Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_13.298.838ON50948622580.0
Smik_13.208.838ON51048517550.0
YML114C (TAF8)8.838ON51048517360.0
Skud_13.278.838ON51448217320.0
ZYRO0G14146g8.838ON5074045302e-60
NCAS0B003108.838ON5644475236e-59
Kpol_1068.108.838ON6173525186e-58
TDEL0B005908.838ON5413744859e-54
Kwal_27.102728.838ON5514614552e-49
ABL128W8.838ON4743754406e-48
TPHA0I002308.838ON6143874232e-44
SAKL0D01518g8.838ON5744104184e-44
KLTH0C03916g8.838ON5703694167e-44
NDAI0E003008.838ON6644604153e-43
Ecym_46098.838ON5203913962e-41
KAFR0A028208.838ON4533613413e-34
TBLA0D032508.838ON6834813226e-31
KLLA0D01617g8.838ON5624162951e-27
KNAG0G034108.838ON5263832551e-22
CAGL0B02299g8.838ON6432532081e-16
CAGL0D05852g5.219ON86480706.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_13.29
         (509 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}...   874   0.0  
Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}...   680   0.0  
YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}  T...   673   0.0  
Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}...   671   0.0  
ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weak...   208   2e-60
NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}...   206   6e-59
Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {O...   204   6e-58
TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {O...   191   9e-54
Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {...   179   2e-49
ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic ho...   174   6e-48
TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838...   167   2e-44
SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {...   165   4e-44
KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {...   164   7e-44
NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}...   164   3e-43
Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar...   157   2e-41
KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.8...   135   3e-34
TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.8...   128   6e-31
KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {...   118   1e-27
KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.8...   102   1e-22
CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...    85   1e-16
CAGL0D05852g Chr4 complement(554761..557355) [2595 bp, 864 aa] {...    32   6.2  

>Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}
           YML114C (REAL)
          Length = 509

 Score =  874 bits (2258), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/486 (90%), Positives = 440/486 (90%)

Query: 1   MTSATPESGSGASQTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLNICISNFA 60
           MTSATPESGSGASQTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLNICISNFA
Sbjct: 1   MTSATPESGSGASQTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLNICISNFA 60

Query: 61  LDEMVNLVAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHI 120
           LDEMVNLVAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHI
Sbjct: 61  LDEMVNLVAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHI 120

Query: 121 KSKHSVEYEKLVKSSSFTAVSHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLEKLIPSWLP 180
           KSKHSVEYEKLVKSSSFTAVSH                    VLLPPSNPLEKLIPSWLP
Sbjct: 121 KSKHSVEYEKLVKSSSFTAVSHIEDDEEDEINNIEEQQNEINVLLPPSNPLEKLIPSWLP 180

Query: 181 NFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHTPSPRL 240
           NFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHTPSPRL
Sbjct: 181 NFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHTPSPRL 240

Query: 241 PDASDASERLEIWGNTLHERKPAIIAKSFNEKNIEQYAKYRIELARERVSKFEVNQLKRT 300
           PDASDASERLEIWGNTLHERKPAIIAKSFNEKNIEQYAKYRIELARERVSKFEVNQLKRT
Sbjct: 241 PDASDASERLEIWGNTLHERKPAIIAKSFNEKNIEQYAKYRIELARERVSKFEVNQLKRT 300

Query: 301 KNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQKLKKEKIQLAKEE 360
           KNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQKLKKEKIQLAKEE
Sbjct: 301 KNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQKLKKEKIQLAKEE 360

Query: 361 RQKSLKRRQEELISQRKKKEQDEGHDLELLLNNEQARESTDNNTNLNALNVSTXXXXXXX 420
           RQKSLKRRQEELISQRKKKEQDEGHDLELLLNNEQARESTDNNTNLNALNVST       
Sbjct: 361 RQKSLKRRQEELISQRKKKEQDEGHDLELLLNNEQARESTDNNTNLNALNVSTIDINANA 420

Query: 421 XXXXXXMNLFGILGSSEDENELSSIQVETVAGESEPPTAPARDXXXXXXXXXXXXXIDTT 480
                 MNLFGILGSSEDENELSSIQVETVAGESEPPTAPARD             IDTT
Sbjct: 421 DGDDDDMNLFGILGSSEDENELSSIQVETVAGESEPPTAPARDTTNTTPVAQNTTNIDTT 480

Query: 481 ANFSIL 486
           ANFSIL
Sbjct: 481 ANFSIL 486

>Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}
           YML114C (REAL)
          Length = 510

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/485 (70%), Positives = 382/485 (78%), Gaps = 1/485 (0%)

Query: 1   MTSATPESGSGASQTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLNICISNFA 60
           MT     S SG   T+VQL  LPDLTE+SHLEIDAPV+EILKK+VLFQLNSLNICISNFA
Sbjct: 1   MTFRMSGSESGTQHTIVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA 60

Query: 61  LDEMVNLVAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHI 120
           LDE+VNLVAVQMDGMFRNLHNL LLQRRS+ SQADLKLLFREFN+++ASL+QQ Q+SE I
Sbjct: 61  LDELVNLVAVQMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFI 120

Query: 121 KSKHSVEYEKLVKSSSFTAVSHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLEKLIPSWLP 180
           KS H+VEY KLV+ SSF A++H                    VLLPPSNPLEKLIPSWLP
Sbjct: 121 KSNHAVEYGKLVRLSSFPALAHNEEDEEDELSNIEEQQSEINVLLPPSNPLEKLIPSWLP 180

Query: 181 NFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHT-PSPR 239
           NFPPDHTYKFTPEFNHPITDLKTIK+EIVKES ESE+ALLNLNKRL  +SSASHT P P 
Sbjct: 181 NFPPDHTYKFTPEFNHPITDLKTIKKEIVKESEESEKALLNLNKRLSHLSSASHTSPPPV 240

Query: 240 LPDASDASERLEIWGNTLHERKPAIIAKSFNEKNIEQYAKYRIELARERVSKFEVNQLKR 299
           L DA    ++LEIWGN L ERKP I A S NE NIEQYAKYR+ELARERV+KFE+NQLKR
Sbjct: 241 LDDADATEQQLEIWGNALQERKPTITATSLNESNIEQYAKYRVELARERVAKFELNQLKR 300

Query: 300 TKNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQKLKKEKIQLAKE 359
           TKNPFLK+SE+LY  + PHQSHK IQ +IDLQ RKS+TLFMHNLPKVQKLKKE+I++AKE
Sbjct: 301 TKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLKKERIRMAKE 360

