY+YN T     W    + +++ A++ FF + IMYE+ACQ   +CNTDQR
Sbjct: 254 YNHGLVMAGAAYLYNFTE-NEVWHNRTKMLVD-ASTVFFNNSIMYEAACQGPNSCNTDQR 311

Query: 316 TFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGY 375
           +FK+ FSR LG T+ + P T   I  LI  SA AA KSC GGTDGHTCGL+W     DG 
Sbjct: 312 SFKAYFSRFLGATAQLVPETRSKILPLINASAIAAGKSCSGGTDGHTCGLNWFIGDWDGM 371

Query: 376 YGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNLNITKGDR 435
           YGLGEQM ALEV+ N     +PAPY   NGG+S GD  AG     T++    L+ITKG R
Sbjct: 372 YGLGEQMCALEVMVNTRCLHKPAPYTSTNGGSSVGDGAAGTEHHPTNLAP--LHITKGSR 429

Query: 436 AGAAIITAVILSVLIGGAVWMLF 458
           AGA IITAVI   ++  A+W++F
Sbjct: 430 AGAGIITAVIGISILACALWLVF 452

>NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570
          Length = 453

 Score =  474 bits (1219), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 240/454 (52%), Positives = 301/454 (66%), Gaps = 5/454 (1%)

Query: 6   SMKIALPLCFTLLSFFKA-TDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMF 64
           S  I+  L  +L S   +   A+ LD     S+ +AT+L+  G++DYY G +YG TVGMF
Sbjct: 4   SKSISTFLLLSLASILPSQVSALTLDLNDTESLQNATSLVAYGLMDYYTGNQYGKTVGMF 63

Query: 65  QSPYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQ 124
             PYYWW AG A+G M++ WY   NDTY   +  ALL QTG D DY+P NQ+  EGNDDQ
Sbjct: 64  SDPYYWWQAGGAWGSMLDYWYYMNNDTYNDDIMAALLHQTGDDNDYVPLNQSTTEGNDDQ 123

Query: 125 GIWGITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGY 184
             WGI VM A ERNFTNP    P WL + QAVFNTM  RWDS+ CGGGLRWQIF WNSGY
Sbjct: 124 AFWGIAVMTAAERNFTNPPEDQPQWLYLAQAVFNTMAMRWDSDTCGGGLRWQIFIWNSGY 183

Query: 185 NYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDT 244
           +YKNT+SN  LF IA+RL RYTGN +Y+D AE+V+DW+ DV  +       VYDG  I  
Sbjct: 184 DYKNTVSNGALFHIASRLARYTGNQSYVDWAEKVYDWMYDVHLISNGSYMYVYDGVNIGD 243

Query: 245 NCTDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESAC 304
           NCT +T  +WTYN G++L G AY+YN T G   W    + +L  AA  FF + I+YE+AC
Sbjct: 244 NCTTVTPYQWTYNQGLLLSGCAYLYNFT-GEELWHNRTKNLLT-AAGVFFNNSILYEAAC 301

Query: 305 QDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCG 364
           Q + TCNTDQR+FK+ FSR LG T+ + P T + I   I TSA AAA+SC GGTDGHTCG
Sbjct: 302 QGHNTCNTDQRSFKAYFSRFLGTTAQLVPETRNQIMHWINTSAVAAAQSCSGGTDGHTCG 361

Query: 365 LDWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVL 424
           ++W  +  DG YGLGEQM+ALE++ N     + APY   NGG+S GD  AG     T++ 
Sbjct: 362 INWFADGWDGMYGLGEQMAALEIMVNTKALSKAAPYTSSNGGSSVGDGAAGTEPHPTNLA 421

Query: 425 QNNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458
              L+ITKG RAGA IITAVI   ++  A+W++F
Sbjct: 422 P--LHITKGSRAGAGIITAVIGISIVTCALWLVF 453

>NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  471 bits (1212), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 235/445 (52%), Positives = 300/445 (67%), Gaps = 4/445 (0%)

Query: 13  LCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWH 72
           L FT+ SF     A+DL+  S  S+ +AT+L+  G++DYY G +YG TVGMF  PYYWW 
Sbjct: 6   LLFTVSSFSFPIAAVDLNLNSLQSLQNATSLVAYGLMDYYTGDQYGQTVGMFSDPYYWWE 65

Query: 73  AGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVM 132
           AG A+G M++ WY  QNDTY  ++  ALL Q G D +YIP NQ+  EGNDDQ  WGITVM
Sbjct: 66  AGGAWGTMLDYWYFMQNDTYNDIITAALLHQVGTDNNYIPLNQSTTEGNDDQAFWGITVM 125

