Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_13.288.842ON53053026350.0
YML115C (VAN1)8.842ON53553424300.0
Smik_13.198.842ON53652323270.0
Skud_13.268.842ON53952522910.0
KNAG0G034208.842ON51143218420.0
KAFR0A028308.842ON50740418140.0
NCAS0B003008.842ON52340718000.0
ZYRO0G14234g8.842ON50940817990.0
TDEL0B005608.842ON50944817700.0
SAKL0D01430g8.842ON44743817520.0
NDAI0E002908.842ON52252017550.0
Kpol_541.158.842ON49840217350.0
TBLA0B032708.842ON52040316840.0
KLTH0C03828g8.842ON40440316490.0
CAGL0B02321g8.842ON51240116300.0
KLLA0D01529g8.842ON50140315980.0
Ecym_46138.842ON52440715690.0
ABL124W8.842ON48540715580.0
TPHA0C047808.842ON52540915480.0
Kwal_27.102468.842ON33933814250.0
Ecym_35731.479ON44736210331e-136
SAKL0D11792g1.479ON48336210131e-132
KLTH0C03432g1.479ON48936310091e-131
CAGL0L01331g1.479ON44736210031e-131
KNAG0I003001.479ON45736410011e-131
KAFR0I027701.479ON4553629991e-130
NCAS0G041101.479ON49436210021e-130
Kwal_27.101571.479ON4763629991e-130
TBLA0B021701.479ON57236210031e-129
NDAI0G003401.479ON5043539931e-129
YEL036C (ANP1)1.479ON5003549911e-128
Smik_5.571.479ON4913539861e-128
NDAI0B012501.479ON4463619811e-128
Suva_5.331.479ON4953539851e-128
AFR357W1.479ON4343639781e-127
Skud_5.541.479ON4913539831e-127
KLLA0E22155g1.479ON4503629791e-127
Kpol_370.51.479ON6453539921e-127
TPHA0O004301.479ON5483539731e-125
TDEL0C026001.479ON4623629591e-124
ZYRO0F05170g1.479ON6083549591e-122
TPHA0L013708.500ON3923465127e-59
KLLA0E12849g8.500ON3923495101e-58
KLTH0E11616g8.500ON3943714971e-56
Suva_16.2658.500ON3953494918e-56
KNAG0A021508.500ON3963524874e-55
ZYRO0F08492g8.500ON3963704856e-55
Smik_16.1868.500ON3953494812e-54
YPL050C (MNN9)8.500ON3953494787e-54
CAGL0L12804g8.500ON3933514752e-53
SAKL0H11110g8.500ON3933494743e-53
Skud_16.2328.500ON3953494691e-52
NDAI0E030208.500ON3963464655e-52
TBLA0H033408.500ON3933524639e-52
NCAS0C023308.500ON3933704631e-51
TDEL0B013708.500ON3963524631e-51
Kpol_1031.788.500ON3923484612e-51
KAFR0H013908.500ON3983484561e-50
Kwal_27.118648.500ON4533464563e-50
Ecym_25508.500ON3903454471e-49
AGL259C8.500ON3893484314e-47
NCAS0B024408.500ON4003434113e-44
NDAI0C052508.500ON4023414001e-42
KNAG0A039908.500ON3571782421e-21
SAKL0H20438gsingletonON5652101732e-12
KLTH0G10626g2.296ON30359870.044
Suva_14.3142.296ON28162810.22
Smik_14.2982.296ON28157800.27
YNL032W (SIW14)2.296ON28157800.28
Kpol_1003.452.296ON28059790.39
Skud_38.1singletonON28157770.57
TPHA0C034702.296ON26457751.1
Agos_YGOB_Anc_6.3476.347ON469138761.1
ZYRO0G12540g3.295ON95063742.3
NCAS0G036902.296ON34960722.5
YCR019W (MAK32)1.440ON363136722.7
NDAI0G007702.296ON33957723.3
Kwal_27.114812.296ON28661704.1
Suva_10.4164.136ON145479706.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_13.28
         (530 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}...  1019   0.0  
YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}  V...   940   0.0  
Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}...   900   0.0  
Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}...   887   0.0  
KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.8...   714   0.0  
KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.8...   703   0.0  
NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,...   697   0.0  
ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} simi...   697   0.0  
TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {O...   686   0.0  
SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {...   679   0.0  
NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,...   680   0.0  
Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON} (41403..4...   672   0.0  
TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.8...   653   0.0  
KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {...   639   0.0  
CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} simila...   632   0.0  
KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {...   620   0.0  
Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar...   608   0.0  
ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic ho...   604   0.0  
TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON} Anc_1...   600   0.0  
Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {...   553   0.0  
Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {O...   402   e-136
SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} simila...   394   e-132
KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {...   393   e-131
CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa] ...   390   e-131
KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}...   390   e-131
KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.4...   389   e-130
NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479    390   e-130
Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {...   389   e-130
TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {O...   390   e-129
NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}...   387   e-129
YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}  AN...   386   e-128
Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON} Y...   384   e-128
NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {O...   382   e-128
Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON} Y...   384   e-128
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...   381   e-127
Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON} Y...   383   e-127
KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]...   381   e-127
Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)...   386   e-127
TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.47...   379   e-125
TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {O...   374   e-124
ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} simila...   374   e-122
TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8....   201   7e-59
KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]...   201   1e-58
KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} high...   196   1e-56
Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {...   193   8e-56
KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {O...   192   4e-55
ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly...   191   6e-55
Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {...   189   2e-54
YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON} ...   188   7e-54
CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} hig...   187   2e-53
SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {...   187   3e-53
Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {...   185   1e-52
NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {O...   183   5e-52
TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.5...   182   9e-52
NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {O...   182   1e-51
TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {O...   182   1e-51
Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON} (1970...   182   2e-51
KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {O...   180   1e-50
Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050...   180   3e-50
Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar...   176   1e-49
AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON} S...   170   4e-47
NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {O...   162   3e-44
NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON} Anc_8...   158   1e-42
KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {O...    98   1e-21
SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, ...    71   2e-12
KLTH0G10626g Chr7 (896733..897644) [912 bp, 303 aa] {ON} similar...    38   0.044
Suva_14.314 Chr14 (556505..557350) [846 bp, 281 aa] {ON} YNL032W...    36   0.22 
Smik_14.298 Chr14 (537057..537902) [846 bp, 281 aa] {ON} YNL032W...    35   0.27 
YNL032W Chr14 (574506..575351) [846 bp, 281 aa] {ON}  SIW14Tyros...    35   0.28 
Kpol_1003.45 s1003 (106636..107478) [843 bp, 280 aa] {ON} (10663...    35   0.39 
Skud_38.1 Chr38 (502..1347) [846 bp, 281 aa] {ON} YNL032W (REAL)       34   0.57 
TPHA0C03470 Chr3 (759402..760196) [795 bp, 264 aa] {ON} Anc_2.29...    33   1.1  
Agos_YGOB_Anc_6.347 Chr5 complement(1133115..1134524) [1410 bp, ...    34   1.1  
ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} simila...    33   2.3  
NCAS0G03690 Chr7 (684097..685146) [1050 bp, 349 aa] {ON} Anc_2.296     32   2.5  
YCR019W Chr3 (152837..153928) [1092 bp, 363 aa] {ON}  MAK32Prote...    32   2.7  
NDAI0G00770 Chr7 complement(162781..163800) [1020 bp, 339 aa] {O...    32   3.3  
Kwal_27.11481 s27 complement(818841..819701) [861 bp, 286 aa] {O...    32   4.1  
Suva_10.416 Chr10 (733026..737390) [4365 bp, 1454 aa] {ON} YLR32...    32   6.5  

>Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}
           YML115C (REAL)
          Length = 530

 Score = 1019 bits (2635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/530 (93%), Positives = 495/530 (93%)

Query: 1   MGLFLNLRSNIKEKAMDNGLSLPISRNGSSNNSKDKRSHHESKSLKGKYMYQPRSSSSKF 60
           MGLFLNLRSNIKEKAMDNGLSLPISRNGSSNNSKDKRSHHESKSLKGKYMYQPRSSSSKF
Sbjct: 1   MGLFLNLRSNIKEKAMDNGLSLPISRNGSSNNSKDKRSHHESKSLKGKYMYQPRSSSSKF 60

Query: 61  QLAXXXXXXXXXXXXXXXXXXXFLSEMKLGISIQNGNPLLGSENYKTIXXXXXXXXXXXX 120
           QLA                   FLSEMKLGISIQNGNPLLGSENYKTI            
Sbjct: 61  QLAVNVISLVIIIVLSLYLMILFLSEMKLGISIQNGNPLLGSENYKTIDLEDEEYYNYDF 120

Query: 121 XXXXPEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNFEGAP 180
               PEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNFEGAP
Sbjct: 121 EDIDPEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNFEGAP 180

Query: 181 NGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIA 240
           NGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIA
Sbjct: 181 NGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIA 240

Query: 241 YSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPF 300
           YSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPF
Sbjct: 241 YSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPF 300

Query: 301 RSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADV 360
           RSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADV
Sbjct: 301 RSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADV 360

Query: 361 ELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDV 420
           ELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDV
Sbjct: 361 ELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDV 420

Query: 421 IVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENH 480
           IVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENH
Sbjct: 421 IVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENH 480

Query: 481 AETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRRQS 530
           AETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRRQS
Sbjct: 481 AETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRRQS 530

>YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}
           VAN1Component of the mannan polymerase I, which contains
           Van1p and Mnn9p and is involved in the first steps of
           mannan synthesis; mutants are vanadate-resistant
          Length = 535

 Score =  940 bits (2430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/534 (85%), Positives = 472/534 (88%), Gaps = 4/534 (0%)

Query: 1   MGLFLNLRSNIKEKAMDNGLSLPISRNGSSNNSKDKRSHHESKSLKGKYMYQPRSSSSKF 60
           MG+F NLRSNIK+KAMDNGLSLPISRNGSSNN KDKRS H S SLKGKY YQPRS+ SKF
Sbjct: 1   MGMFFNLRSNIKKKAMDNGLSLPISRNGSSNNIKDKRSEHNSNSLKGKYRYQPRSTPSKF 60

Query: 61  QLAXXXXXXXXXXXXXXXXXXXFLSEMKLGISIQNGNPLLGS----ENYKTIXXXXXXXX 116
           QL                    FLS M +G+S QNG  LLGS    ENYKTI        
Sbjct: 61  QLTVSITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLLGSSKSSENYKTIDLEDEEYY 120

Query: 117 XXXXXXXXPEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNF 176
                   PEV+SKFDDGVQHYLI+QFGSEVLTP D+EKYQ E++ML DSTVE+YDL+NF
Sbjct: 121 DYDFEDIDPEVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNF 180

Query: 177 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 236
           EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD
Sbjct: 181 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 240

Query: 237 ALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNY 296
           ALIAYSR LQNGTLS+IFQEIDAVIDSQTKGTDKLYLKYMDE YINRVHQAFSPPFH+NY
Sbjct: 241 ALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENY 300

Query: 297 DKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 356
           DKPFRSVQ+FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR
Sbjct: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360

Query: 357 DADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLD 416
           DADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFL +EQPYDLNSWMES EAL LAKTLD
Sbjct: 361 DADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLD 420

Query: 417 EDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFT 476
           EDDVIVEGYAEYPTWRVHLAYIRDA GDPNE VDLDGVGGVSILAKAKIFRNGVQFPAFT
Sbjct: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFT 480

Query: 477 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRRQS 530
           FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA+REREKRRQS
Sbjct: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKRRQS 534

>Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}
           YML115C (REAL)
          Length = 536

 Score =  900 bits (2327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/523 (82%), Positives = 462/523 (88%), Gaps = 4/523 (0%)

Query: 1   MGLFLNLRSNIKEKAMDNGLSLPISRNGSSNNSKDKRSHHESKSLKGKYMYQPRSSSSKF 60
           MGLFLNLRSN K+K++DNGLSLPISRNGSSN+ KDKR+ H SKS K KY+YQPRS SSKF
Sbjct: 1   MGLFLNLRSNRKQKSVDNGLSLPISRNGSSNDIKDKRTLHNSKSFKDKYVYQPRSKSSKF 60

Query: 61  QLAXXXXXXXXXXXXXXXXXXXFLSEMKLGISIQNGNPLLGS----ENYKTIXXXXXXXX 116
           Q+                    FL+ M +G+ IQNG PLLGS    +NYKTI        
Sbjct: 61  QMTVNAISLIIITILSLYLSISFLTGMSIGVPIQNGRPLLGSSKSSDNYKTIDLEDEEYY 120

Query: 117 XXXXXXXXPEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNF 176
                   PEVVSKFD+GV+HYLI+QFGS+VLTP D+EKYQ E+SMLLDSTVEKYDL+ F
Sbjct: 121 DYDFEDIDPEVVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRF 180

Query: 177 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 236
           EGA NG+ETRDHILLC+PLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSE DTTLD
Sbjct: 181 EGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLD 240

Query: 237 ALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNY 296
           ALIAYSRQLQNGTLS+IFQEIDAVIDSQTKGTDKLYL+YMD++YINRV QAFSPPFH+NY
Sbjct: 241 ALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENY 300

Query: 297 DKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 356
           DKPFRSVQ+FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR
Sbjct: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360

Query: 357 DADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLD 416
           DADVELCPGS+IQDLMSKNYDVIVPNVWRPLPTFL SEQPYDLNSWMES E L+LAKTLD
Sbjct: 361 DADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLD 420

Query: 417 EDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFT 476
           EDDVIVEGYAEYPTWRVHLAYIRDA GDPNEV+DLDGVGGVSILAKAK+FRNGVQFPAFT
Sbjct: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFT 480

Query: 477 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 519
           FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI
Sbjct: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 523

>Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}
           YML115C (REAL)
          Length = 539

 Score =  887 bits (2291), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/525 (82%), Positives = 461/525 (87%), Gaps = 4/525 (0%)

Query: 1   MGLFLNLRSNIKEKAMDNGLSLPISRNGSSNNSKDKRSHHESKSLKGKYMYQPRSSSSKF 60
           MGLFLNLRS+IKEKAMDNGL LPISRNGSSNN K+KRS H+ KSLKGKY YQ RS+ SK 
Sbjct: 1   MGLFLNLRSSIKEKAMDNGLGLPISRNGSSNNIKNKRSQHDFKSLKGKYRYQSRSTLSKL 60

Query: 61  QLAXXXXXXXXXXXXXXXXXXXFLSEMKLGISIQNGNPLLGSE----NYKTIXXXXXXXX 116
           QL+                    L+ + + +S+++G  LL       NYKTI        
Sbjct: 61  QLSVSFISIIIITVLSLYLLISRLAGLNVNVSLRDGKSLLSPSESSENYKTIDLEDEEYY 120

Query: 117 XXXXXXXXPEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNF 176
                   PEV+SKFD G QHYLI+QFGSEVL P + E+YQ+E++MLLDSTVEKYDL++F
Sbjct: 121 NYDFEDIDPEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDF 180

Query: 177 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 236
           EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD
Sbjct: 181 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 240

Query: 237 ALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNY 296
           ALIAYSRQLQNGTLS+IFQ+IDA+IDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNY
Sbjct: 241 ALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNY 300

Query: 297 DKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 356
           DKPFRSVQ+FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR
Sbjct: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360

Query: 357 DADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLD 416
           DADVELCPGSVI+DLMSKNYDV+VPNVWRPLPTFLNSEQ YDLNSWMES EAL+LAKTLD
Sbjct: 361 DADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLD 420