Query: 360 ERQKSLKRRQEELISQRKKKEQDEGHDLELLLNNEQARESTDNNTNLNALNVSTXXXXXX 419
           ER KSL+RRQEELIS+RKK+EQDEGHDLELLLNNE ARE+TDNNT  N  N ST      
Sbjct: 361 ERAKSLRRRQEELISERKKREQDEGHDLELLLNNEHAREATDNNTTPNVANNSTIIINAN 420

Query: 420 XXXXXXXMNLFGILGSSEDENELSSIQVETVAGESEPPTAPARDXXXXXXXXXXXXXIDT 479
                  MNLFGILGSSEDENE+SS+ VE +AGESEPPT   +D             +D 
Sbjct: 421 ANDEDDDMNLFGILGSSEDENEISSMPVENLAGESEPPTMIMQDTVNSTLAAHNTTNVDA 480

Query: 480 TANFS 484
           TAN S
Sbjct: 481 TANRS 485

>YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}
           TAF8TFIID subunit (65 kDa), involved in RNA polymerase
           II transcription initiation
          Length = 510

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/485 (70%), Positives = 378/485 (77%), Gaps = 1/485 (0%)

Query: 1   MTSATPESGSGASQTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLNICISNFA 60
           MTS T ESG+G   T+VQL NLPDLTE+SHLEIDAPV+EILKK+VLFQLNSLNICISNFA
Sbjct: 1   MTSKTSESGTGTQSTIVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA 60

Query: 61  LDEMVNLVAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHI 120
           LDE+VNLV VQMDGMFRNLHNL LLQRRSQ SQADLKLL REFNL++ SL+QQ Q SE I
Sbjct: 61  LDELVNLVTVQMDGMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFI 120

Query: 121 KSKHSVEYEKLVKSSSFTAVSHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLEKLIPSWLP 180
           KSKHS EYEKL+  SS  A+ H                    VLLPPSNPLEK IPSWLP
Sbjct: 121 KSKHSTEYEKLMSWSSLAALPHNEEDEEDELNNIEEQQNEINVLLPPSNPLEKQIPSWLP 180

Query: 181 NFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHTPSPRL 240
           NFPPDHTYKFTPEFNHPITDLKTIK+EIVKES ESE+ALLNLNK L  ISSAS+TP P  
Sbjct: 181 NFPPDHTYKFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPG 240

Query: 241 PDASDASER-LEIWGNTLHERKPAIIAKSFNEKNIEQYAKYRIELARERVSKFEVNQLKR 299
            D  DA E+ LEIWGN L ERKP I  KSFNE NIEQYAKYR+ELARERV+KFEVNQLKR
Sbjct: 241 LDDEDAIEQQLEIWGNALEERKPTITEKSFNENNIEQYAKYRVELARERVTKFEVNQLKR 300

Query: 300 TKNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQKLKKEKIQLAKE 359
           TKNPFLKISE+LY  ++PHQSHK IQ++I+LQ RKS+TLFMHNLPKVQKLKKEKI++AKE
Sbjct: 301 TKNPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKIRMAKE 360

Query: 360 ERQKSLKRRQEELISQRKKKEQDEGHDLELLLNNEQARESTDNNTNLNALNVSTXXXXXX 419
           ER KSLKRRQEELISQR K+EQDEGHDLELLLNNE AR++ D+ T  NALN ST      
Sbjct: 361 ERAKSLKRRQEELISQRTKREQDEGHDLELLLNNEHARDAADDTTTPNALNNSTIVINTN 420

Query: 420 XXXXXXXMNLFGILGSSEDENELSSIQVETVAGESEPPTAPARDXXXXXXXXXXXXXIDT 479
                  +NLFGILGSSEDENE+SS+  E +  ESEPPT  A+D             ID 
Sbjct: 421 AEDEDDDINLFGILGSSEDENEMSSMPAENLVAESEPPTMTAQDTTNTTPVAHNTTNIDA 480

Query: 480 TANFS 484
           T + S
Sbjct: 481 TTSHS 485

>Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}
           YML114C (REAL)
          Length = 514

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/482 (71%), Positives = 384/482 (79%), Gaps = 1/482 (0%)

Query: 1   MTSATPESGSGASQTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLNICISNFA 60
           MTS T ESG G  +T+VQL NLPDLTE+SHL+IDAPV+EIL+K+VLFQLNSL+ICISNFA
Sbjct: 1   MTSTTSESGFGTRRTLVQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSLDICISNFA 60

Query: 61  LDEMVNLVAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHI 120
           LDE+VNLVAVQMDGMFRNLHNLALLQRRS+ +QADLKLLF+EFNL+ ASL+QQLQISE I
Sbjct: 61  LDELVNLVAVQMDGMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFI 120

Query: 121 KSKHSVEYEKLVKSSSFTAVSHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLEKLIPSWLP 180
           KS HSVEYEKLV SSSF+A SH                    VLLPPSNPLEKL+PSWLP
Sbjct: 121 KSNHSVEYEKLVSSSSFSASSHNEEDEEDELNNIEEQQNEISVLLPPSNPLEKLMPSWLP 180

Query: 181 NFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHTPSPRL 240
           NFPPDHTY+FTPEFNHPITDLKTIKREIVKES ESE+ALLNLNKRL  IS ASH P PRL
Sbjct: 181 NFPPDHTYRFTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHAPPPRL 240

Query: 241 PDASDASER-LEIWGNTLHERKPAIIAKSFNEKNIEQYAKYRIELARERVSKFEVNQLKR 299
           PD +DA E+ LEIWGN L E K   I+KSFNE NIEQYAKYR+ELARERVSKFEVNQLKR
Sbjct: 241 PDDADAGEQQLEIWGNALQEEKRTAISKSFNENNIEQYAKYRVELARERVSKFEVNQLKR 300

Query: 300 TKNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQKLKKEKIQLAKE 359
           TKNPFL+ISE+LYS K+PHQ H+ IQR+IDLQ RKS+ LF HNLPKVQKLKKEKI++A E
Sbjct: 301 TKNPFLRISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKEKIRMAIE 360

Query: 360 ERQKSLKRRQEELISQRKKKEQDEGHDLELLLNNEQARESTDNNTNLNALNVSTXXXXXX 419
           ER +SLKRRQEELI +RKK+EQDEGHDLELLL+NE AREST+NNTN NA +  T      
Sbjct: 361 ERSRSLKRRQEELILERKKREQDEGHDLELLLHNEHARESTENNTNPNAPSSFTIDINAN 420