Query: 133 GAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISN 192
            A ERNFTNP    P WL + QAVFNTM  RWD+++CGGGLRWQIF WNSGY+YKN++SN
Sbjct: 126 TAAERNFTNPPEDQPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNSVSN 185

Query: 193 ACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTDITKI 252
             LF +AARL RYTGN +Y+D AE+V+DW+ DVG +       VYDGA    NCT +T  
Sbjct: 186 GALFHMAARLARYTGNQSYVDWAERVYDWMSDVGLISNGSYKFVYDGASTTDNCTVLTTY 245

Query: 253 EWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNT 312
           +WTYN G++L G AY+YN T G+  W     Q+LN A+S FF + I+YE+ACQ  GTCN 
Sbjct: 246 QWTYNQGLLLSGAAYLYNYT-GSDTWLLRTNQLLN-ASSVFFNNSILYEAACQKSGTCNN 303

Query: 313 DQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETN 372
           DQR+FK+ F R LG T+ +   T  TI   +  SA AAA+SC GGTDGHTCGL+W     
Sbjct: 304 DQRSFKAYFLRFLGQTAQLVSETQPTIMKWLNASAYAAAQSCSGGTDGHTCGLNWFSGGW 363

Query: 373 DGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNLNITK 432
           DG YGLGEQMSALE + N  +   P PY   +GG+S G++ AG     T++    L+IT 
Sbjct: 364 DGMYGLGEQMSALEALVNTRVLHLPGPYNSTDGGSSIGNSAAGTEQEATNLAP--LHITD 421

Query: 433 GDRAGAAIITAVILSVLIGGAVWML 457
           G +A AAIIT+V+   ++   VW++
Sbjct: 422 GSKAAAAIITSVVGISIVAAGVWLI 446

>TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {ON} 
          Length = 450

 Score =  466 bits (1198), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 232/452 (51%), Positives = 305/452 (67%), Gaps = 12/452 (2%)

Query: 10  ALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYY 69
           +L    +LL  F  T+A+ +D    +S+ +AT+LI  GM+DYY G  YG  +GMF  PYY
Sbjct: 6   SLLFQISLLPLF--TNALKIDLDDFSSLQNATSLIAYGMMDYYNGHDYGQVIGMFAKPYY 63

Query: 70  WWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGI 129
           WW AG A+G +++ WY  QNDTY  L+ +ALL QTG   DY+P NQ+  EGNDDQ  WGI
Sbjct: 64  WWEAGGAWGCLLDYWYYMQNDTYNDLITEALLYQTGDRNDYVPLNQSTTEGNDDQAFWGI 123

Query: 130 TVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNT 189
             + A ERNFTNP    P WL + QAVFNTM  RWD   C GGLRWQIF WNSGY+YKN+
Sbjct: 124 AAITAAERNFTNPPPDKPQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSGYSYKNS 183

Query: 190 ISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTAN----VYDGAEIDTN 245
           +SN  LF IAARL RYTGN +Y++ A++++DW+   G  +++D       VYDGA I+TN
Sbjct: 184 VSNGALFHIAARLARYTGNQSYVEWADKIYDWMFGTG--IISDEYETYKFVYDGANIETN 241

Query: 246 CTDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQ 305
           CTDIT+ +WTYN G+VL G AY+YN T    +W    +Q LNG+   FF+D ++YE+ACQ
Sbjct: 242 CTDITRYQWTYNQGLVLAGCAYLYNHTQ-DEKWLIRTEQFLNGSVV-FFRDNVIYEAACQ 299

Query: 306 DYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGL 365
               CN DQR+FK+ F+R LG+T+ + P T DTI   I TSA AAA++C GGTDGHTCG+
Sbjct: 300 PNKNCNNDQRSFKAYFARFLGVTAQLIPSTRDTIMRWINTSAYAAAQACSGGTDGHTCGM 359

Query: 366 DWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQ 425
           DW  +  DGYYGLGEQM+ALE + N    D P PY   NGG+S G   AG     T++  
Sbjct: 360 DWVWKGWDGYYGLGEQMAALEFMVNTRALDMPPPYTSFNGGSSTGSGAAGTERDPTNL-- 417

Query: 426 NNLNITKGDRAGAAIITAVILSVLIGGAVWML 457
           + L+IT G +AGA+IIT ++   ++ GA+W++
Sbjct: 418 SPLHITAGSKAGASIITCIVSISILTGAMWLV 449

>TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {ON} 
          Length = 449

 Score =  465 bits (1196), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 237/443 (53%), Positives = 304/443 (68%), Gaps = 10/443 (2%)

Query: 11  LPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYW 70
           L +  ++L+ F     ++L+ TS  S+ +A +L+  G++DYY G +YG T+GMF +PYYW
Sbjct: 7   LIIQISILASFSTAVHLNLNVTS--SLQNAASLVAVGLMDYYNGDQYGQTIGMFSNPYYW 64