Query: 417 EDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFT 476
           EDDVIVEGYAEYPTWRVHLAYIRDA G+PNEVVDLDGVGGVSILAKAKIFRNGVQFPAFT
Sbjct: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFT 480

Query: 477 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIAT 521
           FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIAT
Sbjct: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIAT 525

>KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.842
           YML115C
          Length = 511

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/432 (74%), Positives = 381/432 (88%), Gaps = 3/432 (0%)

Query: 101 GSENYKTIXXXXXXXXXXXXXXXXPEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEM 160
           G+ NYKT+                P V+ KFD GVQHYLI++FG++VLTP D E+Y+ E+
Sbjct: 80  GNHNYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEV 139

Query: 161 SMLLDSTVEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELID 220
             L DSTV++YDL  F G+P+G   RDH+L+C+PLR+A +VLPLMFKHLMNLTYPHELID
Sbjct: 140 KQLFDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELID 199

Query: 221 LAFLVSDCSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVID---SQTKGTDKLYLKYMD 277
           +AFLVSDCS+ D TL+ALIAYSRQLQNGTLS+IF E+DAV D   ++ +  +KLYLKYM 
Sbjct: 200 VAFLVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMK 259

Query: 278 EDYINRVHQAFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRA 337
           ++Y+N+V +AF+PP+H+NYDKPFRSVQ+F+K+FGQ+IGQGFSDRHAVKVQGIRRKLMGR+
Sbjct: 260 QEYLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRS 319

Query: 338 RNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPY 397
           RNWLTANALKPYHSWVYWRDAD+ELCPGSVIQD+M+K+YDV+VPNVWRPLP FLN EQPY
Sbjct: 320 RNWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPY 379

Query: 398 DLNSWMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGV 457
           DLNSWMES EAL+LA+TLDEDDVIVEGYAEYPTWRVHLAYIRD  GDP+EVVDLDGVGGV
Sbjct: 380 DLNSWMESPEALELAETLDEDDVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGV 439

Query: 458 SILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLK 517
           SILA+AK+FRNGVQFPAFTFENHAETEAFGKMA+K+G+RVGGLPHYT+WHIYEPSDDDL+
Sbjct: 440 SILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLR 499

Query: 518 EIATREREKRRQ 529
           EIA +EREKRR+
Sbjct: 500 EIANKEREKRRE 511

>KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.842
           YML115C
          Length = 507

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/404 (78%), Positives = 362/404 (89%)

Query: 125 PEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNFEGAPNGLE 184
           P V+ KFD G QHYLI+QFG++VLTP D E Y+ EM+ML DST+E YDL +F G PNG E
Sbjct: 104 PTVIQKFDQGAQHYLISQFGTDVLTPEDQEIYEREMNMLYDSTIETYDLQDFGGNPNGAE 163

Query: 185 TRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQ 244
            RDH+LLCIPLR+A+ VLPLMF+HLMNLTYPHELIDLAFLVSDCSE D TLDALI +S+ 
Sbjct: 164 NRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKN 223

Query: 245 LQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQ 304
           LQNGTLS++  EIDA    +T     L+LKYMD +Y+ RV +AFSPPFH++YDKPFRSVQ
Sbjct: 224 LQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQ 283

Query: 305 VFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCP 364
           +F+K+FGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDAD+ELCP
Sbjct: 284 IFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCP 343

Query: 365 GSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDVIVEG 424
           GSVI+DLM+K+YDVIVPNVWRPLP FL+ EQPYDLNSW ES EAL LA+TLDEDDVIVEG
Sbjct: 344 GSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEG 403

Query: 425 YAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETE 484
           YAEYPTWRVHLAYIRD  G+P+EVVD+DGVGGVSILAKAK+FR+GVQFPAFTFENHAETE
Sbjct: 404 YAEYPTWRVHLAYIRDPQGNPDEVVDIDGVGGVSILAKAKLFRSGVQFPAFTFENHAETE 463

Query: 485 AFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRR 528
           AFGKMAKKMGY+VGGLPHYT+WHIYEPSDDDLKE+A +ERE+RR
Sbjct: 464 AFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREERR 507

>NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,
           523 aa] {ON} Anc_8.842
          Length = 523

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/407 (78%), Positives = 361/407 (88%), Gaps = 3/407 (0%)

Query: 125 PEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNFEGAPNGLE 184
           P VV KFD+GVQHYLI+Q+G++VLTP DNE Y +E+ M+LD++VEKYDL+ F G+ NG  
Sbjct: 116 PAVVKKFDNGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGAT 175

Query: 185 TRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQ 244
            RDH+LLC+PLR+A  VLPLMFKHLMNLTYPHELIDLAFLVSDCSEGD TLDAL+AYS+ 
Sbjct: 176 NRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKH 235

Query: 245 LQNGTLSEIFQEIDAV---IDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFR 301
           LQNGTLS++F E+D        ++KGT  L+LKYM+ DY+  V  +F    H NYDKPFR
Sbjct: 236 LQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFR 295

Query: 302 SVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVE 361
           S+QVFQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPYH+WVYWRDAD+E
Sbjct: 296 SIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIE 355

Query: 362 LCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDVI 421
           LCPGSVI+DLMSK+YDVIVPNVWRPLP FL+ EQPYDLNSW+ES EAL LAKTLDEDDVI
Sbjct: 356 LCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVI 415

Query: 422 VEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHA 481
           VEGYAEYPTWRVHLAYIRDA GDPNEVVDLDGVGGVSILAKAKIFR+GVQFPAFTFENHA
Sbjct: 416 VEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHA 475

Query: 482 ETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRR 528
           ETEAFGKMA+KMG+RVGGLPHYTIWHIYEPSDDDL EIA +ER+ +R
Sbjct: 476 ETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKERQNKR 522

>ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115C VAN1
           Mannosyltransferase with a role in protein N-
           glycosylation
          Length = 509

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/408 (79%), Positives = 363/408 (88%), Gaps = 3/408 (0%)

Query: 125 PEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNFEGAPNGLE 184
           P+V+ KFD GVQHYLITQFG++VLTP D E ++ E  MLL STVE YDL+ F G+ NG  
Sbjct: 102 PKVIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSSTVESYDLSMFRGSANGAA 161

Query: 185 TRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQ 244
             +H+LLC+PLR+A  VLPLMFKHLMNLTYPHELIDLAFLVSDC+E D TLDALIAYSRQ
Sbjct: 162 NGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQ 221

Query: 245 LQNGTLSEIFQEIDAVIDSQ---TKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFR 301
           LQ+GTLS++F ++D         +KGT+KLYLKYM+ DY+  V ++FSPPFH+NYDKPFR
Sbjct: 222 LQSGTLSQVFADMDQAAAEAEQASKGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFR 281

Query: 302 SVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVE 361
           SVQVFQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVE
Sbjct: 282 SVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVE 341

Query: 362 LCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDVI 421
           LCPGSVI+DLMSK+YDV VPNVWRPLP FL+ EQPYDLNSWMESGEAL+LAKTLDEDDVI
Sbjct: 342 LCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVI 401

Query: 422 VEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHA 481
           VEGYAEYPT+RVHLAYIRD   DPNE++DLDGVGGVSILAKA++FR G+QFPAFTFENHA
Sbjct: 402 VEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHA 461

Query: 482 ETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRRQ 529
           ETE FGKMAKKMGYRVGGLPHYT+WHIYEPSDDDL+EIA +ERE RR+
Sbjct: 462 ETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKERESRRE 509

>TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {ON}
           Anc_8.842 YML115C
          Length = 509

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/448 (72%), Positives = 376/448 (83%), Gaps = 1/448 (0%)

Query: 83  FLSEMKLGISIQNGNPL-LGSENYKTIXXXXXXXXXXXXXXXXPEVVSKFDDGVQHYLIT 141
           FLS + LG S  +     + +++Y TI                P+V+ KFD+GV +Y IT
Sbjct: 62  FLSTVILGSSESSSPLPSIWTKSYDTITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKIT 121

Query: 142 QFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNFEGAPNGLETRDHILLCIPLRNAADV 201
           QFG E +T  +  K+++E+SMLLDSTVEKYD+  F G  N  E ++H+LLC+PLR+A +V
Sbjct: 122 QFGEETMTSEETTKFEQEVSMLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENV 181

Query: 202 LPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVI 261
           LPLMFKHLMN+TYPHELIDLAFLVSDCSEGD TLDALIAYSRQLQNGTLS++F E++   
Sbjct: 182 LPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSE 241

Query: 262 DSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDR 321
             + KG + LYL+YMD+DY+ RV  +FSPPFH+NYDK FRSVQ+FQKDFGQ IGQGFSDR
Sbjct: 242 KERKKGGENLYLQYMDQDYLQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDR 301

Query: 322 HAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVP 381
           HAVKVQG+RRKLM RARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLM+K+YDV+VP
Sbjct: 302 HAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVP 361

Query: 382 NVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDA 441
           NVWRPLP FL+ +QPYDLNSW+ES EALDLAKTLDEDDVIVEGYAEYPTWR HLAY RDA
Sbjct: 362 NVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDA 421

Query: 442 GGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLP 501
            GDPNEVV+LDGVGGVSILA+A++FR G+ FPAFTFENHAETEAFGKMAKKMG+RVGGLP
Sbjct: 422 NGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLP 481

Query: 502 HYTIWHIYEPSDDDLKEIATREREKRRQ 529
           HYT+WHIYEPSDDDLKEI  +EREKRR+
Sbjct: 482 HYTLWHIYEPSDDDLKEIGNKEREKRRE 509

>SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 447

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/438 (73%), Positives = 364/438 (83%), Gaps = 4/438 (0%)

Query: 92  SIQNGNPLLGSENYKTIXXXXXXXXXXXXXXXXPEVVSKFDDGVQHYLITQFGSEVLTPG 151
           SI  G+P +   NYKT                  +++ K+D G +H+LI+Q G+EVLTP 
Sbjct: 12  SILGGDPYV---NYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPE 68

Query: 152 DNEKYQEEMSMLLDSTVEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMN 211
           DNE+Y++E+ MLL +TV+ YDL+ +EG+ NG E RDH+LLC+PLRNA +VLPLMFKHLMN
Sbjct: 69  DNERYEKEVEMLLGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMN 128

Query: 212 LTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVI-DSQTKGTDK 270
           LTYPHELIDLAFLVSDCSE D TLDALIAYS++LQNGTLSE+F E D +   +  KG+  
Sbjct: 129 LTYPHELIDLAFLVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPD 188

Query: 271 LYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIR 330
           LYLKYM++DY+N V  AF PPFH +YDKPFRSVQVFQKDFGQVIGQGFSDRHAV VQGIR
Sbjct: 189 LYLKYMNQDYLNMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIR 248

Query: 331 RKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTF 390
           RKLMGRARNWLTANALKPYHSWVYWRD D+ELCPGSVI+DLMS N DV VPNVWRPLP F
Sbjct: 249 RKLMGRARNWLTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEF 308

Query: 391 LNSEQPYDLNSWMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVD 450
           L  EQ YDLNSW+ESGEAL LA TLDEDDVIVEGYAEYPTWRVHL YIR+   +P E++D
Sbjct: 309 LGGEQAYDLNSWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILD 368

Query: 451 LDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 510
           LDGVGGVSILAKAK+FR GV FPAFTFENHAETEAFGKMAKKM YRVGGLPHYT+WHIYE
Sbjct: 369 LDGVGGVSILAKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYE 428

Query: 511 PSDDDLKEIATREREKRR 528
           PSDDDLKEIA +EREKRR
Sbjct: 429 PSDDDLKEIAKKEREKRR 446

>NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,
           522 aa] {ON} Anc_8.842
          Length = 522

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/520 (62%), Positives = 395/520 (75%), Gaps = 20/520 (3%)

Query: 17  DNGLSLPISRNGSSNNSKDKRSHHESKSLKGKYMYQPRSSSSKFQLAXXXXXXXXXXXXX 76
           D  L LPISRN S+   + K+             + P+  S+   +A             
Sbjct: 15  DAKLELPISRNNSNVADELKKQR-----------FIPKKKSTAKNVAIGSVVSFIICALI 63

Query: 77  XXXXXXFLSEM----KLGISIQNGNPLLGSENYKTIXXXXXXXXXXXXXXXXPEVVSKFD 132
                 F +      K+ +     N +  S +YKT                  +V+ KF+
Sbjct: 64  YCGYSYFFNTSPRLGKINLYANKNNKV--STSYKTTELSDKEYYNYDFENIEADVLGKFE 121

Query: 133 DGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNFEGAPNGLETRDHILLC 192
           +GVQHYLI++FG++VLTP D E+Y++E++MLLD++VEKYDL  F+G+ NG E RDH+LLC
Sbjct: 122 NGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGAENRDHLLLC 181

Query: 193 IPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSE 252
           +PLR+A  VLPLMFKHLMN+TYPHELIDLAFLVSDCS+GD TL+AL+ YSR LQNGTLS+
Sbjct: 182 VPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLSQ 241

Query: 253 IFQEIDAVI---DSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQVFQKD 309
           +FQ++D         T+GT  L+LKYM+++Y+  V  AF+ P H+NYDKPFRSVQ+F+KD
Sbjct: 242 VFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRKD 301

Query: 310 FGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQ 369
           FGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPYHSWVYWRDAD+ELCPG++++
Sbjct: 302 FGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADIELCPGTIVE 361

Query: 370 DLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDVIVEGYAEYP 429
           D+M+ +YDV+VPNVWRPLP FL+SEQPYDLNSW+ES EAL LAKTL EDDVIVEGYAEYP
Sbjct: 362 DMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYP 421

Query: 430 TWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKM 489
           TWRVHLAYIR+A GDP  VVDLDGVGGVSILAKAK+FR+GV FPAFTFENHAETE FGKM
Sbjct: 422 TWRVHLAYIREAQGDPTSVVDLDGVGGVSILAKAKLFRSGVHFPAFTFENHAETEGFGKM 481

Query: 490 AKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRRQ 529
           AK+MGYRVGGLPHYTIWHIYEPSDDDLKEIA +ER+ R +
Sbjct: 482 AKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKERQSRHK 521

>Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON}
           (41403..42899) [1497 nt, 499 aa]
          Length = 498

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/402 (75%), Positives = 359/402 (89%), Gaps = 2/402 (0%)

Query: 127 VVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNFEGAPNGLETR 186
           +V KFDDG +HYLI+++GSEVLTP D  +Y++E+  LL +TV+ YDL+ + G  NG++ R
Sbjct: 98  LVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLSTTVQNYDLSKYSGTENGIQNR 157

Query: 187 DHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQ 246
           +H+LLC+PLR+A DVLPLMFK++MNLTYPHELIDLAFLVSDC+EGD TL++LIAYSR LQ
Sbjct: 158 EHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCTEGDHTLESLIAYSRHLQ 217

Query: 247 NGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQVF 306
           +GTL+ +FQE+D   D   K ++KLYLKYM++DY+  V  A+SPPFH++Y+KPFRSVQ+F
Sbjct: 218 DGTLAGLFQEMDK--DDSKKDSEKLYLKYMNKDYLKMVEDAYSPPFHNDYEKPFRSVQIF 275

Query: 307 QKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGS 366
           QKDFGQ +GQGF++RH+VKVQGIRRKLMGRARNWL  NALKPYH+WVYWRDADVELCPG+
Sbjct: 276 QKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPYHAWVYWRDADVELCPGT 335

