Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_13.278.843ON55355327560.0
Smik_13.188.843ON54553522230.0
YML116W (ATR1)8.843ON54252622170.0
Skud_13.258.843ON53753021650.0
NDAI0E002808.843ON54953616970.0
CAGL0B02343g8.843ON53749516600.0
KNAG0G034308.843ON54252816210.0
SAKL0D01386g8.843ON52151516100.0
NCAS0B002908.843ON54253615970.0
Suva_13.4678.843ON54353015620.0
KNAG0J002608.843ON55051415560.0
NCAS0A02540singletonON53952615520.0
YMR279C8.843ON54053415290.0
Kwal_27.102458.843ON51551815220.0
CAGL0M03003g8.843ON55851515220.0
KAFR0B03930singletonON55555315200.0
NCAS0C004008.843ON51750015150.0
Skud_13.4518.843ON53951515030.0
Smik_13.4928.843ON54353515030.0
KLTH0C03806g8.843ON52551614960.0
TDEL0B005508.843ON53753314930.0
Kpol_541.168.843ON52849314920.0
NDAI0K004008.843ON55353414610.0
TBLA0D032708.843ON55054614510.0
KAFR0B039408.843ON54753814410.0
KAFR0A028408.843ON52051114060.0
TBLA0D03280singletonON58052413990.0
TPHA0C047908.843ON55648513860.0
TBLA0C01160singletonON60053711341e-148
Smik_15.560na 1ON5165208121e-101
Skud_15.545na 1ON5165117871e-97
Suva_8.435na 1ON5155097852e-97
YOR378Wna 1ON5154797757e-96
KLTH0C10560gna 1ON5155127712e-95
Kwal_23.6547na 1ON5115087555e-93
TDEL0G04950singletonON5125317356e-90
KLLA0B00352gna 1ON4984707092e-86
KNAG0D00130na 1ON5655615511e-62
SAKL0C06116gsingletonON1851904662e-54
KAFR0C04860na 1ON5345444483e-48
CAGL0L02519gna 1ON5294483931e-40
NCAS0A05720na 1ON5635223668e-37
NDAI0K02730singletonON6045383352e-32
Smik_6.24na 2ON5445571295e-07
Skud_6.16na 2ON5495201251e-06
SAKL0F00440gsingletonON5441351224e-06
KLLA0C18931gna 3ON5531461198e-06
Suva_10.11singletonON5404771181e-05
Kwal_34.15746na 3ON5182321162e-05
Skud_13.2442.473ON5621231134e-05
NDAI0D010202.242ON5921721126e-05
NCAS0G029902.242ON5811721126e-05
KLTH0H16214gsingletonON5511361054e-04
KLTH0C10120gsingletonON6511391010.001
KLLA0E24113g8.570ON5752701010.001
TDEL0F039908.272ON631106990.002
KLLA0A04631g8.272ON579141990.002
AGR076C8.272ON68669980.003
YPR198W (SGE1)singletonON543170970.003
SAKL0A08228gsingletonON569147970.004
TPHA0A017508.272ON636181970.004
SAKL0E02992g2.473ON570126970.004
ZYRO0C01430g8.272ON590330970.004
TDEL0D06610singletonON49790960.004
ABL040W2.473ON567227960.005
NCAS0C03460na 4ON630201960.005
Smik_17.11singletonON544165940.008
YKR105C (VBA5)singletonON582145940.008
SAKL0H16808g8.272ON65748940.009
Kpol_1039.192.242ON573228930.010
Skud_16.503singletonON543170920.013
SAKL0C05588gsingletonON677149920.015
KLTH0D16962gsingletonON571143910.017
TDEL0G03260singletonON612145910.018
Suva_4.2753.245ON683204900.023
Kpol_543.448.272ON64348900.026
KNAG0K01020singletonON599204890.035
Skud_14.2672.242ON562165880.042
YNL065W (AQR1)2.242ON586137880.044
YGR224W (AZR1)na 4ON613145870.059
Smik_14.2622.242ON561137860.066
Skud_2.423na 5ON560231860.075
KAFR0J009302.242ON566264860.076
CAGL0J09944g2.242ON592137860.078
Smik_16.81na 4ON625127850.10
Smik_8.1175.284ON514267840.13
SAKL0H09328g8.570ON596241840.14
Suva_14.2762.242ON562246830.15
SAKL0C02178gsingletonON565124830.16
KLLA0F03311g2.242ON542110830.17
ACL172C3.245ON631198830.18
TDEL0C00120singletonON569170830.19
Ecym_42988.272ON67866820.21
CAGL0B02079gna 4ON624145820.26
Smik_2.1613.245ON689235810.33
KLTH0E13222g8.570ON566267800.35
Skud_2.1553.245ON688194800.37
KLLA0F17776gna 6ON553190800.40
TPHA0F012902.242ON562172800.41
KLLA0B06798g3.245ON663132800.42
KLTH0G13464g8.272ON593161800.44
KLTH0C10142gsingletonON573132790.47
Kwal_14.728singletonON568214790.47
Smik_2.434na 5ON474147790.48
KLTH0B00132gsingletonON568145790.59
Skud_7.560na 4ON642145780.65
Kpol_1003.112.241ON581222780.66
YBR043C (QDR3)3.245ON689247780.67
KLTH0B00594gsingletonON618145780.68
TDEL0C045802.241ON557263780.72
TPHA0G031502.473ON60049780.76
YBR293W (VBA2)na 5ON474158770.80
TBLA0F030408.272ON90687770.99
SAKL0A00726gsingletonON598212771.0
Kwal_23.48242.242ON553110761.1
SAKL0E08756g2.242ON565137761.2
NDAI0B037702.242ON571238761.2
KLTH0G09372g2.242ON551145761.2
Suva_4.553na 5ON562147751.6
Suva_13.174na 7ON541236741.9
TBLA0G025502.242ON613212742.0
Ecym_53572.191ON163235742.3
TBLA0B057705.84ON68083732.7
Kpol_1004.245.530ON563167732.9
SAKL0E04246gna 6ON56566733.0
Kwal_26.9616singletonON562164723.1
NCAS0B064802.241ON587224723.6
SAKL0D04070g3.245ON667141723.7
NDAI0A02050singletonON617175724.0
TPHA0I017608.570ON653146715.1
Smik_11.368singletonON580145715.3
Kwal_26.6669singletonON590370705.5
Kpol_416.5singletonON60793706.2
ZYRO0F08228gsingletonON649140706.2
TBLA0C01100na 8ON64955706.8
Klac_YGOB_Anc_2.2412.241ON602190707.0
KLTH0B10384gsingletonON551115698.0
KAFR0J016202.242ON570128698.2
Skud_9.482.241ON599255698.5
YHR048W (YHK8)5.284ON514252698.8
TDEL0C045902.242ON529137698.8
TBLA0B044808.570ON608159699.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_13.27
         (553 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...  1066   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   860   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   858   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   838   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      658   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   644   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   629   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   624   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      619   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   606   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   603   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   602   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   593   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   590   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   590   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   590   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      588   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   583   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   583   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   580   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   579   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   579   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               567   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   563   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   559   0.0  
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   546   0.0  
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   543   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   538   0.0  
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   441   e-148
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   317   e-101
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   307   1e-97
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   306   2e-97
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   303   7e-96
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   301   2e-95
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   295   5e-93
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   287   6e-90
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   277   2e-86
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   216   1e-62
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   184   2e-54
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     177   3e-48