Query: 71  WHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGIT 130
           W AG A+G M++ WY  QNDTY  ++  ALL QTG   DYIP NQ+  EGNDDQ  WGIT
Sbjct: 65  WEAGGAWGCMIDYWYFMQNDTYNDIISQALLYQTGDRNDYIPLNQSTTEGNDDQAFWGIT 124

Query: 131 VMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTI 190
           VM A ERNFTNP    P WL + QAVFNTM  RWD   C GGLRWQIF WNSGY+YKN++
Sbjct: 125 VMSAAERNFTNPPPDKPQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSGYSYKNSV 184

Query: 191 SNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDT--ANVYDGAEIDTNCTD 248
           SN  LF +AARL RYTGN +Y+D A +V+DW+   G ++ NDT    VYDGA I+TNCTD
Sbjct: 185 SNGALFHMAARLARYTGNQSYVDWAVKVYDWMEKTG-LISNDTYFKFVYDGASIETNCTD 243

Query: 249 ITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYG 308
           IT+ +WTYN G++L G AY+YN T   S+W T  +Q +NG+A  FF + I+YE+ACQ   
Sbjct: 244 ITQFQWTYNQGLILSGCAYLYNHTE-DSKWLTRTEQFVNGSA-VFFNNSIVYEAACQGSK 301

Query: 309 TCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWE 368
            C+ DQR+F++ F+R LG+T+ + P T D I   I TSA AAA++C GGTDGHTCGL+W 
Sbjct: 302 RCDNDQRSFRAYFARFLGVTAQLVPTTKDIIMDWINTSAYAAAQACSGGTDGHTCGLNWF 361

Query: 369 KETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNL 428
               DGYYGLGEQM ALE + N    D PAPY   NGG+S G+  AG     T++    L
Sbjct: 362 NIGWDGYYGLGEQMGALEFLVNTRALDMPAPYTSSNGGSSTGNGAAGTEKPPTNL--GPL 419

Query: 429 NITKGDRAGAAIITAVI-LSVLI 450
           +IT G +AGA IIT VI LS+L+
Sbjct: 420 HITDGSKAGAGIITCVIGLSILL 442

>KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.570
           YKL046C
          Length = 449

 Score =  463 bits (1192), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 233/446 (52%), Positives = 307/446 (68%), Gaps = 4/446 (0%)

Query: 13  LCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWH 72
               L +    + +++LD     S+ +ATAL+  G++DYYEGT+YGGTVGMF SPYYWW 
Sbjct: 8   FALILSTLIWRSQSLELDLDDYQSLQNATALVAWGLMDYYEGTKYGGTVGMFSSPYYWWE 67

Query: 73  AGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVM 132
           AG AFG +++ WY   NDTY   +  A++ Q G D+DYIP NQ+  EGNDDQ  WGI  M
Sbjct: 68  AGGAFGTLLDFWYFMDNDTYNDEILAAMVYQAGNDWDYIPLNQSTTEGNDDQAFWGIAAM 127

Query: 133 GAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISN 192
            A ERNFTNP +  P WL + QAVFNTM  RWD+++CGGGLRWQIFTWNSGY+YKN++SN
Sbjct: 128 TAAERNFTNPASDEPQWLYLAQAVFNTMALRWDTDSCGGGLRWQIFTWNSGYDYKNSVSN 187

Query: 193 ACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTDITKI 252
             LF +AARL RYTGN +Y+D AE+V++W+ D G++   +T  VYDGA  + NC+ +TK 
Sbjct: 188 GALFHLAARLARYTGNDSYVDWAEKVYNWMEDTGFITTGNTLYVYDGASTEDNCSSVTKY 247

Query: 253 EWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNT 312
           +WTYN G++L G AY+YN +  +S W       L+ ++  F  + IM E+ACQ  GTC+T
Sbjct: 248 QWTYNQGLILSGAAYLYNYSE-SSLWYNRTMTALS-SSGVFLNNSIMCEAACQPAGTCDT 305

Query: 313 DQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETN 372
           DQR+FK+ F+R LG+T+ + P T   I   +  SA A A+SC GGTDGHTCGL+W   + 
Sbjct: 306 DQRSFKAYFARFLGVTAQLVPSTRTQIMTWMNASAYAVAESCSGGTDGHTCGLNWFLGSW 365

Query: 373 DGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNLNITK 432
           DGYYGLGEQMSALEV+ N    D+P PY   NGG+S+GD  AG  ++ T++    LNIT 
Sbjct: 366 DGYYGLGEQMSALEVLVNTRALDKPGPYNSTNGGSSQGDGAAGTETTATNLAP--LNITG 423