Query: 367 VIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDVIVEGYA 426
           VI+DLMSKN+DV+VPNVWRPLP FLNSEQPYDLNSWMES EAL LAK LDEDDVIVEGYA
Sbjct: 336 VIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEALKLAKNLDEDDVIVEGYA 395

Query: 427 EYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAF 486
           EYPTWRVHLAYIR+  G+PN+VVDLDGVGGVSIL KAK+FR+G+ FPAFTFENHAETEAF
Sbjct: 396 EYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSGIHFPAFTFENHAETEAF 455

Query: 487 GKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRR 528
           GKMAKKMG+RVGGLPHYT+WHIYEPSDDDL EIA++ERE  R
Sbjct: 456 GKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNR 497

>TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.842
           YML115C
          Length = 520

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/403 (74%), Positives = 348/403 (86%), Gaps = 3/403 (0%)

Query: 131 FDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNFEGAPNGLETRDHIL 190
           FD G QHYLITQ+G +V+T  D E+Y +EM  LL S+V+KYDL+ FEG  NG E R+H+L
Sbjct: 118 FDQGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVDKYDLSQFEGTANGAENREHLL 177

Query: 191 LCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTL 250
              PLR+A  VLP+MFKHLMNLTYPHELID+AFLVSDCSEGD TLD LI ++R LQ+GTL
Sbjct: 178 YLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTL 237

Query: 251 SEIFQEIDAVI---DSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQVFQ 307
            +IF+++DA I   + + +  +K YLK+MD++YI     +F+ P H+ Y+KPFRSVQ+FQ
Sbjct: 238 VDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQ 297

Query: 308 KDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSV 367
           KDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSV
Sbjct: 298 KDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSV 357

Query: 368 IQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDVIVEGYAE 427
           IQDLMSKNYDVIVPNVWRPLP FLN EQPYDLNSWMESGEAL+LAKTLDEDDVIVEGYAE
Sbjct: 358 IQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAE 417

Query: 428 YPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFG 487
           YPTWRVHLAY+RD  GDPN+ +D+DGVGGVSILAKAK+FR+GV FPAFTFENHAETEAFG
Sbjct: 418 YPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFG 477

Query: 488 KMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRRQS 530
           KMAKKMGY VGGLP+Y +WHIYEPSDDDLK++A  ER +  Q+
Sbjct: 478 KMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIERGEYNQN 520

>KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 404

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/403 (73%), Positives = 343/403 (85%), Gaps = 1/403 (0%)

Query: 127 VVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNFEGAPNGLETR 186
           ++ KFD+G +HYLI++ G E+L   D E+Y+EE+  LLDSTVE YDL +FEG+  G   R
Sbjct: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60

Query: 187 DHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQ 246
           +H+LL +PLRNA  VLPLMFK+LMNLTYPHELIDLAFLVSDCSE D TL+AL+ Y ++LQ
Sbjct: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120

Query: 247 NGTLSEIFQEIDAVID-SQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQV 305
           +GTLS++F    +  +  + KGT  L+LKYM   Y+  V  A+SPPFH  YDKPFRSVQ+
Sbjct: 121 SGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSVQI 180

Query: 306 FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 365
           FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG
Sbjct: 181 FQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 240

Query: 366 SVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDVIVEGY 425
           SVIQDLMS ++DV VPNVWRPLP FL  EQPYDLNSW+ES  AL LA+TLDEDDVIVEGY
Sbjct: 241 SVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEGY 300

Query: 426 AEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEA 485
           AEYPTWRVHLAY+RD   +P ++++LDGVGGVSILAKAK+FRNGV FPAFTFENHAETEA
Sbjct: 301 AEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETEA 360

Query: 486 FGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRR 528
           FGKMAKKMGYRV GLPHYT+WHIYEPSDDDL +IA REREK+R
Sbjct: 361 FGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKR 403

>CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115c VAN1
           Vanadate resistance protein
          Length = 512

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/401 (73%), Positives = 344/401 (85%), Gaps = 2/401 (0%)

Query: 126 EVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNFEGAPNGLET 185
           ++VSKFD G+ +YLI+++G+E  +  D  +Y + + MLLDSTVEKYDL NF+G+ +G E 
Sbjct: 114 DIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTVEKYDLGNFQGSADGFEQ 173

Query: 186 RDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQL 245
           ++HIL+C+PLR+A +VLPLMFK+LMNLTYPHELIDLAFLVSDCSEGD TL+AL  YS+ L
Sbjct: 174 QEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCSEGDKTLEALETYSQLL 233

Query: 246 QNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQV 305
           Q G L +I  ++D    ++ K  + ++LKYM+ DY+ RV  A+ PPFH NY KPFRSVQ+
Sbjct: 234 QEGILPDILADMDNY--NKGKSNESIHLKYMEPDYLKRVKAAYKPPFHPNYSKPFRSVQI 291

Query: 306 FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 365
           FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL +NALKPYHSWVYWRDADVELCPG
Sbjct: 292 FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELCPG 351

Query: 366 SVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDVIVEGY 425
           SVI+DLM ++YDVIVPNVWRPLP FLNS QPYDLNSWMES EAL LAKTLDEDDVIVEGY
Sbjct: 352 SVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQLAKTLDEDDVIVEGY 411

Query: 426 AEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEA 485
           AEYPT+RVHLAYIR+  GDP +VVDLDGVGGVSILA+A++FR GV F AFTFENHAETEA
Sbjct: 412 AEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVHFSAFTFENHAETEA 471

Query: 486 FGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREK 526
           FGKMAKK+G+RVGGLPHYT+WHIYEPSDDDL  +A  E+ K
Sbjct: 472 FGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEKGK 512

>KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 501

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/403 (68%), Positives = 340/403 (84%), Gaps = 1/403 (0%)

Query: 126 EVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNFEGAPNGLET 185
           + + K+D+GV HY+I++ G E L+  D E ++ E  MLL ST + YDL+ + GA NG   
Sbjct: 97  DTIKKYDEGVSHYIISKGGMEALSSEDKEAFEREADMLLASTTDLYDLSQYNGASNGAAN 156

Query: 186 RDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQL 245
           RDH+LLC+PLR+AA +LP++FK+LMNLTYPHELID+AFLVSDC++   T+ +L+ +S++L
Sbjct: 157 RDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKEL 216

Query: 246 QNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQV 305
           QNGTLS+  Q+ +A  D +    ++LYLKYM +DY+  V  AF+PPFHD+YDKPFRS+Q+
Sbjct: 217 QNGTLSKTLQDFEADKD-KGNSAEQLYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQI 275

Query: 306 FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 365
           F+KDFGQ IGQGFSDRHAVKVQG+RRKLMGRARNWLTANALKPYHSWVYWRD DVELCPG
Sbjct: 276 FEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELCPG 335

Query: 366 SVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDVIVEGY 425
           +VI+DLM  +YDVIVPNVWRPLPTFL   Q YDLNSW+ES EA+ LAKTLDEDDVIVEGY
Sbjct: 336 TVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGY 395

Query: 426 AEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEA 485
           AEYPTWRVHL Y+R   G+P++++DLDGVGGVSILA+A++FR G+ FPAFTFENHAETEA
Sbjct: 396 AEYPTWRVHLGYLRKDNGNPDDLLDLDGVGGVSILARAQLFRKGIHFPAFTFENHAETEA 455

Query: 486 FGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRR 528
           FGKMAKKMG++VGGL HYT+WHIYEPSDDDL+EIA  ERE RR
Sbjct: 456 FGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRR 498

>Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii ABL124W
          Length = 524

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/407 (70%), Positives = 333/407 (81%), Gaps = 6/407 (1%)

Query: 126 EVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNFEGAPNGLET 185
           + V ++DDG +H LI Q G+  L     E ++E + MLL +TVE YDL+ + G  NG E 
Sbjct: 119 DTVRRYDDGFKHILIDQDGT--LNSNQEEGFEEHLDMLLSTTVETYDLSKYAGTANGAEN 176

Query: 186 RDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQL 245
           R+H+L+C+PLRNA +VLPLMF+HLMNLTYPHELIDLAFLVSDCS+ D T+D+LI+Y+ +L
Sbjct: 177 REHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCSKDDHTMDSLISYAEEL 236

Query: 246 QNGTLSEIFQEIDAV-IDSQTKGTDK---LYLKYMDEDYINRVHQAFSPPFHDNYDKPFR 301
           Q GTLS+  +  DA  +  ++K  +K   L+LKYM++DY+N V  A   PFH NYDKPFR
Sbjct: 237 QKGTLSKSLKLQDAYKMHKKSKSKNKEGDLHLKYMNKDYLNMVENALKEPFHKNYDKPFR 296

Query: 302 SVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVE 361
           SVQ+FQKDFGQ+IGQGFSDRH VKVQG RRKLMG+ARNWLTANALKPYHSWVYWRDADVE
Sbjct: 297 SVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTANALKPYHSWVYWRDADVE 356

Query: 362 LCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDVI 421
           LCPGSVI+DLMS  YDVIVPNVWRPLP FL SEQ YDLNSW+ES  AL+LAKTLDEDDVI
Sbjct: 357 LCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWIESDNALNLAKTLDEDDVI 416

Query: 422 VEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHA 481
           VEGYAEY TWR HLA  RD  G+  +V+DLDGVGGVSILAKAK+FRNGV F AF FENHA
Sbjct: 417 VEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKAKLFRNGVHFAAFAFENHA 476

Query: 482 ETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRR 528
           ETEAFGKMAKKMGYRVGGL HYT+WHIYEPS+DDL EIA +ER  RR
Sbjct: 477 ETEAFGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKERSSRR 523

>ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML115C (VAN1)
          Length = 485

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/407 (69%), Positives = 331/407 (81%), Gaps = 7/407 (1%)

Query: 126 EVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNFEGAPNGLET 185
           E ++K+D+G +HY +T+ G       D+ +++E+M  L+ +TVE+YDL N+EG PNG E 
Sbjct: 81  ERLAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEELVSATVEQYDLRNYEGTPNGAEN 137

Query: 186 RDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQL 245
           R+H+L+CIPLRNA  VLP+MFKHLMNLTYPHELID+AFLVSDCSE D TL +L+ Y+  L
Sbjct: 138 REHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCSENDKTLQSLMEYATYL 197

Query: 246 QNGTLSEIFQ----EIDAVIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFR 301
           Q GTL+ +      EI  +      G   LYLKYMD++Y+  V  AFSPP+H+NY+KPFR
Sbjct: 198 QKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVRDAFSPPYHENYEKPFR 257

Query: 302 SVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVE 361
           SVQVF+KDFGQ IGQGFSDRH VKVQGIRR+LMGRARNWLTANALKPYHSWVYWRD DVE
Sbjct: 258 SVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANALKPYHSWVYWRDVDVE 317

Query: 362 LCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDVI 421
           LCPGSVI+DLMS  YDVIVPNVWRPLP FL  +Q YDLNSW+ES +AL+LAK L+EDDVI
Sbjct: 318 LCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIESTDALNLAKKLEEDDVI 377

Query: 422 VEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHA 481
           VEGYAEY TWR HL   R+A G+P EV+DLDGVGGVSILAKAK+FR G  F AF FENHA
Sbjct: 378 VEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHA 437

Query: 482 ETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRR 528
           ETEAFGKMAKKMGY+VGGLPHYT+WHIYEPSDDD+ +IA RERE RR
Sbjct: 438 ETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRERENRR 484

>TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON}
           Anc_1.479 YEL036C
          Length = 525

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/409 (69%), Positives = 345/409 (84%), Gaps = 8/409 (1%)

Query: 126 EVVSKFDDGVQHYLITQFGSE---VLTPGDNEKYQEEMSMLLDSTVEKYDLTNFEGAPNG 182
           + +SK+D GV+ YL+  + ++    L+    E Y  E+  LL S+V+ YD+ +F G  +G
Sbjct: 115 DTISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHG 174

Query: 183 LETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYS 242
           + +R+H+LLCIPLR+A DVLPLMFK+LMNLTYPHELID+AFLVSDCSE D TL++L+ Y+
Sbjct: 175 VSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYT 234

Query: 243 RQLQNGTLSEIFQE---IDAVIDSQTKGTD--KLYLKYMDEDYINRVHQAFSPPFHDNYD 297
           R LQNGTL ++F+E   +D + D   +  D  KLYLKYM ++Y+ RV +AF  PFH+NYD
Sbjct: 235 RFLQNGTLPDVFEEMDKLDEMTDKVVENADDSKLYLKYMKKEYLQRVKEAFKSPFHENYD 294

Query: 298 KPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRD 357
           KPFRS+Q+++KDFGQ +GQ FSDRH VKVQGIRRKLMGRARNWL  NALKPYHSWVYWRD
Sbjct: 295 KPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRD 354

Query: 358 ADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDE 417
           ADVELCPG+VI+DLMSK++DVIVPNVWRPLP F+NSEQPYDLNSWMES EA+DLAK L E
Sbjct: 355 ADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHE 414

Query: 418 DDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTF 477
           D+VIVEGYAEYPTWRVHLAY+R+  GDPN+VVD+DGVGGVSILA+A++FR GV FPAFTF
Sbjct: 415 DEVIVEGYAEYPTWRVHLAYLREKDGDPNQVVDVDGVGGVSILARARLFRAGVHFPAFTF 474

Query: 478 ENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREK 526
           ENHAETEAFGKMAKKMG+RVGGLPHYT+WHIYEPSDDDL  IAT+E+E+
Sbjct: 475 ENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEKER 523

>Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {ON}
           YML115C (VAN1) - mannosyltransferase [contig 38] FULL
          Length = 339

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/338 (76%), Positives = 290/338 (85%), Gaps = 1/338 (0%)

Query: 193 IPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSE 252
           +PLRNA  VLPLMFK+LMNLTYPHELIDLAFLVSDCSE D T +AL+ Y+++LQ+GTLS+
Sbjct: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61

Query: 253 IFQEIDAVIDS-QTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQVFQKDFG 311
           +F   ++  +  + +G+  L+LKYM   Y+  V  AF+PPFH NYDKPFRSVQ+FQK+FG
Sbjct: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121

Query: 312 QVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDL 371
           QVIGQ FSDRHAVKVQG RRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVI+DL
Sbjct: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181

Query: 372 MSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDVIVEGYAEYPTW 431
           M+  YDV VPNVWRPLP FL+ EQ YDLNSW+ES  ALDLAK LDEDDVIVEGYAEYPTW
Sbjct: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241

Query: 432 RVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAK 491
           RVHL YIR+  GDP   +DLDGVGGVSILAKA++FRNGV FPAFTFENHAETEAFGKMAK
Sbjct: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301

Query: 492 KMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRRQ 529
           KMGY V GLPHYT+WHIYEPSDDDL ++  RERE +RQ
Sbjct: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339

>Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {ON}
           similar to Ashbya gossypii AFR357W
          Length = 447

 Score =  402 bits (1033), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 195/362 (53%), Positives = 243/362 (67%), Gaps = 47/362 (12%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           V+ YDL+N++G  +G +  D +L C+PLR+AA+ LP+ FKHL ++TYPH LIDL+FLVSD
Sbjct: 50  VDYYDLSNYQGNKDGWQRADRVLFCVPLRDAANHLPMFFKHLKSMTYPHNLIDLSFLVSD 109

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
            +  D T+  L+     LQ                SQ  GT                   
Sbjct: 110 ST--DDTMGVLLNSLHDLQ----------------SQADGT------------------- 132