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   155   1e-40
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            145   8e-37
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   133   2e-32
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    54   5e-07
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    53   1e-06
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    52   4e-06
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    50   8e-06
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    50   1e-05
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    49   2e-05
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    48   4e-05
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    48   6e-05
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    48   6e-05
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    45   4e-04
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    44   0.001
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    44   0.001
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    43   0.002
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    43   0.002
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    42   0.003
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    42   0.003
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    42   0.004
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    42   0.004
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    42   0.004
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    42   0.004
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    42   0.004
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    42   0.005
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    42   0.005
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    41   0.008
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    41   0.008
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    41   0.009
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    40   0.010
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    40   0.013
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    40   0.015
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    40   0.017
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               40   0.018
Suva_4.275 Chr4 complement(487620..489671) [2052 bp, 683 aa] {ON...    39   0.023
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    39   0.026
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    39   0.035
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    39   0.042
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    39   0.044
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    38   0.059
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    38   0.066
Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W ...    38   0.075
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    38   0.076
CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} simil...    38   0.078
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    37   0.10 
Smik_8.117 Chr8 (181800..183344) [1545 bp, 514 aa] {ON} YHR048W ...    37   0.13 
SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} simila...    37   0.14 
Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065...    37   0.15 
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    37   0.16 
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    37   0.17 
ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON} Syn...    37   0.18 
TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON}         37   0.19 
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    36   0.21 
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    36   0.26 
Smik_2.161 Chr2 complement(302754..304823) [2070 bp, 689 aa] {ON...    36   0.33 
KLTH0E13222g Chr5 complement(1175450..1177150) [1701 bp, 566 aa]...    35   0.35 
Skud_2.155 Chr2 complement(291487..293553) [2067 bp, 688 aa] {ON...    35   0.37 
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    35   0.40 
TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {O...    35   0.41 
KLLA0B06798g Chr2 (596500..598491) [1992 bp, 663 aa] {ON} simila...    35   0.42 
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    35   0.44 
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    35   0.47 
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    35   0.47 
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...    35   0.48 
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    35   0.59 
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    35   0.65 
Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON} (33230....    35   0.66 
YBR043C Chr2 complement(321876..323945) [2070 bp, 689 aa] {ON}  ...    35   0.67 
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    35   0.68 
TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.2...    35   0.72 
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    35   0.76 
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...    34   0.80 
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    34   0.99 
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    34   1.0  
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    34   1.1  
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    34   1.2  
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    34   1.2  
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    34   1.2  
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...    33   1.6  
Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011...    33   1.9  
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    33   2.0  
Ecym_5357 Chr5 (722150..727048) [4899 bp, 1632 aa] {ON} similar ...    33   2.3  
TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa] ...    33   2.7  
Kpol_1004.24 s1004 (52837..54528) [1692 bp, 563 aa] {ON} (52837....    33   2.9  
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    33   3.0  
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    32   3.1  
NCAS0B06480 Chr2 complement(1225523..1227286) [1764 bp, 587 aa] ...    32   3.6  
SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} simila...    32   3.7  
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...    32   4.0  
TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.5...    32   5.1  
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    32   5.3  
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...    32   5.5  
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...    32   6.2  
ZYRO0F08228g Chr6 (665663..667612) [1950 bp, 649 aa] {ON} simila...    32   6.2  
TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432     32   6.8  
Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 b...    32   7.0  
KLTH0B10384g Chr2 complement(877070..878725) [1656 bp, 551 aa] {...    31   8.0  
KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {...    31   8.2  
Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W (...    31   8.5  
YHR048W Chr8 (204607..206151) [1545 bp, 514 aa] {ON}  YHK8Presum...    31   8.8  
TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.2...    31   8.8  
TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON} Anc_8...    31   9.2  