Query: 433 GDRAGAAIITAVILSVLIGGAVWMLF 458
           G +A AAIITAVI   LI   +W++F
Sbjct: 424 GSKAAAAIITAVIGISLIACTLWIIF 449

>TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON}
           Anc_2.570 YKL046C
          Length = 447

 Score =  450 bits (1157), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 222/450 (49%), Positives = 295/450 (65%), Gaps = 4/450 (0%)

Query: 9   IALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPY 68
             + L   L S F   +A+ +D  +  SI +A++L+  G++DYY G +YG T+GMF  PY
Sbjct: 2   FVMRLLAALASTFACANAVWIDLNNTESIHNASSLVAVGLMDYYTGLQYGETIGMFSDPY 61

Query: 69  YWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWG 128
           YWW AG A+G M++ W+  QNDTY  ++  ALL Q G   DY+P NQ+  EGNDDQ  WG
Sbjct: 62  YWWEAGGAWGCMLDYWWYMQNDTYNDIIMQALLYQVGTHNDYVPLNQSTTEGNDDQAFWG 121

Query: 129 ITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKN 188
           I  M A ERNFTNP +  P WL + QAVFNTM  RWD+ +C GGLRWQIF WN+GY+YKN
Sbjct: 122 IAAMTAAERNFTNPPSDQPQWLYLAQAVFNTMALRWDTTSCNGGLRWQIFMWNTGYDYKN 181

Query: 189 TISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTD 248
           T+SN  LF +AARL RYTGN +Y+D A++V+DW+  VG +   ++  VYDG  I  NC +
Sbjct: 182 TVSNGALFNLAARLARYTGNQSYVDWADKVYDWMYGVGLISNGNSRFVYDGVNIAHNCAN 241

Query: 249 ITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYG 308
           IT  +W+YNHG++L G AY+YN T    +W     + LN +AS F+ + ++YE ACQ   
Sbjct: 242 ITGYQWSYNHGLMLSGCAYLYNMTK-DEKWGNRTFEYLN-SASIFYNNSVLYEVACQTVN 299

Query: 309 TCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWE 368
            CNTDQR+FK+ F+R LG+T+ + P   D     I  SA  AA+SC GG DGHTCG++W 
Sbjct: 300 KCNTDQRSFKAYFTRFLGVTAELIPQARDQAMKWINASALGAAQSCSGGYDGHTCGINWF 359

Query: 369 KETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNL 428
            +  DG YGLGEQMSALE + N    +RP PY   NGG+S GD  AG   S T++  + L
Sbjct: 360 YDGWDGMYGLGEQMSALEALVNTQALNRPPPYNSTNGGSSTGDGAAGTEESPTNL--SPL 417

Query: 429 NITKGDRAGAAIITAVILSVLIGGAVWMLF 458
           +IT G RAGA IIT VI   ++  A+W++ 
Sbjct: 418 DITAGSRAGAGIITCVIGISILSCALWLIL 447

>CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa]
           {ON} highly similar to uniprot|P36091 Saccharomyces
           cerevisiae YKL046c
          Length = 446

 Score =  447 bits (1149), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 237/443 (53%), Positives = 296/443 (66%), Gaps = 8/443 (1%)

Query: 16  TLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGE 75
           +L+S F     ++LD     S+ +ATAL+  G++DYY G +YG TVGMF  PYYWW AG 
Sbjct: 12  SLVSVF----GLELDLDDYASLQNATALVAYGLMDYYTGDQYGKTVGMFSDPYYWWQAGG 67

Query: 76  AFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAV 135
           A+G M++ WY  QNDTY   +  ALL QTG + DY+P NQ+  EGNDDQ  WGI VM A 
Sbjct: 68  AWGCMLDYWYFMQNDTYNDKIMAALLHQTGDNNDYVPLNQSTTEGNDDQAFWGIAVMQAA 127

Query: 136 ERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACL 195
           ER F NP +  P WL + QAVFNTM  RWDSE CGGGLRWQIF WNSGY+YKNT+SN  L
Sbjct: 128 ERKFPNPPDDKPQWLYLTQAVFNTMALRWDSETCGGGLRWQIFVWNSGYDYKNTVSNGAL 187

Query: 196 FQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTDITKIEWT 255
           F IAARL RYTGN +Y+D AE+V+DW+ DV  +       VYDG  I+ NCT +TK +WT
Sbjct: 188 FHIAARLARYTGNQSYVDWAERVYDWMEDVHLIDNGTYRYVYDGVSINDNCTTVTKYQWT 247