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                     K F  +++FQKDFGQ+IGQ FSDRH    QG RRKLM RARNWL + A+K
Sbjct: 133 ----------KRFGDIEIFQKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSAAIK 182

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGE 407
           PYHSWVYWRD DVE  P ++++DLM  + D+IVPNVWRPLP +LN  QPYDLNSW+ES  
Sbjct: 183 PYHSWVYWRDVDVEYVPETILEDLMHHDKDIIVPNVWRPLPKWLNYIQPYDLNSWVESEG 242

Query: 408 ALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFR 467
            L LA +L EDDVIVEGY EY TWRVHLAY+RD  GDP   ++LDG+GGVSIL+KAK+FR
Sbjct: 243 GLQLAASLKEDDVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSKAKVFR 302

Query: 468 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKR 527
            G  FPAF+FE HAETEAFGK++++M Y V GLPHY IWH+YEPS DDLK +A    E++
Sbjct: 303 TGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAEEEQ 362

Query: 528 RQ 529
           R+
Sbjct: 363 RK 364

>SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 483

 Score =  394 bits (1013), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 191/362 (52%), Positives = 242/362 (66%), Gaps = 47/362 (12%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           VE YDL N++G  +G +  D +L C+PLR+AA+ LP+ FKH+  ++YPH LIDL+FLVSD
Sbjct: 82  VEYYDLNNYQGNADGWQRGDRVLFCVPLRDAAEHLPMFFKHMDEISYPHNLIDLSFLVSD 141

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
            S  D T+  L++  ++ Q+                             ++D   R    
Sbjct: 142 SS--DDTMGVLLSSLKKAQS-----------------------------NQDKSQR---- 166

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                       F ++++F+KDFGQVIGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 167 ------------FGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 214

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGE 407
           PYHSWVYWRD DVE  P ++++DLM  N DVIVPNVWRPLP +L + QPYDLNSW ES  
Sbjct: 215 PYHSWVYWRDVDVETIPRTILEDLMHHNKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 274

Query: 408 ALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFR 467
            L LA +L+ED VIVEGY EY TWR HLAY+RD  GDP   ++LDG+GGVSIL+KAK+FR
Sbjct: 275 GLQLADSLEEDAVIVEGYPEYATWRTHLAYMRDPSGDPEAEMELDGIGGVSILSKAKVFR 334

Query: 468 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKR 527
            G  FPAF+FE HAETEAFGK++++M Y V GLPHY IWH+YEPS DDLK +A    E++
Sbjct: 335 TGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAEEEK 394

Query: 528 RQ 529
           R+
Sbjct: 395 RK 396

>KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {ON}
           similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 489

 Score =  393 bits (1009), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 190/363 (52%), Positives = 243/363 (66%), Gaps = 47/363 (12%)

Query: 167 TVEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVS 226
            V+ YDL N++G  +G +  DH+L  +PLR+AA+ LP+ F H+  ++YPH LIDL+FLVS
Sbjct: 52  NVQYYDLRNYQGHADGWQRGDHVLFTVPLRDAAEHLPMFFDHMDRISYPHNLIDLSFLVS 111

Query: 227 DCSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQ 286
           D S  D T+  L+ Y ++ Q                S+   T +                
Sbjct: 112 DSS--DDTMGVLLEYLQKAQ----------------SKPDRTQR---------------- 137

Query: 287 AFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 346
                        F ++++++KDFGQ IGQ FSDRH    QG RRKLMGRARNWL + AL
Sbjct: 138 -------------FGNIEIYEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVAL 184

Query: 347 KPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESG 406
           KPYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES 
Sbjct: 185 KPYHSWVYWRDVDVETIPPTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESE 244

Query: 407 EALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIF 466
             L LA++LDED VIVEGY EY TWR HLAY+RD  GDP + ++LDG+GGVSIL+KAK+F
Sbjct: 245 GGLQLAESLDEDSVIVEGYPEYATWRTHLAYMRDPSGDPEDEMELDGIGGVSILSKAKVF 304

Query: 467 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREK 526
           R G  FPAF+FE HAETEAFGK+++++GY V GLPHY IWHIYEPS DDLK +A    E+
Sbjct: 305 RAGSHFPAFSFEKHAETEAFGKLSRRLGYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEE 364

Query: 527 RRQ 529
           +R+
Sbjct: 365 KRK 367

>CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa]
           {ON} highly similar to uniprot|P32629 Saccharomyces
           cerevisiae YEL036c ANP1 required for protein
           glycosylation in the golgi
          Length = 447

 Score =  390 bits (1003), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 192/362 (53%), Positives = 242/362 (66%), Gaps = 49/362 (13%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           VE YDL ++ G P+G +  D IL C+PLR+AA+ LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 54  VEFYDLNDYTGLPDGWQRNDRILFCVPLRDAAEHLPMFFDHLNAMTYPHHLIDLSFLVSD 113

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
            S  D T+  L+ + +Q Q                      DK                 
Sbjct: 114 SS--DNTMGVLMHHLQQAQK---------------------DK----------------- 133

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                    +K F ++++F+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + A+K
Sbjct: 134 ---------NKRFGNIEIFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIK 184

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGE 407
           PYHSWVYWRD DVE+ P S+++DLM  + DVIVPNVWRPLP +L + QPYDLNSW+ES  
Sbjct: 185 PYHSWVYWRDVDVEVIPRSIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESEG 244

Query: 408 ALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFR 467
            L LA TL ED VIVEGY EY TWR HLAY+RD  G+P + + LDG+GGVSIL+KA++FR
Sbjct: 245 GLQLADTLSEDSVIVEGYPEYATWRTHLAYMRDPNGNPEDEMMLDGIGGVSILSKARVFR 304

Query: 468 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKR 527
            G  FPAF+F+ HAETEAFGK++++MG+ V GLPHY IWHIYEPS DDLK +A    E++
Sbjct: 305 AGSHFPAFSFQKHAETEAFGKLSRRMGFDVVGLPHYVIWHIYEPSTDDLKYMAWMAEEEK 364

Query: 528 RQ 529
           R+
Sbjct: 365 RK 366

>KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}
           Anc_1.479 YEL036C
          Length = 457

 Score =  390 bits (1001), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 191/364 (52%), Positives = 241/364 (66%), Gaps = 47/364 (12%)

Query: 166 STVEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLV 225
           +  E YDL N+ G  NG +T D IL C+PLR+AA+ LP+ FKHL  +TYPH L+DL+FLV
Sbjct: 65  ANTEFYDLKNYRGNSNGWQTGDRILFCVPLRDAAEHLPMFFKHLNEMTYPHNLVDLSFLV 124

Query: 226 SDCSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVH 285
           SD    D T+  L++                     + QT  + K               
Sbjct: 125 SDSK--DDTMGVLLS---------------------NLQTAQSQK--------------- 146

Query: 286 QAFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 345
                    +  K F +++ F+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + A
Sbjct: 147 ---------DRSKRFGNIEFFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVA 197

Query: 346 LKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMES 405
           +KPYHSWVYWRD DVE  P ++++DLM    DVIVPNVWRPLP +L + QPYDLNSW ES
Sbjct: 198 IKPYHSWVYWRDVDVETAPVTIMEDLMHHGKDVIVPNVWRPLPEWLGNIQPYDLNSWQES 257

Query: 406 GEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKI 465
              L+LA +LD+D VIVEGY EY TWR HLAY+RD  GDP   ++LDG+GGVSIL+KA++
Sbjct: 258 DAGLELADSLDDDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKARV 317

Query: 466 FRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATRERE 525
           FR+G  FPAF+FE HAETEAFGK++++MGY V GLPHY IWHIYEPS +DLK +A    E
Sbjct: 318 FRSGSHFPAFSFEKHAETEAFGKLSRRMGYSVVGLPHYVIWHIYEPSTEDLKHMAWMAEE 377

Query: 526 KRRQ 529
           ++R+
Sbjct: 378 EQRK 381

>KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.479
           YEL036C
          Length = 455

 Score =  389 bits (999), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 193/362 (53%), Positives = 242/362 (66%), Gaps = 48/362 (13%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           VE YDL N++G  +G +  D IL C+PLR+AA+ LP+ F+HL  +TYPH  IDL+FLVSD
Sbjct: 62  VEYYDLRNYQGNSDGWQRNDRILFCVPLRDAAEHLPMFFEHLNLMTYPHNFIDLSFLVSD 121

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
            S  D T+  L+++ +  Q+                            MD+         
Sbjct: 122 SS--DDTMGVLLSHLQSAQSQ---------------------------MDKS-------- 144

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                     K F ++++++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 145 ----------KRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 194

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGE 407
           PYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES  
Sbjct: 195 PYHSWVYWRDVDVETVPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 254

Query: 408 ALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFR 467
            L LA+ L+ED VIVEGY EY TWR HLAY+RD  GDP E ++LDG+GGVSIL+KAK+FR
Sbjct: 255 GLQLAEALEEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVFR 314

Query: 468 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA-TREREK 526
            G  FPAF+FE HAETEAFG+++++M Y V GLPHY IWHIYEPS +DLK +A   E EK
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMAEEEK 374

Query: 527 RR 528
           RR
Sbjct: 375 RR 376

>NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479
          Length = 494

 Score =  390 bits (1002), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 190/362 (52%), Positives = 242/362 (66%), Gaps = 47/362 (12%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           VE YDL N++G  +G +  D IL C+PLR+AA+ LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 82  VEFYDLGNYQGNKDGWQRNDRILFCVPLRDAAEHLPMFFDHLNKMTYPHNLIDLSFLVSD 141

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
            S  D T+  L++    LQN    +                                   
Sbjct: 142 SS--DNTMGVLLS---NLQNAQSQQ----------------------------------- 161

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                  +  K F ++++F+KDFGQ+IGQ FSDRH  K QG RRKLM RARNWL + A+K
Sbjct: 162 -------DRSKRFGNIEIFEKDFGQIIGQSFSDRHGFKAQGPRRKLMARARNWLGSVAIK 214

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGE 407
           PYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES  
Sbjct: 215 PYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 274

Query: 408 ALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFR 467
            L LA +LDED VIVEGY EY TWR HLAY+RD  G+P + ++L+G+GGVSIL+KAK+FR
Sbjct: 275 GLQLANSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELNGIGGVSILSKAKVFR 334

Query: 468 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKR 527
           +G  FPAF+FE HAETEAFGK++++M + V GLPHY IWHIYEPS +DLK +A    E++
Sbjct: 335 SGSHFPAFSFEKHAETEAFGKLSRRMNFNVIGLPHYVIWHIYEPSKEDLKHMAWMAEEEK 394

Query: 528 RQ 529
           R+
Sbjct: 395 RK 396

>Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {ON}
           YEL036C (ANP1) - subunit of mannosyltransferase complex
           [contig 41] FULL
          Length = 476

 Score =  389 bits (999), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 188/362 (51%), Positives = 242/362 (66%), Gaps = 47/362 (12%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           VE YDL N++G  +G +  D +L  +PLR+AA+ LP+ F H+  ++YPH LIDL+FLVSD
Sbjct: 53  VEYYDLRNYQGNRDGWQRGDRVLFTVPLRDAAEHLPMFFDHMDKISYPHNLIDLSFLVSD 112

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
            S  D T+  L+ + ++ Q+ T                                      
Sbjct: 113 SS--DDTMGVLLDHLKKAQSKT-------------------------------------- 132

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                  +  K F ++++F+KDFGQ IGQ FSDRH    QG RRKLMGRARNWL + ALK
Sbjct: 133 -------DRKKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVALK 185

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGE 407
           PYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES  
Sbjct: 186 PYHSWVYWRDVDVETIPRTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 245

Query: 408 ALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFR 467
            + LA++LDED VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSIL+KAK+FR
Sbjct: 246 GMQLAESLDEDAVIVEGYPEYATWRTHLAYMRDPSGNPEDEMELDGIGGVSILSKAKVFR 305

Query: 468 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKR 527
            G  FPAF+FE HAETEAFGK+++++GY V GLPHY IWHIYEPS DDLK +A    E++
Sbjct: 306 AGSHFPAFSFEKHAETEAFGKLSRRLGYSVIGLPHYVIWHIYEPSSDDLKHMAWMAEEEK 365

Query: 528 RQ 529
           R+
Sbjct: 366 RK 367

>TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {ON}
           Anc_1.479 YEL036C
          Length = 572

 Score =  390 bits (1003), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 190/362 (52%), Positives = 236/362 (65%), Gaps = 47/362 (12%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           V  YDL N+ G  +G +  D IL C+PLR+AA  LP  F HL  +TYPH LIDL+FLVSD
Sbjct: 72  VHFYDLNNYRGNSDGWQRNDRILFCVPLRDAAQHLPRFFNHLNTMTYPHNLIDLSFLVSD 131

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
               D T+  L+++ +  Q+                                        
Sbjct: 132 SK--DDTMGVLLSHLQTAQS---------------------------------------- 149

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                  N  K F ++++++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 150 -----QQNKLKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 204

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGE 407
           PYHSWVYWRD DVE CP ++++DLM    DVIVPNVWRPLP +L + QPYDLNSW ES  
Sbjct: 205 PYHSWVYWRDVDVETCPVTIMEDLMHHGKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 264

Query: 408 ALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFR 467
            L LA +LDED VIVEGY EY TWR HLAY+RD  GDP E ++LDG+GGVSIL+KAK+FR
Sbjct: 265 GLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVFR 324

Query: 468 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKR 527
           +G  FPAF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS +DLK +A    E++
Sbjct: 325 SGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMAWMAEEEK 384

Query: 528 RQ 529
           R+
Sbjct: 385 RK 386

>NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}
           Anc_1.479 YEL036C
          Length = 504

 Score =  387 bits (993), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 193/353 (54%), Positives = 235/353 (66%), Gaps = 47/353 (13%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           VE YDL N++G  +G +  D IL C+PLR+AA+ LP+ F HL  ++YPH  IDL+FLVSD
Sbjct: 87  VEFYDLANYQGNKDGWQKNDRILFCVPLRDAAEHLPMFFDHLNKMSYPHNSIDLSFLVSD 146

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
            S  D T+  L++    LQN    +                DK                 
Sbjct: 147 SS--DDTMGVLLS---NLQNAQSQQ----------------DK----------------- 168

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                     K F ++++F+KDFGQVIGQ FSDRH    QG RRKLM RARNWL + A+K
Sbjct: 169 ---------SKRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIK 219

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGE 407
           PYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES  
Sbjct: 220 PYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 279

Query: 408 ALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFR 467
            L LA TL EDDVIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILAKAK+FR
Sbjct: 280 GLQLADTLGEDDVIVEGYPEYATWRSHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 339

Query: 468 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 520
            G  FPAF+FE HAETEAFGK+++KM Y V GLPHY IWHIYEPS +DLK +A
Sbjct: 340 TGSHFPAFSFEKHAETEAFGKLSRKMNYNVIGLPHYVIWHIYEPSKEDLKHMA 392

>YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}
           ANP1Subunit of the alpha-1,6 mannosyltransferase
           complex; type II membrane protein; has a role in
           retention of glycosyltransferases in the Golgi; involved
           in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol
          Length = 500

 Score =  386 bits (991), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 189/354 (53%), Positives = 236/354 (66%), Gaps = 47/354 (13%)

Query: 167 TVEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVS 226
           +VE YDL N++G  +G +  D IL C+PLR+A++ LP+ F HL  +TYPH LIDL+FLVS
Sbjct: 61  SVEFYDLRNYQGNKDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVS 120