Query: 420 XXXXXXXMNLFGILGSSEDENELSSIQVETVAGESEPPTAPARDXXXXXXXXXXXXXIDT 479
                  MNLFGILGSS DENE  SIQ   VAGE EPPTA  +D             ID 
Sbjct: 421 ADDEDDDMNLFGILGSSGDENEAPSIQNGNVAGEPEPPTATVQDNANTTSMTHNTTNIDA 480

Query: 480 TA 481
           TA
Sbjct: 481 TA 482

>ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weakly
           similar to uniprot|Q03750 Saccharomyces cerevisiae
           YML114C TAF8 TFIID subunit (65 kDa) involved in RNA
           polymerase II transcription initiation
          Length = 507

 Score =  208 bits (530), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 138/404 (34%), Positives = 227/404 (56%), Gaps = 31/404 (7%)

Query: 17  VQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLNICISNFALDEMVNLVAVQMDGMF 76
           +Q+T LP L E+ H + +  V+++L KSV  QL  +N  I+ FA D ++ LV  Q++ M 
Sbjct: 5   IQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNAQITQFAFDRLLQLVDGQLNDMI 64

Query: 77  RNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKHSVEYEKLVKSSS 136
             LH ++ LQRR  +++ D+ +L   FN++ +S+  Q +ISE    K+  E+  L     
Sbjct: 65  SQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHSLRD 124

Query: 137 F-TAVSHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLEKLIPSWLPNFPPDHTYKFTPEFN 195
             ++++H                    VL+PP+NPL+  +P WLP+FPPDHTYKFTP+++
Sbjct: 125 LQSSLAHEMVPFEDQEAVRQNVST---VLVPPTNPLQDFLPKWLPDFPPDHTYKFTPQYS 181

Query: 196 HPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHTPSPRLPDASDAS------ER 249
           HPITD  TI+R+IV+E+ +SE AL +L+++          P+  + + S         E 
Sbjct: 182 HPITDETTIRRQIVEEAKQSELALSHLSQK--------KNPTDDIVNRSQYDSELAEQET 233

Query: 250 LEIWGNTLHERK-------PAIIAKSFNEKN--IEQYAKYRIELARERVSKFEVNQLKRT 300
           L I+G+ L +RK        A +     + N  +E+YA  RIE+AR++V +FE  QL+  
Sbjct: 234 LAIYGSQLKKRKTQHPQANSADLLSKLPQTNFSVEEYAHNRIEVARKKVLEFEERQLQSQ 293

Query: 301 KNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQKLKKEKIQLAKEE 360
           ++PFLK+S   ++  N   + K + R   L L++S    + ++P++++ K E  + AKEE
Sbjct: 294 QDPFLKLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPELERNKLETEEKAKEE 353

Query: 361 RQKSLKRRQEELISQRKKKEQDEGHDLELLLNNEQ---ARESTD 401
           R K L+  + +   Q KK E+D   DL+ L  N++   A ES+D
Sbjct: 354 RSKRLQELRAQREEQEKKGERD-VLDLDELDQNQEDFFAMESSD 396

>NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}
           Anc_8.838 YML114C
          Length = 564

 Score =  206 bits (523), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 145/447 (32%), Positives = 234/447 (52%), Gaps = 34/447 (7%)

Query: 16  MVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLNICISNFALDEMVNLVAVQMDGM 75
           M +LTN    TE+     D  V ++L KS+  QL  LN+ +S  A +E+  LV  Q+D +
Sbjct: 30  MNELTNP---TEIPSNSSDEQVRKLLNKSIALQLKPLNLELSQLAFNELSLLVNDQLDFL 86

Query: 76  FRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKHSVEYEKLVKSS 135
              LH ++++QRR+  ++ D++LL R  NLN + L  QLQ+S  +KSK+  +Y+ L+K S
Sbjct: 87  ISELHRMSVIQRRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDS 146

Query: 136 SFTAVSHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLEKLIPSWLPNFPPDHTYKFTPEFN 195
           S    S                     +L+ P+NP E  IP+WLP FPPDHTYKFTP+FN
Sbjct: 147 STIFDS---SDTMANPGHDSMVNNPSNILIKPNNPFEISIPNWLPAFPPDHTYKFTPQFN 203

Query: 196 HPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHTPSPRLPDASDASERLEIWGN 255
            PITD   IK+++++E  +SE++LLNL   +   SS  +  +          E + I+G 
Sbjct: 204 KPITDQVLIKQKLIEEGKKSEKSLLNLLNDITEQSSIENEETSNFDSELAREENIAIYGY 263

Query: 256 TLHERK----PAIIAKSFNEK------------NIEQYAKYRIELARERVSKFEVNQLKR 299
               RK    P +I+    E+            N+  YA +R+EL R+RV +FE+ QLK 
Sbjct: 264 DAMSRKKRKPPHLISIHDTEQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLKW 323

Query: 300 TKNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQKLKKEKIQLAKE 359
            KNPFL++S  +   K    S   ++  I   L++S      N PK+++ +  +++LA++
Sbjct: 324 EKNPFLRLSRMINDKK---VSRSDLKLEIKNSLQRSYKSIFRNYPKLKQERDRRLELARQ 380

Query: 360 ERQKSLKRRQEELISQRKKKEQDEGHDLELLLNNEQARESTDNNTNLNA-----LNVSTX 414
           +R++ +    E+L  Q ++ ++D    L   L+ E + E+T   +NL       LN  + 
Sbjct: 381 KREEKI----EKLKIQNEQLKKDRDAQLLAALSMETSGENTKTESNLTGVNDQKLNEFST 436

Query: 415 XXXXXXXXXXXXMNLFGILGSSEDENE 441
                       + LFG L SS+++N+
Sbjct: 437 IATNIEDVEDDGIGLFGDLESSDEDND 463

>Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {ON}
           complement(18964..20817) [1854 nt, 618 aa]
          Length = 617

 Score =  204 bits (518), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 128/352 (36%), Positives = 198/352 (56%), Gaps = 21/352 (5%)

Query: 10  SGASQTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLNI--CISNFALDEMVNL 67
           +G +   +QLT LP LTE  + E +  + +IL K+V  QL S+N    I+ FA + +++L
Sbjct: 2   TGEATKYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSL 61

Query: 68  VAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKHSVE 127
           V  Q+D M   LH L+ LQRR+ V++AD+ +  R FNL    L +Q Q S+++   +  +
Sbjct: 62  VVGQIDDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKD 121

Query: 128 YEKLVKSSSFTAVSHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLEKLIPSWLPNFPPDHT 187
           YE L K ++ T  +                      L+P SNPL+KLIPSWLP+FPPD+T
Sbjct: 122 YESLTKIATTTTRTLSTYQKLDLTHKDTSTAQTSK-LVPISNPLQKLIPSWLPDFPPDYT 180

Query: 188 YKFTPEFNHPITDLKTIKREIVKESGESERALLNL--NKRLFRISSASHTPSPRLPDASD 245
           YKFTP++N PITD   I+R++V+E  +SE+ALLNL    +  RIS      S  +  A++
Sbjct: 181 YKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISRDLKFSSSEMELATE 240

Query: 246 ASERLEIWG---------NTLHERKPAIIAKSFNEKNIEQYAKYRIELARERVSKFEVNQ 296
             E L  +           +  E++P  I  S    N+E+YA+ R+E+ R++V  +E  Q
Sbjct: 241 --ETLATYSAITLRNKHLTSFFEKEP--IQNSL---NVEEYARTRVEIERKKVLGYEERQ 293

Query: 297 LKRTKNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQK 348
           L+  +NPFLKIS  + +  +   S  V    I   L++S+  F+H++PK Q+
Sbjct: 294 LQIQRNPFLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQQ 345

>TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {ON}
           Anc_8.838 YML114C
          Length = 541

 Score =  191 bits (485), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 122/374 (32%), Positives = 198/374 (52%), Gaps = 26/374 (6%)

Query: 17  VQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLNICISNFALDEMVNLVAVQMDGMF 76
           +QLT+LP L E+ H + +A V++IL K+V  QL  +   IS FA + ++ L+  Q++ M 
Sbjct: 10  IQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKADISKFAFEHLMILIDDQLNDMI 69

Query: 77  RNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKHSVEYEKL--VKS 134
             LH  + +QRR  +++ D+ L  + +NL  A L +Q Q S++    +  E++ L  +K 
Sbjct: 70  GQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSLHSLKE 129

Query: 135 SSFTAVSHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLEKLIPSWLPNFPPDHTYKFTPEF 194
           +   AV                       L+ P+NPL + IP W+P FPPDHTYKFTP++
Sbjct: 130 TFTDAVVDEDNGSEDVINE----------LVRPNNPLIRYIPKWMPAFPPDHTYKFTPQY 179

Query: 195 NHPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHTPSPRLPDASDASERLEIWG 254
           N PITD   I+R IV E  +SE ALL+L K +   + +S        +A    E   I+G
Sbjct: 180 NQPITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTPSSDADGASYDEALVREETAAIYG 239

Query: 255 NTLHERKPAIIAKSFNEK-------NIEQYAKYRIELARERVSKFEVNQLKRTKNPFLKI 307
           N   +RK    + S           +IE+YA+ R+E+AR++V ++E  Q+K  +NPF+K 
Sbjct: 240 NEQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVVEYEERQMKLQRNPFIKY 299

Query: 308 SESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQKLKKEKIQLAKEERQKSLKR 367
           S+   S  +     +   R I   L++S+   + ++P++Q  K++        R+K+ ++
Sbjct: 300 SKIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTKQDA-------RRKAEQK 352

Query: 368 RQEELISQRKKKEQ 381
           R E L   R KK Q
Sbjct: 353 RDERLQELRDKKAQ 366

>Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {ON}
           YML114C (TAF8) - TAF65, subunit of transcription factor
           TFIID [contig 37] FULL
          Length = 551

 Score =  179 bits (455), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 135/461 (29%), Positives = 234/461 (50%), Gaps = 59/461 (12%)

Query: 1   MTSATPESGSGAS--QTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLNI--CI 56
           MT   P++ + +   Q +VQL NLP L E+   ++D P+ ++L+K++  QL S+N    I
Sbjct: 1   MTKPAPDAQTVSPDLQRVVQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASI 60

Query: 57  SNFALDEMVNLVAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQI 116
           S  A + ++ LV   +  M  +LH +A +QRR  +S+ DL L+   +NL+S+ L  +L+ 
Sbjct: 61  SQLAFENLIILVEEMLSNMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELER 120

Query: 117 SEHIKSKHSVEYEKLVKSSSFTAVSHXXXXXXXXXXXXX-----XXXXXXXVLLPPSNPL 171
           S +++S+H  + +K+ + S +                               L+PPS   
Sbjct: 121 SRYVRSRHLEQIKKVEEDSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKD 180

Query: 172 EKLIPSWLPNFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESERALLNLNKRLFRISS 231
            K +P WLP+FPPDHTY+FT ++N PITD + +KR++ +E+  SE+AL++L+  +     
Sbjct: 181 TKHVPRWLPDFPPDHTYRFTAQYNKPITDERLMKRKLAEEANLSEKALIHLS--MLSHEE 238

Query: 232 ASHTPSPRLPDASDASERLEIWGNTLHERKPAII------AKSFNEKN--IEQYAKYRIE 283
           AS  P        +A +  ++    + ++K A I       ++  ++N  +E+YA+ R+E
Sbjct: 239 ASSGPIDSDTIYEEAQQETQLLFGPVKKKKTAAINEVNDLLRTLPQQNFSVEEYARNRVE 298

Query: 284 LARERVSKFEVNQLKRTKNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNL 343
           +AR RV+++E +QL+  K  F+K +  L  F     S K +++ I   L +S    + + 
Sbjct: 299 IARRRVNEYERHQLQLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSA 358

Query: 344 PKVQKLKKEKIQLAKEERQKSLKRRQEELISQRKKKEQDEGHDLELLLNNEQARESTDNN 403
           P +++ +K +I LA+E R    + R E+L   RK++E               AR  + N 
Sbjct: 359 PSLKERRKREIALAEENR----RLRDEKL---RKERE---------------ARSKSSNE 396

Query: 404 ---TNLNALNVSTXXXXXXXXXXXXXMNLFGILGSSEDENE 441
               +LN LN                   FG LGSS+ E+E
Sbjct: 397 FDVLDLNNLNEDP---------------FFGGLGSSDSEDE 422

>ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML114C (TAF65)
          Length = 474

 Score =  174 bits (440), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 117/375 (31%), Positives = 193/375 (51%), Gaps = 33/375 (8%)

Query: 10  SGASQTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSL--NICISNFALDEMVNL 67
           +GA +  +QL  LPDLTEV+      P+ ++L ++V   L ++  ++ I+    + +V  
Sbjct: 13  AGAKEG-IQLKKLPDLTEVTK---SNPMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQF 68