Query: 256 YNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNTDQR 315
           YN G++L G AY++N T G+  W       LN A+  FF + I+YE+ACQ   TCNTDQR
Sbjct: 248 YNQGLMLSGSAYLFNMT-GSDLWHERTHAFLN-ASRVFFNNSILYEAACQGPNTCNTDQR 305

Query: 316 TFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGY 375
           +FK+ F+R LG T+ + P T   I   + TSA AAAKSC GGTDGHTCGL+W ++  DG 
Sbjct: 306 SFKAYFARFLGSTAELVPETRQQIMTWLNTSALAAAKSCSGGTDGHTCGLNWFRDDWDGM 365

Query: 376 YGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNLNITKGDR 435
           YGLGEQM+ALEV+ N     R  PY   NGG S GD  AG     T++    L+IT G R
Sbjct: 366 YGLGEQMAALEVMVNTQALKRAPPYNATNGGNSTGDGAAGTKPHPTNLAP--LHITGGSR 423

Query: 436 AGAAIITAVILSVLIGGAVWMLF 458
           AGA IITA+I   +I  A+W+++
Sbjct: 424 AGAGIITAIIGISIIACALWLVY 446

>TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {ON}
           Anc_2.570 YKL046C
          Length = 449

 Score =  446 bits (1146), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 228/435 (52%), Positives = 295/435 (67%), Gaps = 5/435 (1%)

Query: 24  TDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMVEN 83
           T+A+ L+   ++S+ +A AL+  G++DYY G +YG T+GMF  PYYWW AG A+G M++ 
Sbjct: 18  TNAVSLNLNDSSSLDNAAALVAYGLMDYYNGNQYGQTIGMFSDPYYWWEAGGAWGCMLDY 77

Query: 84  WYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTNPD 143
           WY  QNDTY  ++Y+AL  QTG D DYIP NQ+  EGNDDQ  WGI  + A ERNFTNP 
Sbjct: 78  WYYMQNDTYNDVIYEALQYQTGDDNDYIPLNQSTTEGNDDQAFWGIAAITAAERNFTNPP 137

Query: 144 NGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLG 203
              P WL + QAVFNTM  RWDS+ C GGLRWQIF WNSGY+YKN++SN  LF IAARL 
Sbjct: 138 PDKPQWLYLAQAVFNTMALRWDSDTCNGGLRWQIFVWNSGYSYKNSVSNGALFHIAARLA 197

Query: 204 RYTGNTTYLDVAEQVFDWLVDVGYVVLNDTAN-VYDGAEIDTNCTDITKIEWTYNHGIVL 262
           RYTGN +Y+D +E+V+DW++  G +    T   V+DG  I+TNCTDIT  +WTYN G++L
Sbjct: 198 RYTGNQSYVDWSEKVYDWMLGTGLISNGTTYKFVHDGVNIETNCTDITPYQWTYNQGLLL 257

Query: 263 GGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNTDQRTFKSIFS 322
            G AY+YN T    +W     Q LNG+   FF + ++YE+ACQ    CN DQR+FK+ F+
Sbjct: 258 AGCAYLYNFTQ-DEKWLIRTNQFLNGSGV-FFNNSVIYEAACQPNKNCNNDQRSFKAYFA 315

Query: 323 RMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGYYGLGEQM 382
           R LG+T+ + P T DTI   I TSA AAA++C GGTDGHTCG+DW     DGYYGLGEQM
Sbjct: 316 RFLGVTAQLLPSTRDTIMQWIDTSAYAAAQACSGGTDGHTCGMDWNWNGWDGYYGLGEQM 375

Query: 383 SALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNLNITKGDRAGAAIIT 442
           +ALE + N    D P PY   NGG+S G   AG     T++    LNIT G +AGA IIT
Sbjct: 376 AALEFMVNTRALDLPPPYTSSNGGSSTGSGAAGTEQKPTNL--GPLNITAGSKAGAGIIT 433

Query: 443 AVILSVLIGGAVWML 457
            V+   ++  ++W++
Sbjct: 434 CVVGISILACSMWLV 448

>Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON}
           complement(6537..7889) [1353 nt, 451 aa]
          Length = 450

 Score =  437 bits (1124), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 219/429 (51%), Positives = 284/429 (66%), Gaps = 7/429 (1%)

Query: 8   KIALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSP 67
           K+ + L  T+  +F+A  A++LD  +  S+ +AT+L+  G++DYY G +YG T+GMF +P
Sbjct: 5   KVLISLLCTV--WFRAGHAVELDLNNLDSLRNATSLVAYGLMDYYNGLQYGQTIGMFSNP 62

Query: 68  YYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIW 127
           YYWW AG A+G M++ WY  QNDTY  ++  AL  QTG + DY+P NQ+  EGNDDQ  W
Sbjct: 63  YYWWEAGGAWGTMIDYWYYMQNDTYNDIIMQALQYQTGVNNDYVPLNQSTTEGNDDQAFW 122