Query: 227 DCSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQ 286
           D S  D T+  L++  +  Q+                Q K                    
Sbjct: 121 DSS--DNTMGVLLSNLQMAQS---------------QQDKS------------------- 144

Query: 287 AFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 346
                      K F ++++++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 145 -----------KRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVAL 193

Query: 347 KPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESG 406
           KPYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES 
Sbjct: 194 KPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 253

Query: 407 EALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIF 466
             L LA +LDED VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILAKAK+F
Sbjct: 254 GGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVF 313

Query: 467 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 520
           R G  FPAF+FE HAETEAFG+++++M Y V GLPHY IWHIYEPS DDLK +A
Sbjct: 314 RTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  384 bits (986), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 188/353 (53%), Positives = 235/353 (66%), Gaps = 47/353 (13%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           VE YDL N++G  +G +  D IL C+PLR+A++ LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVSD 121

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
            S  D T+  L++                                           +H+A
Sbjct: 122 SS--DNTMGVLLS------------------------------------------NLHKA 137

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
            S     +  K F ++++++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 138 QS---QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALK 194

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGE 407
           PYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES  
Sbjct: 195 PYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 254

Query: 408 ALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFR 467
            L LA  L+ED VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILAKAK+FR
Sbjct: 255 GLQLADALEEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 314

Query: 468 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 520
            G  FPAF+FE HAETEAFG+++++M Y V GLPHY IWHIYEPS DDLK +A
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {ON}
           Anc_1.479
          Length = 446

 Score =  382 bits (981), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 187/361 (51%), Positives = 242/361 (67%), Gaps = 47/361 (13%)

Query: 167 TVEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVS 226
           +VE YD++N++G  +G    + IL+C+PL++A++ LPL FK L  +TYPHELIDL+FLVS
Sbjct: 54  SVEFYDMSNYQGHKDGWNQNNRILICVPLKDASNALPLFFKTLEKMTYPHELIDLSFLVS 113

Query: 227 DCSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQ 286
           D S  D T+  L+   ++LQ              ID  T G                   
Sbjct: 114 DSS--DNTMYNLLNMLKRLQ--------------IDGGTSGK------------------ 139

Query: 287 AFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 346
                        F ++++++KDFGQVIGQGFSDRH    QG RRKLMG+ARNWL   A+
Sbjct: 140 -------------FGNIEIYEKDFGQVIGQGFSDRHGFAAQGPRRKLMGKARNWLNTVAI 186

Query: 347 KPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESG 406
           KPYHSWVYWRD DVE+ P ++++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES 
Sbjct: 187 KPYHSWVYWRDVDVEIIPETILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 246

Query: 407 EALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIF 466
             L L+ +L ED VIVEGY EY TWR HLAY+RD  GDP   ++LDGVGGVSIL+KA +F
Sbjct: 247 AGLALSNSLGEDAVIVEGYPEYATWRSHLAYMRDPNGDPEREMELDGVGGVSILSKANVF 306

Query: 467 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREK 526
           R+G  FPAF+F+ HAETEAFGK++K M + V GLP+Y +WHIYEPS +DL+ +A  E ++
Sbjct: 307 RSGSHFPAFSFKKHAETEAFGKLSKHMNFTVIGLPNYVVWHIYEPSKEDLQYMAKLEEKE 366

Query: 527 R 527
           R
Sbjct: 367 R 367

>Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON}
           YEL036C (REAL)
          Length = 495

 Score =  384 bits (985), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 188/353 (53%), Positives = 234/353 (66%), Gaps = 47/353 (13%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           VE YDL N++G  +G +  D IL C+PLR+A++ LP+ F HL  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFDHLNAMSYPHNLIDLSFLVSD 121

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
            S  D T+  L++                             KL +    +D   R    
Sbjct: 122 SS--DNTMGVLLS-----------------------------KLQMAQSQQDKTKR---- 146

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                       F ++++++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 147 ------------FGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALK 194

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGE 407
           PYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES  
Sbjct: 195 PYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 254

Query: 408 ALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFR 467
            L LA  LDED VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILAKAK+FR
Sbjct: 255 GLQLANALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 314

Query: 468 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 520
            G  FPAF+FE HAETEAFG+++++M Y V GLPHY IWHIYEPS DDLK +A
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score =  381 bits (978), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 191/363 (52%), Positives = 235/363 (64%), Gaps = 48/363 (13%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           VE +DL+   G  +G    D +L C+PLR+AA+ LP+ FKHL  +TYPH L+DL+FLVSD
Sbjct: 42  VEYWDLSWSRGKADGWAQGDRVLFCVPLRDAAEHLPMFFKHLSEMTYPHNLVDLSFLVSD 101

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
               D T+  L  + R+LQ                SQ                       
Sbjct: 102 SK--DETMSVLRQHVRELQ----------------SQPDNA------------------- 124

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                     + F ++++FQKDFGQ IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 125 ----------RQFGNIEIFQKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 174

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGE 407
           PYHSWVYWRD DVE  P ++I+DLM  + DVIVPNVWRPLP +L   QPYDLNSW+ES  
Sbjct: 175 PYHSWVYWRDVDVETVPQTIIEDLMHHDKDVIVPNVWRPLPDWLGDIQPYDLNSWVESEG 234

Query: 408 ALDLAK-TLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIF 466
            L LA  T DED VIVEGY EY TWRVHLAY+RD  GDP   ++LDG+GGVSIL++A++F
Sbjct: 235 GLQLAADTPDEDAVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSRARVF 294

Query: 467 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREK 526
           R+G  FPAF+F+ HAETE FGK+++ MGY V GLPHY IWHIYEPS DDLK +A    E+
Sbjct: 295 RSGSHFPAFSFQKHAETEGFGKLSRAMGYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEE 354

Query: 527 RRQ 529
           +R+
Sbjct: 355 QRR 357

>Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  383 bits (983), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 187/353 (52%), Positives = 234/353 (66%), Gaps = 47/353 (13%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           VE YDL N++G  +G +  D IL C+PLR+A++ LP+ F HL  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMSYPHNLIDLSFLVSD 121

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
            S  D T+  L++  +  Q+                Q K                     
Sbjct: 122 SS--DNTMGVLLSSLQTAQS---------------QQDKS-------------------- 144

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                     K F ++++++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 145 ----------KRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALK 194

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGE 407
           PYHSWVYWRD DV+  P ++++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES  
Sbjct: 195 PYHSWVYWRDVDVQTIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 254

Query: 408 ALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFR 467
            L LA  LDED VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILAKAK+FR
Sbjct: 255 GLQLADALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 314

Query: 468 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 520
            G  FPAF+FE HAETEAFG+++++M Y V GLPHY IWHIYEPS DDLK +A
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]
           {ON} similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 450

 Score =  381 bits (979), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 191/362 (52%), Positives = 238/362 (65%), Gaps = 48/362 (13%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           VE YDL N++G  NG +T D ++ C+PLR+AA  L + F  L  LTYPH LIDL+FLVSD
Sbjct: 57  VEYYDLINYQGNANGWQTGDRVVFCVPLRDAAAHLDMFFDTLDKLTYPHNLIDLSFLVSD 116

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
            S  D T+  L+++ R+ Q+               +Q K                     
Sbjct: 117 SS--DDTMKTLLSHLRRAQS---------------NQDKS-------------------- 139

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                     + F ++++F+KDFGQ +GQ FSDRH    QG RRK M RARNWL + ALK
Sbjct: 140 ----------RRFANIEIFEKDFGQSVGQSFSDRHGFAAQGPRRKSMARARNWLGSAALK 189

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGE 407
           PYHS+VYWRD DV+  P ++++DLM  + DVIVPNVWRPLP +L + QPYDLNSW+ES  
Sbjct: 190 PYHSYVYWRDVDVQTIPNTILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESEG 249

Query: 408 ALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFR 467
            L LA +LDED  IVEGY EY TWR HLAY+RD  GDP   ++LDG+GGVSIL+KAK+FR
Sbjct: 250 GLQLADSLDEDACIVEGYPEYATWRTHLAYMRDPSGDPEVEMELDGIGGVSILSKAKVFR 309

Query: 468 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA-TREREK 526
            G  FPAF+FE HAETEAFGK++++M Y V GLPHY IWHIYEPS DDLK +A   E EK
Sbjct: 310 TGSHFPAFSFEKHAETEAFGKLSRRMQYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEEK 369

Query: 527 RR 528
           RR
Sbjct: 370 RR 371

>Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)
           [1938 nt, 646 aa]
          Length = 645

 Score =  386 bits (992), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 184/353 (52%), Positives = 237/353 (67%), Gaps = 47/353 (13%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           VE YDL+N++G  +G +  D IL CIPLR+AA  LP+ F H+  +TYPH L+DL+FLVSD
Sbjct: 66  VEFYDLSNYQGNKDGWQQNDRILFCIPLRDAAQHLPMFFDHMNKMTYPHNLVDLSFLVSD 125

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
            S  D T+  L+++ + +Q+                Q K                     
Sbjct: 126 SS--DDTMGVLLSHLQTVQS---------------QQDKS-------------------- 148

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                     K F ++++++KDFGQ+IGQ FSDRH    QG RRKLM +ARNWL + ALK
Sbjct: 149 ----------KRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMAKARNWLGSVALK 198

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGE 407
           PYHSWVYWRD D+E  P ++++DLM  + D+IVPNVWRPLP +L + QPYDLNSW ES  
Sbjct: 199 PYHSWVYWRDVDIETAPVTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESEG 258

Query: 408 ALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFR 467
            L LA  LDE+ VIVEGY EY TWR HLAY+RD  GDP + ++LDG+GGVSIL+KAK+FR
Sbjct: 259 GLQLANQLDENAVIVEGYPEYATWRPHLAYMRDPNGDPEDEMELDGIGGVSILSKAKVFR 318

Query: 468 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 520
           +G  FPAF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS +DLK +A
Sbjct: 319 SGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMA 371

>TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.479
           YEL036C
          Length = 548

 Score =  379 bits (973), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 184/353 (52%), Positives = 231/353 (65%), Gaps = 47/353 (13%)

Query: 167 TVEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVS 226
            VE YDL N++G  +G +  D I+ C+PLR+AA  LP  F HL  ++YPH LIDL+FLVS
Sbjct: 64  NVEFYDLRNYKGNKDGWQRNDRIVFCVPLRDAAQHLPRFFDHLDKMSYPHNLIDLSFLVS 123

Query: 227 DCSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQ 286
           D S  D T+  L++  +  Q                SQ   +                  
Sbjct: 124 DSS--DDTMGVLLSNLQTAQ----------------SQRDKS------------------ 147

Query: 287 AFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 346
                      K F ++++++KDFGQVIGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 148 -----------KRFGNIEIYEKDFGQVIGQSFSDRHGFAGQGPRRKLMARARNWLGSVAL 196

Query: 347 KPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESG 406
           KPYHSWVYWRD D+E  P ++++DLM  + D+IVPNVWRPLP +L + QPYDLNSW ES 
Sbjct: 197 KPYHSWVYWRDVDIETAPRTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESE 256

Query: 407 EALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIF 466
             L LA  L+ED VIVEGY EY TWR HLAY+RD  GDP   ++LDG+GGVSIL+KA +F
Sbjct: 257 GGLQLANQLNEDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKANVF 316

Query: 467 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 519
           R+G  FPAF+FE HAETEAFGK++++MGY V GLPHY +WHIYEPS +DLK +
Sbjct: 317 RSGSHFPAFSFEKHAETEAFGKLSRRMGYNVIGLPHYVVWHIYEPSTEDLKHM 369

>TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {ON}
           Anc_1.479 YEL036C
          Length = 462

 Score =  374 bits (959), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 186/362 (51%), Positives = 235/362 (64%), Gaps = 48/362 (13%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           VE YDL N++G  +G +  + IL  +PLR+AA  LP  F H+  L+YPH LID++FLVSD
Sbjct: 57  VEYYDLRNYQGDRDGWQRGNRILFLVPLRDAAQHLPRFFGHMSELSYPHNLIDMSFLVSD 116

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
            S+                  T+ E+   +  +  SQ                       
Sbjct: 117 SSDD-----------------TMGELLHHL-QIAQSQK---------------------- 136

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                  + +K F ++++F+KDFGQ IGQ FSDRH    QG RRKLM RARNWL +  LK
Sbjct: 137 -------DRNKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVTLK 189

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGE 407
           PYHSWVYWRD DVE+ P S+++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES  
Sbjct: 190 PYHSWVYWRDVDVEIAPISIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESEA 249

Query: 408 ALDLAKTL-DEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIF 466
            + LA TL DED VIVEGY E+ TWR HLAY+RD  G+P + ++LDG+GGVSILAKAK+F
Sbjct: 250 GIQLANTLTDEDSVIVEGYPEFATWRTHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVF 309

Query: 467 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREK 526
           R G  FPAF+FE HAETEAFGK++++M Y V GLPHY IWHIYEPS +DLK +A    E+
Sbjct: 310 RTGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMAEEE 369

Query: 527 RR 528
           +R
Sbjct: 370 KR 371

>ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 608

 Score =  374 bits (959), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 184/354 (51%), Positives = 235/354 (66%), Gaps = 48/354 (13%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           VE YDL N++G P+G +  + IL  +PLR+AA+ LP  F H+  +TYPH LID +FLVSD
Sbjct: 63  VEYYDLRNYQGDPDGWQRDNRILFLVPLRDAAEHLPRFFNHMDKMTYPHNLIDFSFLVSD 122

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
            S  D T+ AL+++  + Q+                             ++D   R    
Sbjct: 123 SS--DDTMGALLSHLEKAQS-----------------------------NKDKTRR---- 147

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                       F ++++++KDFGQ IGQ FSDRH    QG RRKLM RARNWL   ALK
Sbjct: 148 ------------FGNIEIYEKDFGQAIGQSFSDRHGFDAQGPRRKLMARARNWLGTVALK 195

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGE 407
            YHSWVYWRD DVELCP S+++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES  
Sbjct: 196 AYHSWVYWRDVDVELCPQSIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESEV 255

Query: 408 ALDLAKTLDEDD-VIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIF 466
            + LA +L +DD VIVEGY +Y TWR HLAY+RD  G+P + ++LDG+GGVSIL+K K+F
Sbjct: 256 GVQLADSLPDDDAVIVEGYPDYSTWRTHLAYMRDPNGNPEDELELDGIGGVSILSKGKVF 315

Query: 467 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 520
           R G  FPAF+FE HAETEAFGK++++MGY V GLPHY IWHIYEPS +DL+ +A
Sbjct: 316 RTGSHFPAFSFEKHAETEAFGKLSRRMGYNVVGLPHYVIWHIYEPSTEDLQHMA 369

>TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8.500
           YPL050C
          Length = 392

 Score =  201 bits (512), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 112/346 (32%), Positives = 178/346 (51%), Gaps = 52/346 (15%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           +  YDL       + ++ ++H+L+  P++   D     + +L+ ++YP  L++L F++  
Sbjct: 96  IAHYDLNKLHSTKDAMKLKEHVLIATPMQTFHDAY---WSNLLKMSYPRSLLELGFIIPR 152

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
              GD TL  L A  + +Q G + + F +I  ++   ++  DKL                
Sbjct: 153 TPTGDETLKKLEAAVKNVQTGKVEDRFAKI-TILRQDSQSFDKL---------------- 195

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                                        G  +RH++ VQ  RR  M  ARN L  +++ 
Sbjct: 196 -----------------------------GEKERHSLAVQKERRSAMALARNELLFSSIG 226