Query: 68  VAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKHSVE 127
           V +Q+D M + LH  A +QRR++VS  D++L      +   SL+++   S++++ +H+  
Sbjct: 69  VELQLDDMLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGA 128

Query: 128 YEKLV-KSSSFTAVSHXXXXXXXXXXXXXXXXXXXXV----LLPPSNPLEKLIPSWLPNF 182
              +  +S+S     H                    V    L+PP+N     +P WLP F
Sbjct: 129 VRSIEEQSASLMGHWHQPMSEEELLSSSHAEFFFKDVDILNLVPPTNNNNHYVPKWLPEF 188

Query: 183 PPDHTYKFTPEFNHPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHTPSPRLPD 242
           PPDHTYKFT  +N PITD + +KR++ +ES  SE+ALL++          + T  PR  D
Sbjct: 189 PPDHTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHM--------LGTATKKPRADD 240

Query: 243 A------SDA-SERLEIWGNTLHERKP-AIIAKSFNEKNIEQYAKYRIELARERVSKFEV 294
           A      SD   E L I+G       P     + F   NIE YA+ R+ELAR RV +FE 
Sbjct: 241 AQLPQIISDGQQENLLIYGPERRRLAPEPAPTRGF---NIEDYARCRVELARRRVEEFEQ 297

Query: 295 NQLKRTKNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQKLKKEKI 354
            +L+  KNPF++ + +   +     S K I+R   + L +S    +H +P++++ K  ++
Sbjct: 298 QKLQVQKNPFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTKAREL 357

Query: 355 QLAKEE---RQKSLK 366
             A E    RQ+S++
Sbjct: 358 AAAYERERARQESMR 372

>TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838
           YML114C
          Length = 614

 Score =  167 bits (423), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 122/387 (31%), Positives = 197/387 (50%), Gaps = 35/387 (9%)

Query: 17  VQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLN--ICISNFALDEMVNLVAVQMDG 74
           VQLT LP LTE  + +   P+  IL K++  QL  +N    I+ FA   + +LV  Q+  
Sbjct: 46  VQLTKLPTLTEFKYEDTKGPMEVILAKAIALQLKLMNRDTTITKFAFTHLTSLVDEQLSD 105

Query: 75  MFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKHSVEYEKLVKS 134
           M   +  LA LQRR +V++ D+ L  R FNL  + L    Q SE+IK K+  E   L + 
Sbjct: 106 MVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTLLNRL 165

Query: 135 SSFTAVSHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLEKLIPSWLPNFPPDHTYKFTPEF 194
           ++ T                         L+P +N LE +IP WLP+FPPD+TYKFTP+F
Sbjct: 166 ATDTN-EVLTVFKKTDKTLKDDSTLETLKLVPITNTLENIIPDWLPSFPPDYTYKFTPQF 224

Query: 195 NHPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHTPSPRLP----DASDA-SER 249
           N  ITD   I++++  E  +SE+ALL+L      + S   T S  L     D+ D  + +
Sbjct: 225 NKHITDATVIRKKVAAEGKKSEKALLHL------LESEKITTSKLLNLDKFDSDDMDTAK 278

Query: 250 LEI-----WGNTLHERKPAIIAK------------SFNEKNIEQYAKYRIELARERVSKF 292
           LE+      G+   +++ A                + N+ +IE+Y   RI + R +V ++
Sbjct: 279 LEMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRNKVKQY 338

Query: 293 EVNQLKRTKNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQKLKKE 352
           E  QL+   +PFLK++  L    +   S +VI  +I+  L++S    ++++P + + KK+
Sbjct: 339 EDKQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIPTLNQNKKD 398

Query: 353 KIQLAKEERQKSLKRRQEELISQRKKK 379
             + A  E+    KRR +E + +R++K
Sbjct: 399 TRERAMVEK----KRRHDEWLKRREEK 421

>SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 574

 Score =  165 bits (418), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 118/410 (28%), Positives = 210/410 (51%), Gaps = 28/410 (6%)

Query: 4   ATPESGSGASQTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLN--ICISNFAL 61
           A+ +     S+  ++L  LP L    H  ++ P+ +IL ++V  +L  +N  + +S FA 
Sbjct: 6   ASHKDAPAPSRKQIRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAF 65

Query: 62  DEMVNLVAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIK 121
           + +V LV+  +  M   LH    +QRR ++S+ DL LL + ++L+++ L ++L+ S++I 
Sbjct: 66  ENLVQLVSENLSFMLTTLHRFVDIQRRREISKKDLLLLLKGYDLSNSELMRELESSQYIV 125

Query: 122 SKHSVEYEKLVKSSS-----FTAVSHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLEKLIP 176
           S H  +  K+ + S                                 L+PP+N   + IP
Sbjct: 126 SNHPEKVNKIAQKSKELKSKLLKPMTEKELLNSAHSEFFFKDMDILDLVPPTNKNNQYIP 185

Query: 177 SWLPNFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESERALLNL-------------N 223
            WLP FPPDHTY+FT ++N P+ D + ++R++V+E  +SERAL+NL             N
Sbjct: 186 KWLPEFPPDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHDSTNQDLGNN 245

Query: 224 KRLFRISSASHTPSPRLPDASDASERLEIWGNTLHERKPAIIAKSFNEKNIEQYAKYRIE 283
           +R+ + S    T            ++     N+ HE    +  K+F   ++E+YA+ R+E
Sbjct: 246 ERVEKRSLYEETQEETFLIFGPERKKSHTTENS-HELLRTLPLKNF---SVEEYARNRVE 301

Query: 284 LARERVSKFEVNQLKRTKNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNL 343
           +AR +V ++E  QL+  KNPF+K +      K    S K I + +   L++S    + ++
Sbjct: 302 IARRKVLEYEQYQLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSV 361

Query: 344 PKVQKLKKEKIQLAKEERQKSLKRRQEELISQRKKKEQDEGHDLELLLNN 393
           PK+ ++K  + +LA E R++ L++  EE    R+++ +  G D  L LNN
Sbjct: 362 PKLNEVKARERELANERRREMLEKLNEE----RQRQAEAGGGDEVLDLNN 407

>KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 570

 Score =  164 bits (416), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 111/369 (30%), Positives = 195/369 (52%), Gaps = 34/369 (9%)

Query: 17  VQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLN--ICISNFALDEMVNLVAVQMDG 74
           VQL +LP+L E+    +D P+ ++L+K+V  QL ++N  + IS FA + ++ LV   +  
Sbjct: 19  VQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSN 78