Query: 128 GITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYK 187
           GI VM A ERNFTNP    P WL + QAVFNTM  RWD + C GGLRWQIF WNSGY+YK
Sbjct: 123 GIAVMSAAERNFTNPPADRPQWLYLAQAVFNTMALRWDDQTCNGGLRWQIFVWNSGYDYK 182

Query: 188 NTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDT-ANVYDGAEIDTNC 246
           N++SN  LF I ARL R+TGN +Y++ AE+V+DW+  V  +  +   A VYDG  I  NC
Sbjct: 183 NSVSNGALFHIGARLARFTGNDSYVEWAEKVYDWMESVNLIEDDGKGAFVYDGVNIGDNC 242

Query: 247 TDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQD 306
           T +T ++WTYNHG++L G AY+YN T G ++W    ++ L   A  FF   +M+E+ACQ 
Sbjct: 243 TKVTNLQWTYNHGLILSGCAYLYNYT-GDAKWYNRTERFLE-YAYVFFNRTVMFEAACQG 300

Query: 307 YGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLD 366
             TC TDQRTFK+ FSR LG+T+ + P T  TI   +  SA  AA+SC GG DGHTCG++
Sbjct: 301 VHTCTTDQRTFKAYFSRFLGMTAQLVPDTQHTIMTYMNASAYGAAQSCSGGYDGHTCGIN 360

Query: 367 WEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQN 426
           W     DGYYGLGEQM ALEV+ N      P PY   NGG+S GD  AG     T++  +
Sbjct: 361 WFYGGWDGYYGLGEQMCALEVMINTRALHVPGPYNSTNGGSSTGDGAAGTEQHPTNL--S 418

Query: 427 NLNITKGDR 435
            LNIT G R
Sbjct: 419 PLNITSGSR 427

>Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {ON}
           similar to Ashbya gossypii ABR060W
          Length = 450

 Score =  437 bits (1124), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 217/435 (49%), Positives = 295/435 (67%), Gaps = 9/435 (2%)

Query: 26  AMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMVENWY 85
           A++LD    +S+  AT+LI  G+LDYY G   G T+GMF SPYYWW AG A+G +++ W+
Sbjct: 21  ALELDVDDFSSMQSATSLISTGVLDYYTGLDPGNTIGMFSSPYYWWEAGAAWGALIDYWF 80

Query: 86  LCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTNPDNG 145
             +NDTY  ++  ALL Q G   DY+P NQ+  EGNDDQ  WGI VM A E+ F NPD  
Sbjct: 81  YMENDTYNDIIKQALLYQVGKYEDYVPLNQSTTEGNDDQAFWGIAVMSAAEKGFPNPDPD 140

Query: 146 APGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRY 205
            P WLA+ QAVFNTM  RWDS +C GGLRWQIFTWN+GY+YKN++SN  LF +AARL RY
Sbjct: 141 QPQWLALAQAVFNTMAYRWDSSSCNGGLRWQIFTWNTGYDYKNSVSNGALFHLAARLARY 200

Query: 206 TGNTTYLDVAEQVFDWLVDVGYVVLNDTAN---VYDGAEIDTNCTDITKIEWTYNHGIVL 262
           TGN +Y D AE+V+DW+  V   ++N T +   VYDGA I  NC+  + ++W+YNHG++L
Sbjct: 201 TGNQSYADWAEKVYDWMASV--QLINQTGDWTFVYDGAFIHDNCSRPSVLQWSYNHGLIL 258

Query: 263 GGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNTDQRTFKSIFS 322
           GG AY+ + T G+  W     ++L  +AS FF +G++ E ACQ+ GTCNTDQR+FK+ F 
Sbjct: 259 GGCAYLTDFT-GSDVWHNRTLRLLR-SASIFFPNGVVTEVACQEAGTCNTDQRSFKAYFM 316

Query: 323 RMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGYYGLGEQM 382
           R LGLT+ + P + +     I+ SA+ AA SC GG DGHTCG+++ + + D  YGLGEQ+
Sbjct: 317 RFLGLTAQLIPESREIAMKWIRDSAKGAALSCSGGRDGHTCGMNYSRGSYDESYGLGEQL 376

Query: 383 SALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNLNITKGDRAGAAIIT 442
           +ALE IQNL   ++ +P     GGTS G+  AG N +  ++  + L+I+  DRAGA IIT
Sbjct: 377 AALETIQNLRCLEKGSPLTASEGGTSIGNPGAGGNRNLGTL--SPLDISNADRAGAGIIT 434