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score = 1066 bits (2756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/553 (94%), Positives = 523/553 (94%)

Query: 1   MIVGKEECVIQNPEVKTAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEV 60
           MIVGKEECVIQNPEVKTAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEV
Sbjct: 1   MIVGKEECVIQNPEVKTAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEV 60

Query: 61  MKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSW 120
           MKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSW
Sbjct: 61  MKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSW 120

Query: 121 LMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRA 180
           LMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRA
Sbjct: 121 LMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRA 180

Query: 181 FQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQ 240
           FQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQ
Sbjct: 181 FQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQ 240

Query: 241 WPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPI 300
           WPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFSMDWIGS             WNQAPI
Sbjct: 241 WPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFSMDWIGSGLGVIGLVLLNLVWNQAPI 300

Query: 301 SGWNQAYXXXXXXXXXXXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFG 360
           SGWNQAY                 YEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFG
Sbjct: 301 SGWNQAYIIVLLIISVLFLVLFGVYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFG 360

Query: 361 IFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFN 420
           IFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFN
Sbjct: 361 IFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFN 420

Query: 421 VGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTV 480
           VGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTV
Sbjct: 421 VGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTV 480

Query: 481 VNYSMSLCLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDH 540
           VNYSMSLCLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDH
Sbjct: 481 VNYSMSLCLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDH 540

Query: 541 RAKAVAEDKRSMS 553
           RAKAVAEDKRSMS
Sbjct: 541 RAKAVAEDKRSMS 553

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  860 bits (2223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/535 (77%), Positives = 456/535 (85%)

Query: 15  VKTAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFK 74
           V++  K +D +E+ENE     + SS  N  E  L     TN EDE+++  QKWQNP YFK
Sbjct: 7   VESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFK 66

Query: 75  YPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFIL 134
           Y WQEYLFIFTCMISQLLNQ+GTTQTLSIMNIL+DSFGS+ NS+SWLMASFPLVSGSFIL
Sbjct: 67  YAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFIL 126

