Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_13.30singletonON1321326977e-96
Kwal_23.43105.46ON96850625.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_13.30
         (132 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_13.30 Chr13 (43141..43539) [399 bp, 132 aa] {ON} YCR017C (N...   273   7e-96
Kwal_23.4310 s23 complement(664281..667187) [2907 bp, 968 aa] {O...    28   5.2  

>Suva_13.30 Chr13 (43141..43539) [399 bp, 132 aa] {ON} YCR017C
           (NOVEL)
          Length = 132

 Score =  273 bits (697), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 132/132 (100%), Positives = 132/132 (100%)

Query: 1   MQMFNEFNWNRTDFFRISSTGASISKWLTSVKSGRFVNWTIVWLAPEPLSGVAEVIVLYP 60
           MQMFNEFNWNRTDFFRISSTGASISKWLTSVKSGRFVNWTIVWLAPEPLSGVAEVIVLYP
Sbjct: 1   MQMFNEFNWNRTDFFRISSTGASISKWLTSVKSGRFVNWTIVWLAPEPLSGVAEVIVLYP 60

Query: 61  SLDYTLLVHLLAHAWHCFLLFFITGQDFLQYKQRVTSPSTPAGVASVLMAAFLESPLITA 120
           SLDYTLLVHLLAHAWHCFLLFFITGQDFLQYKQRVTSPSTPAGVASVLMAAFLESPLITA
Sbjct: 61  SLDYTLLVHLLAHAWHCFLLFFITGQDFLQYKQRVTSPSTPAGVASVLMAAFLESPLITA 120

Query: 121 IFNKTTYAREPD 132
           IFNKTTYAREPD
Sbjct: 121 IFNKTTYAREPD 132

>Kwal_23.4310 s23 complement(664281..667187) [2907 bp, 968 aa] {ON}
           YMR288W (HSH155) -  [contig 1] FULL
          Length = 968

 Score = 28.5 bits (62), Expect = 5.2,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 22/50 (44%)

Query: 83  ITGQDFLQYKQRVTSPSTPAGVASVLMAAFLESPLITAIFNKTTYAREPD 132
           +T  D    K  V S S P GV +   A      L+    NKT YARE +
Sbjct: 7   VTDGDKYSRKNLVASYSIPKGVRNEFEADLQGDELMERTKNKTVYARESE 56

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.135    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,778,765
Number of extensions: 498676
Number of successful extensions: 1278
Number of sequences better than 10.0: 6
Number of HSP's gapped: 1278
Number of HSP's successfully gapped: 6
Length of query: 132
Length of database: 53,481,399
Length adjustment: 97
Effective length of query: 35
Effective length of database: 42,358,797
Effective search space: 1482557895
Effective search space used: 1482557895
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)