Query: 443 AVILSVLIGGAVWML 457
           A++   LI   VW++
Sbjct: 435 ALVGFSLISCIVWLV 449

>ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL046C
          Length = 451

 Score =  437 bits (1124), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 219/434 (50%), Positives = 284/434 (65%), Gaps = 6/434 (1%)

Query: 27  MDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMVENWYL 86
           ++LD     SI +AT+L+  G++DYY G  YG TVG F  PYYWW AG A+G +++ WY 
Sbjct: 22  LNLDVDDLQSIREATSLLATGLMDYYHGHDYGETVGKFSDPYYWWEAGGAWGSILDYWYY 81

Query: 87  CQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTNPDNGA 146
            +N TY  LL D+LL Q G D  Y P N+T  EGNDDQ  WG+ VM A ER   NP    
Sbjct: 82  MENSTYNDLLTDSLLHQAGEDLSYTPWNETTTEGNDDQFFWGMAVMDAAERKNPNPPADQ 141

Query: 147 PGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRYT 206
           P  LA+ QAVFNTM  RWD E C GGLRWQIF WN GY+YKN++SN  LF +AARL RYT
Sbjct: 142 PQRLALAQAVFNTMALRWDMETCNGGLRWQIFRWNDGYHYKNSVSNGALFHMAARLTRYT 201

Query: 207 GNTTYLDVAEQVFDWLVDVGY--VVLNDTANVYDGAEIDTNCTDITKIEWTYNHGIVLGG 264
           GN TYL+ AE+V+DW+  VG   +V  +   VYDG +I+ NCT++ K++WTYNHG+++ G
Sbjct: 202 GNATYLEWAERVYDWMYGVGLISIVQPNWHVVYDGTDINDNCTNLNKLQWTYNHGLIMAG 261

Query: 265 MAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNTDQRTFKSIFSRM 324
            A++YN T     W     + L+ +A  F  +  +YE+ CQ    CN DQR+FK+ FSR 
Sbjct: 262 CAFIYNHTQ-DELWHQRTLRFLD-SARIFLSNDTLYEAGCQGGDNCNIDQRSFKAYFSRF 319

Query: 325 LGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGYYGLGEQMSA 384
           LGLT+ + P + +TI   I+ SA+ AA SC GG DGHTCGL+W     DG +GLGEQM+A
Sbjct: 320 LGLTAQLVPESRETIVRWIRASAQGAAASCSGGRDGHTCGLNWLINGWDGKWGLGEQMAA 379

Query: 385 LEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNLNITKGDRAGAAIITAV 444
           LE+IQNL   +RPAPY   NGGTS GD  AG  +   ++    L+I  GDRAGA IITA+
Sbjct: 380 LEIIQNLRCLERPAPYTAMNGGTSPGDPAAGTKTKAENLPP--LDIKAGDRAGAGIITAL 437

Query: 445 ILSVLIGGAVWMLF 458
           I S  +   +W++ 
Sbjct: 438 IGSSFLACTLWLII 451

>ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046C DCW1
           Mannosidase GPI-anchored membrane protein required for
           cell wall biosynthesis homologous to Dfg5p
          Length = 453

 Score =  432 bits (1110), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 214/444 (48%), Positives = 295/444 (66%), Gaps = 6/444 (1%)

Query: 17  LLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGEA 76
           L S+F +  A+D+D     ++ +A+AL+  G++DYY G +YG T+GMF  PYYWW AG A
Sbjct: 12  LASWFPSASALDIDLNDFKTLQNASALVAKGLMDYYTGDQYGQTIGMFSWPYYWWEAGGA 71

Query: 77  FGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAVE 136
           +  +++ W+  +NDTY   + +ALL Q+G ++DY+P NQ+ VEGNDDQ  WGI V+ A E
Sbjct: 72  WNTLIDYWFYMKNDTYNDKVTEALLYQSGDNHDYVPLNQSTVEGNDDQAFWGIAVLNAAE 131

Query: 137 RNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACLF 196
           R F NP +  P WL + QAVFNTM  RWD+  CGGGLRWQIFTWN+GY+YKNT+SN  LF
Sbjct: 132 RKFPNPPDDQPQWLYLGQAVFNTMALRWDTATCGGGLRWQIFTWNTGYDYKNTVSNGALF 191

Query: 197 QIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVL--NDTANVYDGAEIDTNCT-DITKIE 253
            IAARL  +TGN++Y+D AE+V+DW+ DV  +    +D   VYDG ++  NC+  +T+I 
Sbjct: 192 HIAARLAYFTGNSSYVDWAERVYDWMHDVKLIEPENDDNKYVYDGVDVSNNCSGPVTRIV 251