Query: 75  MFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKHSVEYEKLVKS 134
           M  +LH +  +QRR  +S+ DL L+   +NL  A L  +L+ S++++S H++E  + V+ 
Sbjct: 79  MLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRS-HNLERVRKVRE 137

Query: 135 SSFTAVSHXXXXXXXXXXXXXX------XXXXXXVLLPPSNPLEKLIPSWLPNFPPDHTY 188
            S    +                            L+PP+    K +P WLP FPPDHTY
Sbjct: 138 ESEVVEAKEKTPLSEKELLESKHLEFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHTY 197

Query: 189 KFTPEFNHPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHTPSPRLPDASDASE 248
           +FT +FN PITD + +KR++ +E+  SE+AL++L+K        SH  SP   + +D+ E
Sbjct: 198 RFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSK-------LSHEESPS--EGADSDE 248

Query: 249 RLE--------IWGNTLHERKPAIIAKSF-------NEKNIEQYAKYRIELARERVSKFE 293
             +        I+G     +  AI   S           N+E+YA+ R+E+AR +V ++E
Sbjct: 249 IFKESQQDTQLIFGPAKKTKIAAINGASDLLRTLPQQNYNVEEYARNRVEIARRKVEEYE 308

Query: 294 VNQLKRTKNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQKLKKEK 353
            +QL   K  F+K +  L  F    ++ K +++ +   L +S    + + P +++ +K +
Sbjct: 309 RHQLLLQKGAFIKAAHLLSPFAK-KRNCKQVEKEVRTLLHRSYIGLLKSAPLLREQRKRE 367

Query: 354 IQLAKEERQ 362
           ++LA+E R+
Sbjct: 368 VELAEENRR 376

>NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}
           Anc_8.838 YML114C
          Length = 664

 Score =  164 bits (415), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 136/460 (29%), Positives = 225/460 (48%), Gaps = 108/460 (23%)

Query: 27  EVSHLEIDAPVLEILKKSVLFQLNSLNICISNFALDEMVNLVAVQMDGMFRNLHNLALLQ 86
           E++H  +D  + ++L+KS+  QL +  +  S  A +++  LV  Q++ +   LH L+LLQ
Sbjct: 20  EIAHNHMDMQIEKLLQKSIAIQLKAFKVDFSKLAFNQLTLLVDDQLNSLITELHRLSLLQ 79

Query: 87  RRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKHSV-EY-------EKLVKSSSF- 137
           RR+ +++ DL+L  R FN+N + L  Q + S++I+ K S  EY       E++VK  +  
Sbjct: 80  RRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRTHI 139

Query: 138 --TAVSHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLEKL-IPSWLPNFPPDHTYKFTPEF 194
             ++ S                     +L+ P+NP + + I SWLP+FPPDHTYKFTP+F
Sbjct: 140 MESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFTPQF 199

Query: 195 NHPITDLKTIKREIVKESGESERALLNL------NKRLFRISSASHTPSPRLPDA----- 243
           N+PITD K IK+++V+E  +SE+ALLN        K+   I+  +  PSP L +      
Sbjct: 200 NNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEGPITD 259

Query: 244 SDASER-----------------------------LEIWGNTLH----ER----KPAIIA 266
           +D  E+                             L I+G        ER    KP II+
Sbjct: 260 TDEEEKQAKNEKEKEQEDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSSSKPNIIS 319

Query: 267 ------------KSFNEK-NIEQYAKYRIELARERVSKFEVNQLKRTKNPFLKISESLYS 313
                        S ++K ++ +Y+ +R+EL R++V  FE  +L+  KNPFLK+S+ +  
Sbjct: 320 IHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSKLVCL 379

Query: 314 FK-----------------------------NPHQSHKVIQRSIDLQLRKSVTLFMHNLP 344
            K                             +P +    I   I   L++S    ++N P
Sbjct: 380 EKEDYYDYDNDEDDLEERKNYNNNNDNDNRLSPIRKRAQINNEIISNLKRSFYSILNNYP 439

Query: 345 KVQKLKKEKIQLA---KEERQKSLKRRQEELISQRKKKEQ 381
           K++K KK++++LA   +++R + L++ QEE   +RK KEQ
Sbjct: 440 KLKKAKKQRVKLAIEKRDQRLQELRKIQEE---ERKVKEQ 476

>Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar to
           Ashbya gossypii ABL128W
          Length = 520

 Score =  157 bits (396), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 106/391 (27%), Positives = 194/391 (49%), Gaps = 29/391 (7%)

Query: 7   ESGSGASQTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSL--NICISNFALDEM 64
           +  +  ++  +QL  LP L EV+      P+  +L +SV  QL ++  +  I+    + M
Sbjct: 9   DGSTEGAKEFIQLKKLPGLQEVAK---HNPMQILLSQSVALQLKTMKSDFSITELGFNNM 65

Query: 65  VNLVAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKH 124
           +  + +QM+ MF+ LH  A +QRR+++S  DLKL  +   +   SL+ + + S +IK  +
Sbjct: 66  MQFIEMQMNDMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKTY 125

Query: 125 SVEYEKLVKSS-----SFTAVSHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLEKLIPSWL 179
             E++ + + S      +                          L+PP+N     +P+WL
Sbjct: 126 EAEFKNIERQSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSYVPTWL 185

Query: 180 PNFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESERALLNL----NKRLFRISSASHT 235
           P FPPDHTYKFT  +N PI+D + +KR + +E   SE+ALLN+      ++ ++     T
Sbjct: 186 PEFPPDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQAKMLKVED-EET 244

Query: 236 PSPRLPDASDAS-------------ERLEIWGNTLHERKPAIIAKSFNEKNIEQYAKYRI 282
            +    ++ + +             E   + GN+ +     + +      NI++YA+ RI
Sbjct: 245 IAQTYKESQEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYARSRI 304

Query: 283 ELARERVSKFEVNQLKRTKNPFLKISESLYSFKNPHQ-SHKVIQRSIDLQLRKSVTLFMH 341
            LAR +V +FE ++L+  KNPF++ S     + N  + + K  +R  ++ LR+S    + 
Sbjct: 305 GLARRKVEEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILLRRSYVGVLK 364

Query: 342 NLPKVQKLKKEKIQLAKEERQKSLKRRQEEL 372
           ++PK+++LK  ++  A E  +   K R+ EL
Sbjct: 365 SIPKLRQLKANEMAAAIERERIKQKEREMEL 395

>KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.838
           YML114C
          Length = 453

 Score =  135 bits (341), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 115/361 (31%), Positives = 182/361 (50%), Gaps = 42/361 (11%)