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPL---PTFLNSEQPYDLNSWME 404
           P  SWV W DAD+   P +VIQD+ + N  V+  NV++         NS +PYD N+W E
Sbjct: 227 PSTSWVLWLDADIVETPATVIQDMTNHNKPVLAANVYQRFFDKEKNENSIRPYDFNNWAE 286

Query: 405 SGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAK 464
           S + L++AK ++ED++IVEGYAE  T+R  +A+  D  G  + ++ LDGVGG   L KA+
Sbjct: 287 SEKGLEIAKNMNEDEIIVEGYAEIATYRPLMAHFYDKAGKIDALMALDGVGGGCTLVKAE 346

Query: 465 IFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 510
           + R+G  FP F F +  ETE F KMAK++ Y + GLP+Y ++HI E
Sbjct: 347 VHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIFGLPNYLVYHIEE 392

>KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]
           {ON} highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 392

 Score =  201 bits (510), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 118/349 (33%), Positives = 179/349 (51%), Gaps = 58/349 (16%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           +  YDL   +   N L  ++ +L+  P++         + +L++LTYP  LI+L F++  
Sbjct: 96  IAHYDLNKLKSTSNALVNKERVLILTPMQTFHQQ---YWNNLLSLTYPRALIELGFIIPR 152

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
            + GD  L  L +  R++Q G   + F +I  ++   ++  D+L                
Sbjct: 153 TASGDAALQKLESAVREVQTGKQDKRFAKI-TILRQASQSFDRL---------------- 195

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                                        G  DRHA++VQ  RR  M  ARN L  + + 
Sbjct: 196 -----------------------------GEKDRHALEVQKERRAAMALARNELLFSTIG 226

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQ------PYDLNS 401
           P+ SW+ W DAD+   P +VIQDL S N  V+  NV++    F + +Q      PYD N+
Sbjct: 227 PHTSWILWLDADIVETPVTVIQDLTSHNKPVLAANVYQ---KFYDKDQKKESIRPYDFNN 283

Query: 402 WMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILA 461
           W ES   L LA+ L ++++IVEGY+E  T+R  +A+  DA G  N +++LDGVGG   L 
Sbjct: 284 WAESEIGLKLAQQLGDNEIIVEGYSEIATYRPLMAHFYDANGATNSLMELDGVGGGCTLV 343

Query: 462 KAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 510
           KA++ R+G  F  F F +  ETEAF KMAK++GY V GLP+Y ++HI E
Sbjct: 344 KAEVHRDGAMFTNFPFYHLIETEAFAKMAKRLGYSVFGLPNYLVYHIEE 392

>KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 394

 Score =  196 bits (497), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 120/371 (32%), Positives = 187/371 (50%), Gaps = 69/371 (18%)

Query: 156 YQEEMSMLLDSTVE---------KYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMF 206
           Y+++ + L   TVE          YDL            ++ +L+  P++   D     +
Sbjct: 75  YKKKSNWLFSDTVEDNIPAGHISHYDLNKLTSTDKAFANKEQVLILTPMQTFHDQY---W 131

Query: 207 KHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAV-IDSQT 265
            +L+ LTYP +LI+L F++   + GDT L  L A  ++ Q G   + F +I  +  DSQ+
Sbjct: 132 DNLLQLTYPRDLIELGFIIPRTATGDTALRKLEAAVKRTQLGKKDQRFSKITILRQDSQS 191

Query: 266 KGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVK 325
                                             F S+Q               +RHA+K
Sbjct: 192 ----------------------------------FDSLQE-------------KERHALK 204

Query: 326 VQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWR 385
           VQ  RR  M  ARN L  + + P+ SW+ W DAD+   P S+IQD+ + N  V+  NV++
Sbjct: 205 VQKERRAAMALARNELLFSTIGPHTSWILWLDADIIETPPSLIQDMTAHNKPVLAANVYQ 264

Query: 386 PLPTFLN------SEQPYDLNSWMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIR 439
               ++N      +E+PYD N+W +S +AL +A  + +D+V+ EGYAE PT+R  +A++ 
Sbjct: 265 ---KYMNEETKKIAERPYDFNNWADSEKALQMAAGMADDEVLFEGYAELPTYRTLMAHMY 321

Query: 440 DAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGG 499
           DA G     + LDGVGG   L KA++ R+G  FP+F F +  ETE F KMA+++ Y + G
Sbjct: 322 DASGSQAAEMSLDGVGGGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMARRLEYEIFG 381

Query: 500 LPHYTIWHIYE 510
           LP+Y ++HI E
Sbjct: 382 LPNYLVYHIEE 392

>Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  193 bits (491), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 115/349 (32%), Positives = 174/349 (49%), Gaps = 58/349 (16%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           +  YDL      P+    ++HIL+  P++         + +L+ L YP ELI+L F+   
Sbjct: 96  IAHYDLNKLHSTPDAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIELGFITPR 152

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
            + GD+ L  L +  +++Q    ++ F +I  ++   ++  DKL  K             
Sbjct: 153 TATGDSALKKLESAIKKVQTDKKTQRFSKI-TILRQNSQSFDKLMEK------------- 198

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                                           +RHA++VQ  RR  M  ARN L  + + 
Sbjct: 199 --------------------------------ERHALEVQKERRAAMALARNELLFSTIG 226

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQ------PYDLNS 401
           P+ SWV W DAD+   P S+IQD+   N  V+  N+++    F + E+      PYD N+
Sbjct: 227 PHTSWVLWLDADIIETPTSLIQDMTQHNKAVLAANIYQ---RFYDQEKKQASIRPYDFNN 283

Query: 402 WMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILA 461
           W ES   LD+A  + +D++IVEGYAE  T+R  +A+  DA    NE + LDGVGG   L 
Sbjct: 284 WQESDIGLDIASQMGDDEIIVEGYAEIATYRPLMAHFFDASKPQNEEMALDGVGGGCTLV 343

Query: 462 KAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 510
           KA++ R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 344 KAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  192 bits (487), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 117/352 (33%), Positives = 176/352 (50%), Gaps = 58/352 (16%)

Query: 165 DSTVEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFL 224
           ++ +  YDL            ++ +L+  P++   +     + +++++TYP ELI+L F+
Sbjct: 94  ENHIAHYDLNKLHSTKQAAVNKERVLILTPMQTFHEQ---YWDNILHMTYPRELIELGFI 150

Query: 225 VSDCSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRV 284
                 GD  L  L A  +++Q+G  +E F +I  ++  +++  D L  K          
Sbjct: 151 APRTPTGDAALKKLEAAIKKIQSGKKNERFAKI-IILRQESQSFDMLAEK---------- 199

Query: 285 HQAFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 344
                                              DRHA+ VQ  RR  M  ARN L  +
Sbjct: 200 -----------------------------------DRHALAVQKQRRSAMALARNELLFS 224

Query: 345 ALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSE------QPYD 398
            L P+ SWV W DAD+   P +VIQDL + +  V+  NV++    F N E      +PYD
Sbjct: 225 TLGPHTSWVLWLDADIVETPPTVIQDLAAHDKPVLAANVYQ---RFFNDELSKADIRPYD 281

Query: 399 LNSWMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVS 458
            N+W ES   L+LA +L  D++IVEGYAE  T+R  +A+  D     +E + LDGVGG  
Sbjct: 282 FNNWQESETGLELANSLPADEIIVEGYAEMATFRPLMAHFFDESKPVSEEMALDGVGGGC 341

Query: 459 ILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 510
            L KA++ R+G  FP F F +  ETE F KMAK++GY V GLP+Y ++HI E
Sbjct: 342 TLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIEE 393

>ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 396

 Score =  191 bits (485), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 118/370 (31%), Positives = 181/370 (48%), Gaps = 67/370 (18%)

Query: 156 YQEEMSMLLDSTVE---------KYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMF 206
           Y+++ S L +  VE          YDL            ++H+L+  P++         +
Sbjct: 76  YKKKSSWLFNDRVEDIIPENHIAHYDLNKLHSTAEAALNKEHVLILTPMQTFHQE---YW 132

Query: 207 KHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTK 266
            +L+ LTYP E  +L F++   S GD  L  L A  +++Q    ++ F +I  ++   + 
Sbjct: 133 DNLLQLTYPREFTELGFILPRTSSGDIALSKLEAAVKKVQTDKKNQRFSKI-TILRQNSA 191

Query: 267 GTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKV 326
           G DKL  K                                             +RHA++V
Sbjct: 192 GFDKLMEK---------------------------------------------ERHALEV 206

Query: 327 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRP 386
           Q  RR  M  ARN L  ++L P  SWV W DAD+   P ++IQD+ S N  V+  NV++ 
Sbjct: 207 QKERRSAMASARNELLFSSLGPKTSWVLWLDADIVETPPNLIQDMTSHNKAVLSANVYQ- 265

Query: 387 LPTFLNSE------QPYDLNSWMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRD 440
              + + +      +PYD N+W ES  AL+LAK + +D+++VEGY +  T+R  +AY  D
Sbjct: 266 --KYYDDQAKKVQIRPYDFNNWQESDTALELAKQMGDDEILVEGYGDLATYRALMAYFYD 323

Query: 441 AGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGL 500
           A G  N  ++LDGVGG   L KA + R+G  FP F F +  ETE F KMA+++ Y + GL
Sbjct: 324 ATGATNAEMNLDGVGGGCTLVKADVHRDGAMFPTFPFYHLIETEGFAKMAQRLNYDIFGL 383

Query: 501 PHYTIWHIYE 510
           P+Y ++HI E
Sbjct: 384 PNYLVYHIEE 393

>Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  189 bits (481), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 112/349 (32%), Positives = 173/349 (49%), Gaps = 58/349 (16%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           +  YDL      P+    ++H+L+  P++         + +L+ LTYP ELI+L F+   
Sbjct: 96  IAHYDLNKLHSTPDAAANKEHVLILTPMQTFHQQY---WDNLLQLTYPRELIELGFITPR 152

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
            + GD  L  L    +++Q    ++ F +I  ++   ++  DKL  K             
Sbjct: 153 TATGDLALKKLENAVKKVQADKKAQRFSKI-TIMRQNSQSFDKLMEK------------- 198

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                                           +RHA+ VQ  RR  M  ARN L  + + 
Sbjct: 199 --------------------------------ERHALDVQKERRAAMALARNELLFSTIG 226

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQ------PYDLNS 401
           P+ SWV W DAD+   P ++IQD+   N  V+  N+++    F + E+      PYD N+
Sbjct: 227 PHTSWVLWLDADIIETPTTLIQDMTQHNKAVLAANIYQ---RFYDQEKKQSSIRPYDFNN 283

Query: 402 WMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILA 461
           W ES   L++A  +D+D++IVEGYAE  T+R  +A+   A   P++ + LDGVGG   L 
Sbjct: 284 WQESDTGLEIASQMDDDEIIVEGYAEIATYRPLMAHFYSANELPSKEMVLDGVGGGCTLV 343

Query: 462 KAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 510
           KA++ R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 344 KAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 392

>YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON}
           MNN9Subunit of Golgi mannosyltransferase complex also
           containing Anp1p, Mnn10p, Mnn11p, and Hoc1p that
           mediates elongation of the polysaccharide mannan
           backbone; forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 395

 Score =  188 bits (478), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 113/349 (32%), Positives = 170/349 (48%), Gaps = 58/349 (16%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           +  YDL            ++HIL+  P++         + +L+ L YP ELI+L F+   
Sbjct: 96  IAHYDLNKLHSTSEAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIELGFITPR 152

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
            + GD  L  L    +++Q    ++ F +I  ++   ++  DKL  K             
Sbjct: 153 TATGDLALKKLENAIKKVQTDKKTQRFSKI-TILRQNSQSFDKLMEK------------- 198

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                                           +RHA+ VQ  RR  M  ARN L  + + 
Sbjct: 199 --------------------------------ERHALDVQKERRAAMALARNELLFSTIG 226

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQ------PYDLNS 401
           P+ SWV W DAD+   P S+IQD+   N  ++  N+++    F + E+      PYD N+
Sbjct: 227 PHTSWVLWLDADIIETPPSLIQDMTKHNKAILAANIYQ---RFYDEEKKQPSIRPYDFNN 283

Query: 402 WMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILA 461
           W ES   L++A  + +D++IVEGYAE  T+R  +A+  DA G P E + LDGVGG   L 
Sbjct: 284 WQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLV 343

Query: 462 KAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 510
           KA++ R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 344 KAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050c required for complex N-glycosylation
          Length = 393

 Score =  187 bits (475), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 114/351 (32%), Positives = 174/351 (49%), Gaps = 56/351 (15%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           V KYDL       +    ++ +L+  P++         + +L+ LTYP +L++L F++  
Sbjct: 94  VAKYDLNKLHSTSDAAVNKEQVLILTPMQTFHQA---YWDNLLQLTYPRDLLELGFIIPK 150

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
            + GD  L  L A  ++ Q    +  F ++  ++   +KG DKL  K             
Sbjct: 151 SASGDAALKQLEAAVKRAQTDKKNNRFGKV-TILRQDSKGFDKLQEK------------- 196

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                                           +RHA+ VQ  RR  M  ARN L  + + 
Sbjct: 197 --------------------------------ERHALAVQKERRSAMALARNELLFSTIG 224

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSE-----QPYDLNSW 402
           P+ SWV W DAD+     S+IQD+ + N  V+  NV++    F  +E     +PYD N+W
Sbjct: 225 PHTSWVLWLDADIIETKPSLIQDMTALNKPVLAANVYQRY--FDEAENKPSIRPYDFNNW 282

Query: 403 MESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAK 462
            +S  A +L   + +D++IVEGYAE  T+R  +A+     G PNE++ LDGVGG   L K
Sbjct: 283 ADSQIAQELGDKMGDDEIIVEGYAEIATYRPLMAHFYTPDGPPNELMSLDGVGGGCTLVK 342

Query: 463 AKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSD 513
           A++ R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E +D
Sbjct: 343 AEVHRDGAMFPTFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVFHIEERND 393

>SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 393

 Score =  187 bits (474), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 113/349 (32%), Positives = 170/349 (48%), Gaps = 58/349 (16%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           +  YDL       N    ++ +L+  P++N        + +L+ LTYP ELI+L F+V  
Sbjct: 95  IAHYDLNKLTSTQNAALNKEQVLILTPMQNFHQK---YWDNLLQLTYPRELIELGFIVPR 151

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
              G+  L+ L A  +++Q G   + F +I  ++   ++  DKL  K             
Sbjct: 152 TGSGNVALEQLEAAVKKVQTGKKEDRFGKI-TILRQASQSFDKLLEK------------- 197

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                                           +RHA++VQ  RR  M  ARN L  + + 
Sbjct: 198 --------------------------------ERHALEVQKERRAAMALARNELLFSTIG 225

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQ------PYDLNS 401
           PY SW+ W DAD+   P SVI+D+ + N  V+  NV++    + + EQ      PYD N+
Sbjct: 226 PYTSWILWLDADIVETPPSVIEDMTAHNKPVLAANVYQ---RYYDQEQKKESIRPYDYNN 282

Query: 402 WMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILA 461
           W ES   L LA  +  D+++VEGY E  T+R  +A+  +        ++LDGVGG   L 
Sbjct: 283 WAESDIGLQLASQMSADEILVEGYPEIATYRPLMAHFYEDSAPATVEMELDGVGGGCTLV 342