Query: 254 WTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNTD 313
           WTYNHG+VL G AY+Y  T G   W    +  L  AA  F+ D I+YE +CQ   TCN D
Sbjct: 252 WTYNHGLVLSGCAYLYKET-GDKIWYNRSKAFLETAAKLFYNDSILYEYSCQQSKTCNVD 310

Query: 314 QRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETND 373
           QR+FKS +S  L  T+ + P   + I  ++  +A AAA++C GG DGHTCG++W ++  D
Sbjct: 311 QRSFKSYYSTFLAATAQLIPDFREQIMKVVNATAYAAAQACVGGYDGHTCGINWNQKGWD 370

Query: 374 GYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNLNITKG 433
           G YGLGEQM+ALE +      ++PAPY   NGG S GD  AG  ++ T++    L+IT G
Sbjct: 371 GQYGLGEQMAALEALVVTQAMNKPAPYNSTNGGNSTGDGAAGTQTAPTNL--KPLHITAG 428

Query: 434 DRAGAAIITAVILSVLIGGAVWML 457
            RAGA IIT V+   +I   +W++
Sbjct: 429 SRAGAGIITCVVGFSIIASFLWLV 452

>KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON} 
          Length = 463

 Score =  432 bits (1110), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 215/405 (53%), Positives = 275/405 (67%), Gaps = 4/405 (0%)

Query: 11  LPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYW 70
           + +   L +      A+D+D  +  SI +AT+LI  G++DYY G +YG TVGMF  PYYW
Sbjct: 13  VSVLLALSAVVSKVAALDIDLDNLDSIRNATSLIAYGLMDYYTGEQYGKTVGMFADPYYW 72

Query: 71  WHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGIT 130
           W AG A+G M++  +   NDTY   +  A+L QTG   +YIP NQ+  EGNDDQ  WGI 
Sbjct: 73  WEAGGAWGSMLDYSWFMDNDTYDSQIMSAMLHQTGEHNNYIPLNQSTTEGNDDQAFWGIA 132

Query: 131 VMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTI 190
            M A ERNFTNP    P WL + QAVFNTM  RWD+E+CGGGLRWQIF WNSGY+YKNT+
Sbjct: 133 AMTAAERNFTNPPEDKPQWLYLAQAVFNTMALRWDTESCGGGLRWQIFNWNSGYDYKNTV 192

Query: 191 SNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDT-ANVYDGAEIDTNCTDI 249
           SN  LF +A+RL RYTGN +Y+D AE+V+DW+ DV +V+ N T   VYDG + + NC+ +
Sbjct: 193 SNGALFHMASRLARYTGNQSYVDWAEKVYDWMWDV-HVISNSTYMFVYDGVDANDNCSTV 251

Query: 250 TKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYF-FKDGIMYESACQDYG 308
           T+ +WTYNHG++L G AY+YN T G   W    ++++  A  +F    GIMYE+ACQ   
Sbjct: 252 TQYQWTYNHGLLLAGSAYLYNFT-GDEVWHNRTKKLVTAAQVFFNSTTGIMYEAACQAAL 310

Query: 309 TCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWE 368
           TCN DQR+FK+ FSR LGLT+ + P T   I   + TSA AA KSC GG DGHTCGL+W 
Sbjct: 311 TCNNDQRSFKAYFSRFLGLTAQLVPETRTQIMGWLNTSAVAAGKSCSGGYDGHTCGLNWF 370

Query: 369 KETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDAN 413
           K+  DG YGLGEQMSALE I N     +PAPY   NGG+SKG+++
Sbjct: 371 KDGWDGMYGLGEQMSALECILNTRALMKPAPYTATNGGSSKGESS 415

>SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {ON}
           similar to uniprot|Q75BN0 Ashbya gossypii ACR241C
           ACR241Cp and weakly similar to YKR064W uniprot|P36023
           Saccharomyces cerevisiae YKR064W Hypothetical ORF
          Length = 875

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/100 (21%), Positives = 40/100 (40%), Gaps = 12/100 (12%)

Query: 261 VLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNTDQRTFKSI 320
           VL G+   ++      EW+  L ++ +  AS +F           +Y  C      FK++
Sbjct: 614 VLPGLLLRFSGAPNFQEWRPVLIELFHNVASLYFN------QLATEYYQC------FKAM 661

Query: 321 FSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDG 360
           F   +   ++  PF++D    +++        S   GTD 
Sbjct: 662 FETKIVYKTLDRPFSTDPWSTILRFLVSERPASTSVGTDA 701

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,650,634
Number of extensions: 2248142
Number of successful extensions: 5317
Number of sequences better than 10.0: 57
Number of HSP's gapped: 5361
Number of HSP's successfully gapped: 57
Length of query: 458
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 345
Effective length of database: 40,524,141
Effective search space: 13980828645
Effective search space used: 13980828645
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)