Query: 40  ILKKSVLFQLNSLNIC--ISNFALDEMVNLVAVQMDGMFRNLHNLALLQRR-SQVSQADL 96
           +L KSV  +L  +N+   + N A D ++ L+ VQ++ + + L  L+LLQRR S  +++D+
Sbjct: 29  LLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNATKSDI 88

Query: 97  KLLFREFNLNSASLFQQLQISEHIKSKHSVEYEKLVKSSSFTAVSHXXXXXXXXXXXXXX 156
            LL + FNL+ + L  +L+IS HIK  +S E EK +   S     H              
Sbjct: 89  LLLLKGFNLSESELNTELEISNHIKRLYS-EDEKKLSEDSIHYNQHTDFVGPVETSSFQ- 146

Query: 157 XXXXXXVLLPPSNPLEKLIPSWLPNFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESE 216
                  LL P+NPL+  IPSW P+ PPDHTYKFTP++N+ I D K IK++   ES   +
Sbjct: 147 -------LLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFDESKTVK 199

Query: 217 RALLNLNKRLFRISSASHTPSPRLPDASDASERLEIWGNTLHERKPA--IIAKSFN---- 270
            AL NL   + +I S          +     E   ++G T+ E+      + KS N    
Sbjct: 200 TALFNL---INKIESNEERNDLHYDETLAKLESQALFG-TVEEKMNTNKKVYKSLNSIIV 255

Query: 271 ---EKNIEQYAKYRIELARERVSKFEVNQLKRTKNPFLKISESLYSFKNPHQSHKVIQRS 327
              + +IE+Y+  R+ +AR +VSKFE   L    NPF+ +                 Q  
Sbjct: 256 PITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINLIND--------------QTD 301

Query: 328 IDLQLRKSVTLFMHNLPKVQKLKKEKIQLAKEERQKSLKRRQEELISQRKKKEQDE-GHD 386
           +   L +S  L ++++P++   KK+ I+ A+ ER + + R +E+   Q K K+ D   HD
Sbjct: 302 VKSYLNRSFQLMINSIPELTLEKKKAIRQAEIERDERINRLRED--HQTKLKQIDTISHD 359

Query: 387 L 387
           +
Sbjct: 360 I 360

>TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.838
           YML114C
          Length = 683

 Score =  128 bits (322), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 128/481 (26%), Positives = 200/481 (41%), Gaps = 121/481 (25%)

Query: 19  LTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLN--ICISNFALDEMVNLVAVQMDGMF 76
           L NLPDL +  +    + + ++L KS+  QL  +N    IS  A + ++ LV +Q++ M 
Sbjct: 42  LKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMI 101

Query: 77  RNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKHSVEYEKLVK--S 134
             L  L++ QRR  ++  DL L  R FNLN + L   L+ S  IKSK + +Y  L +   
Sbjct: 102 YQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLR 161

Query: 135 SSFTAVSHXXXXXXXXXXXXXXXXXXXXV---LLPPSNPLEKLIPSWLPNFPPDHTYKFT 191
              T  +H                        ++PPSN + + +P WLP+ PPDHTYKFT
Sbjct: 162 DYNTETNHNFKNPNYSTSDLLNNKSSESSSSRIVPPSNTILRSMPEWLPSLPPDHTYKFT 221

Query: 192 PEFNHPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHT---PSPRLPDASD--- 245
           P +N PITD   +K+ +V E   +E AL+    +L   S+ S     P+P     +D   
Sbjct: 222 PLYNEPITDETVMKKILVNEGKLAESALI----KLLEASTTSEINSLPTPETDRENDLEQ 277

Query: 246 -------------------------ASERLE-----------IWGNTLHERKPAIIAKSF 269
                                     +ERL            I+G+ L  RK   I K F
Sbjct: 278 NINIDTNTNGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSALQVRK---IKKRF 334

Query: 270 -------------------NEKNIEQYAKYRIELARERVSKFEVNQLKRTKNPFLKISES 310
                              +  N+E+YA+ +++  RE+V  +E  QL+  KNPF K S+ 
Sbjct: 335 ELMIDPKAETQLSEEFVYPSTFNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKM 394

Query: 311 LYSFKNPHQ---------------------------------------SHKVIQRSIDLQ 331
           +     P Q                                       S K I   I   
Sbjct: 395 IVG---PSQFHHGPHHHHHHHHHHHRRYSNSSTSSVSSSPSPGLFGGVSKKQINHDIQQM 451

Query: 332 LRKSVTLFMHNLPKVQKLKKEKIQLAKEERQKS----LKRRQEELISQRKKKEQDEGHDL 387
             +S+   +++LP + K K    ++A+ ER+K     LK++Q+EL  ++      + HDL
Sbjct: 452 FNRSLNNLINSLPNLAKEKASAREIAENEREKKVQEMLKKKQKELNEKQSSAGALDLHDL 511

Query: 388 E 388
           +
Sbjct: 512 Q 512

>KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 562

 Score =  118 bits (295), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 113/416 (27%), Positives = 193/416 (46%), Gaps = 59/416 (14%)

Query: 14  QTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLN--ICISNFALDEMVNLVAVQ 71
           Q  V+L  LP+L EV H     P+  +  ++VL QL +LN  + IS  A D++  +  +Q
Sbjct: 18  QRRVRLDKLPNLNEVPHAN---PMERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVSLLQ 74

Query: 72  MDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKHSVEYEKL 131
           +D + ++L  +  +QRR+++S+ DL L F+   ++   L  Q++IS  +  K   E   L
Sbjct: 75  LDDLLQSLKKITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANAL 134

Query: 132 VKS-----SSFTAVSHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLEKLIPSWLPNFPPDH 186
            ++       F                          LLP SN   K +PSWLP  PPDH
Sbjct: 135 NETVLKVKQQFMKELEEKELLSSKHSEFFVQDVDILNLLPSSNKSNKYVPSWLPELPPDH 194

Query: 187 TYKFTPEFNHPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHTPSPRLPDASDA 246
           TYKFT  +  PITD + +K+++++E   SE+ALLN+  ++      +  P   L   SD 
Sbjct: 195 TYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQV-----VNQDPLVALNKDSDQ 249

Query: 247 S------------ERLEI---------------WGNT--LHERKPAIIAKSFNEK----- 272
           S             +LE                WG T  LH        +SFN       
Sbjct: 250 SANNAALSEHIKESQLETDLIFDPHKTIPTDKEWGTTTVLHG------IESFNLSPVKNF 303