Query: 462 KAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 510
           KA + R+G  FP F F +  ETE F KMAK++GY V GLP+Y ++HI E
Sbjct: 343 KADVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIDE 391

>Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  185 bits (469), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 111/349 (31%), Positives = 172/349 (49%), Gaps = 58/349 (16%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           +  YDL       +    ++H+L+  P++         + +L+ L+YP ELI+L F+   
Sbjct: 96  IAHYDLNKLHSTSDAAVNKEHVLILTPMQTFHQQ---YWDNLLQLSYPRELIELGFITPR 152

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
            + GD  L  L    +++Q    ++ F +I  ++   ++  DKL  K             
Sbjct: 153 TATGDLALKNLENAIKKVQTDKKTQRFSKI-TILRQNSQSFDKLMEK------------- 198

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                                           +RHA+ VQ  RR  M  ARN L  + + 
Sbjct: 199 --------------------------------ERHALDVQKERRAAMALARNELLFSTIG 226

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQ------PYDLNS 401
           P+ SW+ W DAD+   P S+IQD+   +  V+  N+++    F + E+      PYD N+
Sbjct: 227 PHTSWILWLDADIIETPVSLIQDMTQHDKAVLAANIYQ---RFYDQEKKQPSIRPYDFNN 283

Query: 402 WMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILA 461
           W ES   L++A  + +D++IVEGYAE  T+R  +A+  +A G PNE + LDGVGG   L 
Sbjct: 284 WQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHHYNADGLPNEEMALDGVGGGCTLV 343

Query: 462 KAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 510
           KA + R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 344 KADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYNVFGLPNYLVYHIEE 392

>NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {ON}
           Anc_8.500
          Length = 396

 Score =  183 bits (465), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 108/346 (31%), Positives = 172/346 (49%), Gaps = 52/346 (15%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           + ++DL       +    ++ +L+  PL+         +++++ L+YP ELI+L F+V  
Sbjct: 97  IAEFDLNKLHSTKDASINKEKVLILTPLQKFHQE---YWENILQLSYPRELIELGFIVPR 153

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
              GD  L +L                    AV  +QT                      
Sbjct: 154 TQTGDLALQSLE------------------KAVEKTQT---------------------- 173

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                 D  ++ F  V + ++D          +RHA+ VQ  RR  M  ARN L  + + 
Sbjct: 174 ------DKKNQRFAKVTILRQDSESFNKLAEKERHALNVQKERRSSMALARNELLFSTIG 227

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPL---PTFLNSEQPYDLNSWME 404
           P+ SWV W DAD+   P ++IQD+ + +  V+  NV++         ++ +PYD N+W E
Sbjct: 228 PHTSWVLWLDADIVETPSTLIQDMTAHDKSVLAANVFQRYYDDEKKASATRPYDFNNWQE 287

Query: 405 SGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAK 464
           S   L+LA  +++D++IVEGY+E  T+R  +AY  D     +E + LDGVGG   L KA+
Sbjct: 288 SEIGLELASKMNDDEIIVEGYSEIATYRPLMAYFHDTTKPVSEEMILDGVGGGCTLVKAE 347

Query: 465 IFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 510
           + R+G  FP+F F +  ETE F KMAK++GY + GLP+Y ++HI E
Sbjct: 348 VHRDGAMFPSFPFYHLIETEGFAKMAKRLGYEIFGLPNYLVYHIEE 393

>TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.500
           YPL050C
          Length = 393

 Score =  182 bits (463), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 109/352 (30%), Positives = 176/352 (50%), Gaps = 58/352 (16%)

Query: 165 DSTVEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFL 224
           ++ +  YDL       +    ++ +L+  P++   D     +++L+ LTYP ELI+L F+
Sbjct: 91  ENHIAHYDLNKLHSTSDAAVNKEQVLILTPMQTFHDEF---WQNLLQLTYPRELIELGFI 147

Query: 225 VSDCSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRV 284
           +     GD  L AL A  +++Q    ++ F +I  ++   ++G                 
Sbjct: 148 LPRSDSGDAALKALEAAVKKVQTDKKNQRFSKI-TILRQDSQG----------------- 189

Query: 285 HQAFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 344
                                    FGQ++ +   +RHA+ VQ  RR  M  ARN L  +
Sbjct: 190 -------------------------FGQLMEK---ERHALHVQKERRAAMALARNELLFS 221

Query: 345 ALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQ------PYD 398
            + P+ SWV W DAD+   P +VIQD+ + +  V+  NV++    + + E+       YD
Sbjct: 222 TIGPHTSWVLWLDADIVETPPTVIQDMTAHDKAVLAANVYQ---RYFDEEKKEKSIRAYD 278

Query: 399 LNSWMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVS 458
            N+W ES   L +A  +++D++IVEGY+E  T+R  +A+  D     N  + LDGVGG  
Sbjct: 279 FNNWQESDTGLQIAAGMNDDEIIVEGYSEIATYRPLMAHFYDPTASVNSEMMLDGVGGGC 338

Query: 459 ILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 510
            L KA + R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++H+ E
Sbjct: 339 TLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHMEE 390

>NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {ON}
           Anc_8.500
          Length = 393

 Score =  182 bits (463), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 117/370 (31%), Positives = 180/370 (48%), Gaps = 67/370 (18%)

Query: 156 YQEEMSMLLDSTVEK---------YDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMF 206
           Y+ E + + D  V++         YDL       +    ++ IL+  P++         +
Sbjct: 73  YKNEHNWMFDDHVDEIIPEGHIAHYDLNKLHSTSDAAINKEKILILTPIQKFHQE---YW 129

Query: 207 KHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTK 266
           ++L+ LTYP ELI+L F+      GD  L AL A   ++Q+   ++ F ++  ++   + 
Sbjct: 130 ENLLQLTYPRELIELGFIAPRTPTGDQALAALEAAVDKVQSDKKNQRFSKV-TILRQDSV 188

Query: 267 GTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKV 326
           G +KL  K                                             +RHA++V
Sbjct: 189 GFNKLTEK---------------------------------------------ERHALEV 203

Query: 327 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRP 386
           Q  RR  M  ARN L  + + P+ SWV W DAD+   P S+IQD+ + +  V+  NV++ 
Sbjct: 204 QKERRASMALARNELLFSTIGPHTSWVLWLDADIIETPASLIQDMTAHDRAVLSANVFQ- 262

Query: 387 LPTFLNSEQ------PYDLNSWMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRD 440
              + + E+      PYD N+W ES   L+LA  + +D++IVEGYAE  T+R  +AY  D
Sbjct: 263 --RYYDEEKKQKAIRPYDFNNWQESDTGLELASKMKDDEIIVEGYAEIATYRPLMAYFHD 320

Query: 441 AGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGL 500
                 E + LDGVGG   L KA++ R+G  FP F F +  ETE F KMAK++ Y V GL
Sbjct: 321 PDNSVAEEMRLDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGL 380

Query: 501 PHYTIWHIYE 510
           P+Y ++HI E
Sbjct: 381 PNYLVYHIEE 390

>TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  182 bits (463), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 112/352 (31%), Positives = 171/352 (48%), Gaps = 58/352 (16%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           +  YDL            ++ +L+  P++   +     + +L+ LTYP ELI+L F+V  
Sbjct: 97  IAHYDLNKLHSTAKAALNKEQVLILTPMQTFHEQ---YWDNLLQLTYPRELIELGFIVPR 153

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
              GD  L  L    +++Q    ++ F ++  ++   +K  DKL  K             
Sbjct: 154 TQSGDVALAKLEEAVKKVQTDKKNQRFVKV-TILRQDSKSFDKLQEK------------- 199

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                                           +RHA+ VQ  RR  M  ARN L  + + 
Sbjct: 200 --------------------------------ERHALAVQKERRAAMALARNELLFSTIG 227

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQ------PYDLNS 401
           P+ SWV W DAD+   P ++IQD+ + N  V+  NV++    + + E+       YD N+
Sbjct: 228 PHTSWVLWLDADIVEAPPNLIQDMTAHNKPVLAANVYQ---RYYDEEKKESSIRAYDFNN 284

Query: 402 WMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILA 461
           W ES   L+LA  + ED++IVEGY+E  T+R  +AY  DA G P   + LDGVGG   L 
Sbjct: 285 WAESETGLELASQMAEDEIIVEGYSELATYRPLMAYYYDANGSPGAEMALDGVGGGCTLV 344

Query: 462 KAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSD 513
           +A + R+G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E +D
Sbjct: 345 QADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNHEVFGLPNYLVYHIEEWND 396

>Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON}
           (197094..198272) [1179 nt, 393 aa]
          Length = 392

 Score =  182 bits (461), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 109/348 (31%), Positives = 172/348 (49%), Gaps = 56/348 (16%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           +  YDL       + +  ++H+L+  P++   +     +++L+ L+YP ELI+L F++  
Sbjct: 96  IAHYDLNKLHSTSDSISDKEHVLVLTPMQTFHEK---YWENLLKLSYPRELIELGFIIPR 152

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
              GD  L  L    + +Q+   +  F +I  ++  +++  DKL  K             
Sbjct: 153 SDAGDAALKKLETAVKNVQSDKKNNRFSKI-TILRQESQSFDKLEEK------------- 198

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                                           +RH++ VQ  RR  M  ARN L  + L 
Sbjct: 199 --------------------------------ERHSLAVQKERRAAMALARNELLFSTLG 226

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQ-----PYDLNSW 402
           P+ SWV W D+D+   P +VI+ +   +  V+  NV++    F N +Q     PYD N+W
Sbjct: 227 PHTSWVLWLDSDIVETPTTVIESMTKHDKPVLAANVYQRF--FDNDKQQDSIRPYDFNNW 284

Query: 403 MESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAK 462
            ES   L LA  + +D++IVEGYAE  T+R  +A+  +  GD  E + LDGVGG   L K
Sbjct: 285 AESDIGLQLASKMGDDEIIVEGYAEIATYRPLMAHFYNPSGDVGEEMALDGVGGGCTLVK 344

Query: 463 AKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 510
           A++ R+G  FP F F +  ETE F KMAK++ Y V GLP++ ++HI E
Sbjct: 345 AEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNFLVYHIEE 392

>KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {ON}
           Anc_8.500 YPL050C
          Length = 398

 Score =  180 bits (456), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 110/348 (31%), Positives = 173/348 (49%), Gaps = 56/348 (16%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           +  YDL            ++ +L+  P++         +++L+ LTYP ELI+L F++  
Sbjct: 99  IAHYDLNKLRSTAYAAVNKERVLILTPMQTFHKQ---YWENLLQLTYPRELIELGFIIPR 155

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
              G+  L  L    +++Q+   ++ F +I  ++   ++  D+L  K             
Sbjct: 156 TKTGENALKELEIAIKKVQSDKKNQRFAKI-TILRQDSQSFDQLAEK------------- 201

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                                           DRH++ VQ  RR  M  ARN L  + L 
Sbjct: 202 --------------------------------DRHSILVQKERRAAMALARNELLFSTLG 229

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQ-----PYDLNSW 402
           P+ +WV W DAD+   P +VIQD+ S +  V+  NV++    F N E+     PYD N+W
Sbjct: 230 PHTAWVLWLDADIIETPPTVIQDMTSHDKSVLAANVYQKY--FDNDEKKMAIRPYDFNNW 287

Query: 403 MESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAK 462
            ES   L++A  +DE+++IVEGY+E  T+R  +A+  +A G   + ++LDGVGG   L K
Sbjct: 288 RESDIGLEIAANMDENEIIVEGYSEIATYRPLMAHFYNADGQVTDEMELDGVGGGCTLVK 347

Query: 463 AKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 510
           A + R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 348 ADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYGVFGLPNYLVYHIEE 395

>Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050C
           (MNN9) - Protein required for complex glycosylation
           [contig 27] FULL
          Length = 453

 Score =  180 bits (456), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 107/346 (30%), Positives = 169/346 (48%), Gaps = 52/346 (15%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           +  YDL       N    ++ +L+  P++   +     + +L+ LTYP EL++L F++  
Sbjct: 155 ITHYDLNKLTSTANAALNKEQVLILTPMQTFHEE---YWNNLLQLTYPRELLELGFIIPR 211

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
            + GD  L  L A                  AV  +Q    D+ +LK             
Sbjct: 212 TTSGDNALRKLEA------------------AVKKTQLSKKDQRFLK------------- 240

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                          + + ++D          DRHA++VQ  RR  M  ARN L  + + 
Sbjct: 241 ---------------ITILRQDSQSFDLLKEKDRHALEVQKKRRSAMALARNELLFSTIG 285

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWR---PLPTFLNSEQPYDLNSWME 404
           PY SWV W DAD+   P ++IQD+ + +  V+  NV++      T   ++ PYD N+W +
Sbjct: 286 PYTSWVLWLDADIIETPPTLIQDMTAHDKAVLAANVYQHSIDKKTGQKTKGPYDFNNWAD 345

Query: 405 SGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAK 464
           S  AL +A ++ +D V+ EGY E  T+R  +A+    G  P+  + LDGVGG   L KA+
Sbjct: 346 SDTALQMAASMPDDGVLFEGYGEMATYRTLMAHFYKEGESPSAEMVLDGVGGGCTLVKAE 405

Query: 465 IFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 510
           + R+G  FP+F F +  ETE F KMA+++ Y + GLP+Y ++HI E
Sbjct: 406 VHRDGAMFPSFPFYHLIETEGFAKMAQRLDYEIYGLPNYLVYHIEE 451

>Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar to
           Ashbya gossypii AGL259C
          Length = 390

 Score =  176 bits (447), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 105/345 (30%), Positives = 171/345 (49%), Gaps = 51/345 (14%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           + KYD+       + L  ++ +L+  P++   D     +++L++LTYP +L  L F++  
Sbjct: 95  IMKYDMNTLTTTSSPLANKEIVLILTPMQKFHDKY---WENLLSLTYPRKLTQLGFIIPR 151

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
              GD  +  L    +++Q+G  ++ F +I  ++   ++  +KL     DE         
Sbjct: 152 TPTGDVAMKRLEDAVKKVQSGKENQRFLKI-TILRQDSQSFNKL-----DE--------- 196

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                                           +RHA  VQ  RR  M  ARN L  + + 
Sbjct: 197 -------------------------------KERHAFNVQKERRAAMALARNELVFSTIG 225

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSE--QPYDLNSWMES 405
           P  SW+ W DAD+   P +VIQD+ + +  ++  NV++      N E  +PYD N+W ES
Sbjct: 226 PSTSWILWLDADIVETPATVIQDMAAHDKAILAANVFQRYIDDQNQENIRPYDFNNWQES 285

Query: 406 GEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKI 465
              L++A ++ +D++IVE Y E  T+R  +A + D  G P+  + LDGVGG   L KA++
Sbjct: 286 QTGLEIAASMKDDEIIVESYHEIVTYRPLMAKLYDPNGSPSAEMSLDGVGGGCTLVKAQV 345

Query: 466 FRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 510
            R+G  FP F F +  ETE F  MAK++ Y V GLP+Y ++H  E
Sbjct: 346 HRDGAMFPNFPFYHLIETEGFAHMAKRLNYEVFGLPNYLVYHFNE 390

>AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL050C
           (MNN9)
          Length = 389

 Score =  170 bits (431), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 106/348 (30%), Positives = 164/348 (47%), Gaps = 57/348 (16%)

Query: 165 DSTVEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFL 224
           D  + +YDL   +         + +L+  P++         + +L+ LTYP + I L FL
Sbjct: 91  DDRLREYDLNTLQSTAMAAANGEQVLILTPMQIFHQQ---YWDNLLLLTYPRKYIHLGFL 147

Query: 225 VSDCSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRV 284
           +   S G+T L  L    R++Q G                                    
Sbjct: 148 LPRTSSGNTALRKLEKAVRKVQTGP----------------------------------- 172

Query: 285 HQAFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 344
                       D+ F  + + ++DF        S RH   VQ  RR  M  ARN L  +
Sbjct: 173 -----------KDQRFGKITILRQDFASFNKLSQSARHRFHVQKERRSAMALARNELLFS 221

Query: 345 ALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQP----YDLN 400
            + PY SWV W D+D+   P ++I+D+ S N  ++  NV++    ++ + +P    YDLN
Sbjct: 222 TIGPYTSWVLWLDSDIVETPNTLIEDMTSHNKPILAANVYQ---RYVENGEPAIRAYDLN 278

Query: 401 SWMESGEALDLAKTLDEDDVIVEGYA-EYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSI 459
           +W ES   L +A  L ED +IVEGY  E+ T+R  +A++       +E++ LDGVGG   
Sbjct: 279 NWAESELGLKIASELPEDQIIVEGYGDEFATYRPLMAHMYSDKRPKDELMALDGVGGGCT 338

Query: 460 LAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWH 507
           L KA++ R+G  FP F F +  ETE F KMAK++ Y + GLP+Y ++H
Sbjct: 339 LVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIYGLPNYLVYH 386

>NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {ON}
           Anc_8.500
          Length = 400

 Score =  162 bits (411), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 98/343 (28%), Positives = 168/343 (48%), Gaps = 51/343 (14%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           +  YDL   + + N  E ++H+L+  PL++        + +L+ L+YP + I+L F++  
Sbjct: 103 IAHYDLNKLQSSANAAENKEHVLILTPLKSFEQG---YWDNLLKLSYPRDAIELGFIIPR 159

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
             +GD +L  L +  +++Q     + F +I  ++   +KG + +     ++  ++ +   
Sbjct: 160 TKKGDHSLKKLESAIKKVQTAKQGDKFSKI-TILRQNSKGFETV----PEKKEVSEI--- 211

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
                   Y+K  R+                               M  ARN L A+ L 
Sbjct: 212 -------EYEKQIRAE------------------------------MALARNELLASTLG 234

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSE---QPYDLNSWME 404
           P  +W+ W D+D+   P S+IQD+   +  V+  NV+       + E   +PYD  +W+E
Sbjct: 235 PQTAWILWLDSDIVETPPSLIQDMTHHDKPVLAANVYERYKDRESGELSIRPYDFRNWIE 294

Query: 405 SGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAK 464
           S EAL LA  + ED++IVEG A   T R  + +     G P+  + LDGVG   +L K++
Sbjct: 295 STEALQLASGMQEDEIIVEGLAGISTNRQLMTHFYQQDGSPSSEISLDGVGASCLLVKSE 354

Query: 465 IFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWH 507
           + R+G  FP F F +  E+E F KMAK++ Y V GLP+Y ++H
Sbjct: 355 VHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVYGLPNYLVYH 397

>NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON}
           Anc_8.500
          Length = 402

 Score =  158 bits (400), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 103/341 (30%), Positives = 172/341 (50%), Gaps = 44/341 (12%)

Query: 168 VEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 227
           +  YDL     + N LE ++H+L+  PL++  +     +++L+NL+YP +LI+L F+V +
Sbjct: 102 IAHYDLNKLVSSANALENKEHVLILTPLQSFDEK---YWENLLNLSYPRDLIELGFMVPN 158

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
             +GD  L       +QL+N   +   Q ID  + S  K      L+  D  +    H+ 
Sbjct: 159 TKKGDQIL-------KQLENAVKN--VQGIDKKLGSN-KFAKITILRQKDSGF----HK- 203

Query: 288 FSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 347
               F+D  DK                     + + ++++  +R  M  ARN L ++ L 
Sbjct: 204 ----FNDRKDK--------------------KEMNDIELEKEKRAEMALARNELLSSTLS 239

Query: 348 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSE--QPYDLNSWMES 405
              +W+ W D++V   P ++IQD+   +  V+  NV+       +    +PYD  +W+ES
Sbjct: 240 HSTAWILWLDSNVIETPNTLIQDMTQHDKPVLATNVYMKDSNDKDKANIRPYDFRNWIES 299

Query: 406 GEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKI 465
             AL LA  + ED++IVEG A   T R  +    ++ G P E + LDG+G    L K+++
Sbjct: 300 DTALQLASEMPEDEIIVEGMAGLATNRQLMTNFYESDGSPTEELALDGIGAACTLVKSEV 359

Query: 466 FRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIW 506
            R+G  FP F F +  E+E F KMAK++ Y V GLP+Y ++
Sbjct: 360 HRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVVGLPNYLVF 400

>KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {ON} 
          Length = 357

 Score = 97.8 bits (242), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/178 (30%), Positives = 89/178 (50%), Gaps = 9/178 (5%)

Query: 331 RKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTF 390
           RK +   +N L  + L PY SWV W D+ +   P +++QDL +    ++  ++      F
Sbjct: 183 RKQLAALKNQLLFSTLPPYCSWVLWLDSQITGTPTTLVQDLANHGKAILTTHI------F 236

Query: 391 LNSEQPYD---LNSWMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNE 447
            NS+   D   LN+W+ S     LA  +    V++EG +   T R  +    DA      
Sbjct: 237 NNSDGSPDSETLNNWVASDTWRSLATGMPHSRVVIEGVSHVYTDRPLMGQFYDAAASVLT 296

Query: 448 VVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTI 505
            ++LD V     L KA++ R+G  FP F F +  ETE F +MA+ + ++  GLP+Y +
Sbjct: 297 EMELDSVSTACTLVKAEVHRDGAMFPNFAFHHLVETEGFARMARLLKHQAFGLPNYVV 354

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 3/84 (3%)

Query: 155 KYQEEMSMLLDSTVEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTY 214
           +Y++    +    +  Y+L     +P+     +HIL+ IPL N        F++L  LTY
Sbjct: 66  QYKDNRGAVETGGISYYNLNELAASPDAEGHSEHILVLIPLINFNS---RFFENLFALTY 122

Query: 215 PHELIDLAFLVSDCSEGDTTLDAL 238
           P +LIDL  +V D       L AL
Sbjct: 123 PKQLIDLGVIVPDSKNATGILQAL 146

>SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, 565
           aa] {ON} weakly similar to gnl|GLV|DEHA0C12881g
           Debaryomyces hansenii DEHA0C12881g
          Length = 565

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 92/210 (43%), Gaps = 35/210 (16%)

Query: 320 DRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVI 379
           DRH   VQ  RRK + + RN+L  N       +    D+D+ + P  +++  +    ++I
Sbjct: 368 DRHKDSVQRARRKTIAKVRNFL-YNRSHMDEKYTLTIDSDMMVIPSDMLEKFVKMGKELI 426

Query: 380 VPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDVIVEGYAEYPTWRVH--LAY 437
           VP + R     + S++ YD N+W+  GE     +T  ED      Y  Y    V+    +
Sbjct: 427 VPRILR-----VGSDREYDKNTWI--GE-----RTKPEDTSKQNNYESYVPRPVNGKTKF 474

Query: 438 IRDAGGD----------PNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTF---------- 477
           ++D   +           + VV+LD VGG  +    KIF  G+QFP F            
Sbjct: 475 LQDCVDEKITLNSPEAYTDNVVELDSVGGAILFWDNKIFDQGIQFPVFYLIGSDWDHSEG 534

Query: 478 ENHAETEAFGKMAKKMGYRVGGLPHYTIWH 507
            +  ETE     AK +GY+  G+P+    H
Sbjct: 535 YDGVETEGLCYQAKTLGYKCYGVPNVICRH 564

>KLTH0G10626g Chr7 (896733..897644) [912 bp, 303 aa] {ON} similar to
           uniprot|P53965 Saccharomyces cerevisiae YNL032W SIW14
           Tyrosine phosphatase that plays a role in actin filament
           organization and endocytosis localized to the cytoplasm
          Length = 303

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%)

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQ 286
           C+ G      L+   R+LQN +L+ IF E       + +  D+ +++  DED I R+ Q
Sbjct: 236 CNRGKHRTGCLVGCIRRLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDEDKIKRIAQ 294

>Suva_14.314 Chr14 (556505..557350) [846 bp, 281 aa] {ON} YNL032W
           (REAL)
          Length = 281

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 31/62 (50%)

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
           C+ G      LI   R+LQN +L+ IF E       + +  D+ +++  D+D I R+ + 
Sbjct: 214 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDDEIKRIARG 273

Query: 288 FS 289
            S
Sbjct: 274 NS 275

>Smik_14.298 Chr14 (537057..537902) [846 bp, 281 aa] {ON} YNL032W
           (REAL)
          Length = 281

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%)

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRV 284
           C+ G      LI   R+LQN +L+ IF E       + +  D+ +++  D+D I R+
Sbjct: 214 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDDEIKRI 270

>YNL032W Chr14 (574506..575351) [846 bp, 281 aa] {ON}  SIW14Tyrosine
           phosphatase that plays a role in actin filament
           organization and endocytosis; localized to the cytoplasm
          Length = 281

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%)

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRV 284
           C+ G      LI   R+LQN +L+ IF E       + +  D+ +++  D+D I R+
Sbjct: 214 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDDEIKRI 270

>Kpol_1003.45 s1003 (106636..107478) [843 bp, 280 aa] {ON}
           (106636..107478) [843 nt, 281 aa]
          Length = 280

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%)

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQ 286
           C+ G      LI   R+LQN +L+ IF E       + +  D+ +++  D+ YI +V +
Sbjct: 213 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIELYDDIYIKKVAE 271

>Skud_38.1 Chr38 (502..1347) [846 bp, 281 aa] {ON} YNL032W (REAL)
          Length = 281

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 29/57 (50%)

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRV 284
           C+ G      L+   R+LQN +L+ IF E       + +  D+ +++  D+D I R+
Sbjct: 214 CNRGKHRTGCLMGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDDEIKRI 270

>TPHA0C03470 Chr3 (759402..760196) [795 bp, 264 aa] {ON} Anc_2.296
           YNL032W
          Length = 264

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 28/57 (49%)

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRV 284
           C+ G      LI   R+LQN +L+ IF E       + +  D+ +++  D+ YI  V
Sbjct: 197 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFSFPKARALDQQFIELYDDKYIKEV 253

>Agos_YGOB_Anc_6.347 Chr5 complement(1133115..1134524) [1410 bp, 469
           aa] {ON} ANNOTATED BY YGOB -
          Length = 469

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 54/138 (39%), Gaps = 32/138 (23%)

Query: 231 GDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKL------YLKYMDEDYINRV 284
           GD TL+ +I   +   N  L+E+   I  ++   T  +  L      Y  ++ E Y    
Sbjct: 237 GDVTLEQVINSCKLEVNAVLNELSIRIPELLVGTTHSSVTLAKVNDFYNSFITEYYNYTY 296

Query: 285 HQAFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLT-- 342
           HQ+ S       DK   ++ V Q   G V             + IRRKLMG A   L+  
Sbjct: 297 HQSRS-------DKIIHTLAVSQNTSGSV------------ARIIRRKLMGFATLILSLL 337

Query: 343 -----ANALKPYHSWVYW 355
                    K  HSWV+W
Sbjct: 338 VALLEVTPAKFAHSWVFW 355

>ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} similar
           to uniprot|P38244 Saccharomyces cerevisiae YBR074W
           Hypothetical ORF
          Length = 950

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 3/63 (4%)

Query: 448 VVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWH 507
           V++L+G G   I  KA +FR      A  ++N  ++  FG    + G+  GG+   T + 
Sbjct: 215 VINLEGTG---IGGKAVLFRTSDVSTAKIYQNAVKSNPFGNSLFQQGFYEGGVGSETDYR 271

Query: 508 IYE 510
           IYE
Sbjct: 272 IYE 274

>NCAS0G03690 Chr7 (684097..685146) [1050 bp, 349 aa] {ON} Anc_2.296
          Length = 349

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 31/60 (51%)

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQA 287
           C+ G      LI   R+LQN +L+ IF E       + +  D+ +++  D++ I R+ ++
Sbjct: 282 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDEGIKRIAKS 341

>YCR019W Chr3 (152837..153928) [1092 bp, 363 aa] {ON}  MAK32Protein
           necessary for structural stability of L-A
           double-stranded RNA-containing particles
          Length = 363

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 60/136 (44%), Gaps = 16/136 (11%)

Query: 362 LCPGS----VIQDLM----SKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGE-ALDLA 412
           LC GS    +I DL+    SK    IV  +W P P   + +   D+ S M+  +  + L+
Sbjct: 145 LCSGSRCLDIINDLLRVKSSKGTKPIV--IWEPFPDLCDFDHQNDIKSVMQRNDVTVILS 202

Query: 413 KTLDEDDVIVEGYAEYPTW---RVHLAYIRDAGGDPNEVVDL--DGVGGVSILAKAKIFR 467
              +E   +    ++ PT     + LA+  D   D N +  L    +G +S+  K K  R
Sbjct: 203 PNAEESSRLFGLSSKEPTSLEECLALAHRFDDFMDENNMCILRCGALGSISVSEKFKNGR 262

Query: 468 NGVQFPAFTFENHAET 483
               FPA+ F+  ++ 
Sbjct: 263 TYDHFPAYHFKTQSKV 278

>NDAI0G00770 Chr7 complement(162781..163800) [1020 bp, 339 aa] {ON}
           Anc_2.296
          Length = 339

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 28/57 (49%)

Query: 228 CSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRV 284
           C+ G      L+   R+LQN +L+ IF E       + +  D+ +++  D+  I R+
Sbjct: 272 CNRGKHRTGCLVGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDKEIKRI 328

>Kwal_27.11481 s27 complement(818841..819701) [861 bp, 286 aa] {ON}
           YNL032W (SIW14) - Tyrosine phosphatase [contig 27] FULL
          Length = 286

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 31/61 (50%)

Query: 224 LVSDCSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINR 283
           L+  C+ G      L+   R+LQN +L+ IF E       + +  D+ +++  +E+ I +
Sbjct: 215 LLIHCNRGKHRTGCLVGCIRRLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYNEEKIKK 274

Query: 284 V 284
           +
Sbjct: 275 I 275

>Suva_10.416 Chr10 (733026..737390) [4365 bp, 1454 aa] {ON} YLR320W
            (REAL)
          Length = 1454

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 181  NGLETRDHILLC--IPLRNAADVLPLMF---KHLMNLTYPHELIDLAFLVSD-CSEGDTT 234
            + L  R HI+    IP  N  ++L L+F   K L   +Y   L  L  L  + C +GD +
Sbjct: 1148 SNLLKRGHIIATDLIPASNEKELLKLVFLFSKALQKYSYQDLLFTLLALAKNHCEDGDIS 1207

Query: 235  LDALIAYSRQLQNGTLSEI 253
             D L  Y   L    L+E+
Sbjct: 1208 RDFLAKYLEFLNKNCLTEL 1226

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,321,800
Number of extensions: 2444952
Number of successful extensions: 7381
Number of sequences better than 10.0: 88
Number of HSP's gapped: 7487
Number of HSP's successfully gapped: 131
Length of query: 530
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 416
Effective length of database: 40,409,475
Effective search space: 16810341600
Effective search space used: 16810341600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)