Query: 273 NIEQYAKYRIELARERVSKFEVNQLKRTKNPFLKISESLYSF-KNPHQSHKVIQRSIDLQ 331
           N+ +Y K R  + + R  + E     + +NPF++ +     + +   +S K ++  +   
Sbjct: 304 NVLEYCKKRDAIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVENQLKTM 363

Query: 332 LRKSVTLFMHNLPKVQKLKKEKIQLAKEERQKSLKRRQEELISQRKKKEQDEGHDL 387
           LR+S    + ++P+V+++ +E+ +   EER++ L+ ++   I + KK  + E  DL
Sbjct: 364 LRRSYLGLIDSIPRVKEV-RERARKEAEERERLLQEQRR--IEKEKKMAEQEILDL 416

>KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.838
           YML114C
          Length = 526

 Score =  102 bits (255), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 108/383 (28%), Positives = 164/383 (42%), Gaps = 47/383 (12%)

Query: 10  SGASQTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLNICISNFA--------L 61
           SG    +V   + P   E+ H   DA V ++L  SV FQ+++                  
Sbjct: 10  SGVKGALVGDVSAP--VELPHEPWDARVDQMLANSVAFQMSAGLARGGGGGGVGMAGQAF 67

Query: 62  DEMVNLVAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIK 121
             ++ LV  Q+ GM   LH +A +QRR   +  D+ LL + F L    + +Q+ +S+ I 
Sbjct: 68  QLLLQLVEEQLSGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQMYLSKKIG 127

Query: 122 -SKHSVEYEKLVKSSSFTAVSHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLEKLIPSWLP 180
            ++  V  E+ V+    T                          +    P+ + IP+WLP
Sbjct: 128 YNRMQVPREQTVQLQDATGSYDRFKLVENQQLIASGLSGSD---MSQELPIAEKIPAWLP 184

Query: 181 NFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESERALLNLNKRLFRISS------ASH 234
             PP+HTYKFT E+N  + D K +K +I+KES E E +L NL +   R +       A  
Sbjct: 185 KLPPNHTYKFTTEYNKLLNDEKVLKEKIIKESMEIEVSLSNLVRNCDRDADTKVDERARE 244

Query: 235 TPSPRLPDASDA-----------SERLEIWGNTLHERKPAIIAKSFNEKNIEQYAKYRIE 283
           TP   L    D            +ER E  G     R P  + KSF   +++ Y+  R++
Sbjct: 245 TPPEELKRIDDEIVALYGPLEEIAERHE--GPRTKRRTPLYLKKSF---DVQAYSLGRVK 299

Query: 284 LARERVSKFEVNQLKRTKNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVT-LFMHN 342
           LAR  V +FE     R +NPFL    ++     P  S KV        L  S+  L   +
Sbjct: 300 LARNAVQRFEWETKYRPRNPFLCSHRAV-----PENSKKVYS-----MLENSLNELVQVD 349

Query: 343 LPKVQKLKKEKIQLAKEERQKSL 365
           LP+++  K   I  A E+R   L
Sbjct: 350 LPRLESRKAAAIAHAVEQRDAKL 372

>CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some
           similarities with uniprot|Q03750 Saccharomyces
           cerevisiae YML114c TAF65 TBP Associated Factor
          Length = 643

 Score = 84.7 bits (208), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 121/253 (47%), Gaps = 26/253 (10%)

Query: 6   PESGSGASQTMVQLTNLPDLTEV-SHLEIDAPVLEILKKSVLFQLNSLN--ICISNFALD 62
           P   S   +  VQ     D+ E+ S   +D  + E+LK++V  QL +++  + ++  A+D
Sbjct: 2   PAIESSVVRGGVQENRDVDIKEINSSNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAMD 61

Query: 63  EMVNLVAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQ----ISE 118
           ++V     Q++ +   LH ++LLQRR  ++ +DL++  R +NL  + L+   +    I E
Sbjct: 62  QLVLFAEDQLNALVDGLHRISLLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIRE 121

Query: 119 HIKSKHSVEYEKLVKSSSFTA------VSHXXXXXXXXXXXXXXXXXXXXVLLPPSNPLE 172
           + ++  SV ++ +   +   +      + +                    ++    + +E
Sbjct: 122 NYRNDTSVVFKDINIDNPMESALGRINIQNKENIEPTDNDVDIDEDDDYELIELQQHAME 181

Query: 173 KLI-------------PSWLPNFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESERAL 219
           +L              P WLP+FPPDHTYK+TP + + +     I++++V+E   SE+AL
Sbjct: 182 QLFKTDTGRGRNLRYKPGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKAL 241

Query: 220 LNLNKRLFRISSA 232
           + L   L  IS+ 
Sbjct: 242 VKLMSNLDSISTT 254

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 62/110 (56%), Gaps = 24/110 (21%)

Query: 273 NIEQYAKYRIELARERVSKFEVNQLKRTKNPFLKISESLY------SFKNPHQSHKVIQR 326
           ++E YA+ RIE+AR +V  FE  QL    NP L++++  Y       F+  +Q  K I+R
Sbjct: 399 DVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAEESDFETEYQ--KCIKR 456

Query: 327 SIDLQLRKSVTLFMHNLPKVQKLKKEKIQLAKEERQKSLKRRQEELISQR 376
           ++D         F  N+P +    KEK ++    R++S+KR+ +ELI++R
Sbjct: 457 TMD--------RFKRNIPII----KEKRKMV---RKESIKRK-DELIAKR 490

>CAGL0D05852g Chr4 complement(554761..557355) [2595 bp, 864 aa] {ON}
           similar to uniprot|Q07895 Saccharomyces cerevisiae
           YLR001c
          Length = 864

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 11/80 (13%)

Query: 204 IKREIVKESGESERALLNLNKRLFRISSASHTPSPRLPDASDASERLEIWGNTLHERKPA 263
           I RE+V  S E E    +LN ++ R+ S S+    ++ D  ++++     GN L+ R  +
Sbjct: 249 ILREMVAGSLEEEAISFDLNNKMIRVDSISNGNQVKINDTIESTK-----GNLLYNRGVS 303

Query: 264 IIAKSFN------EKNIEQY 277
            I + F+      E N E+Y
Sbjct: 304 HIFRDFSGLNSTVEFNAEKY 323

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,554,804
Number of extensions: 1924854
Number of successful extensions: 15137
Number of sequences better than 10.0: 415
Number of HSP's gapped: 14816
Number of HSP's successfully gapped: 487
Length of query: 509
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 395
Effective length of database: 40,409,475
Effective search space: 15961742625
Effective search space used: 15961742625
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)