Query: 135 ISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVL 194
           ISGR+GDI+GLK MLL+GYV++IIWSLICG+T YSGSDTFFI+ RAFQGLGIAFVLPNVL
Sbjct: 127 ISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVL 186

Query: 195 GIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVI 254
           GIIGN+YVGGTFRKNIVISF+GAMAPIGATLGC FAGLIGT NPNQWPWAFYA++I ++I
Sbjct: 187 GIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLI 246

Query: 255 NLILSIYAIPNNIPTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXX 314
           N  LSIYAIPNNIPTN+H FSMDWIGS             WNQAPISGW+QAY       
Sbjct: 247 NFGLSIYAIPNNIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWSQAYIIVILII 306

Query: 315 XXXXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIR 374
                     YE+ FAKSPLLP AV+KD HMIQIML+LFFGWGSFGIFTFYYFQFQLNIR
Sbjct: 307 SVIFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIR 366

Query: 375 HYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHET 434
           HYT LWAGG+YFMFLIWGIIAALLVGF+IK VSPSV+LFF+MVAFNVGSIMASVTPVHET
Sbjct: 367 HYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHET 426

Query: 435 YFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGAT 494
           YFR Q+GTMIILSFGMDLSFPASSIIFSD LPMEYQGMAGSLVNTVVNYSMSLCLGMGAT
Sbjct: 427 YFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGAT 486

Query: 495 VEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAEDK 549
           VE QLDPDGKH+LKGYRGAQYLGIGLASLAC+ISGLYMVE +I DH+AKA  E+ 
Sbjct: 487 VETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAATEND 541

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  858 bits (2217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/526 (78%), Positives = 452/526 (85%)

Query: 22  EDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYL 81
           E   E ENE  L  + SS  NN   +LT    T SEDE++ + QKWQNPNYFKY WQEYL
Sbjct: 11  ESKGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYL 70

Query: 82  FIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGD 141
           FIFTCMISQLLNQ+GTTQTLSIMNIL+DSFGS+ NS+SWLMASFPLVSGSFILISGR+GD
Sbjct: 71  FIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGD 130

Query: 142 IFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVY 201
           I+GLK MLL+GYV++IIWSLICG+TKYSGSDTFFI+SRAFQGLGIAFVLPNVLGIIGN+Y
Sbjct: 131 IYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIY 190

Query: 202 VGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIY 261
           VGGTFRKNIVISF+GAMAPIGATLGC FAGLIGT +P QWPWAFYAY+I A IN +LSIY
Sbjct: 191 VGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIY 250

Query: 262 AIPNNIPTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXXXXXXXX 321
           AIP+ IPTN+H FSMDWIGS             WNQAPISGWNQAY              
Sbjct: 251 AIPSTIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVV 310

Query: 322 XXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWA 381
              YEI FAK+PLLP+AV+KDRHMIQIML+LFFGWGSFGIFTFYYFQFQLNIR YT LWA
Sbjct: 311 FIIYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWA 370

Query: 382 GGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMG 441
           GG+YFMFLIWGIIAALLVGF+IK VSPSVFLFF+MVAFNVGSIMASVTPVHETYFR Q+G
Sbjct: 371 GGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLG 430

Query: 442 TMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDP 501
           TMIILSFGMDLSFPASSIIFSD LPMEYQGMAGSLVNTVVNYSMSLCLGMGATVE Q++ 
Sbjct: 431 TMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNS 490

Query: 502 DGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAE 547
           DGKH+LKGYRGAQYLGIGLASLAC+ISGLYMVE +IK  RA+A AE
Sbjct: 491 DGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAE 536

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  838 bits (2165), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/530 (76%), Positives = 447/530 (84%), Gaps = 2/530 (0%)

Query: 15  VKTAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFK 74
           VK+A   +D  E ENE     + SS  +  E  +T  + T+  +E+   KQ+WQNPNYFK
Sbjct: 7   VKSAESRQDSFEAENESVSAVKKSSRHDGNEETVT--ISTDHGEEMTVDKQRWQNPNYFK 64

Query: 75  YPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFIL 134
             W EYLFIFTCMISQLLNQ+GTTQTLSIMNI+A+SFGS+ NSR+WLMASFPLVSGSFIL
Sbjct: 65  NSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFIL 124

Query: 135 ISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVL 194
           ISGR+GDI+GLK ML IGYV+IIIWSLICGLTKYSGSDTFFI+SRAFQGLGIAFVLPNVL
Sbjct: 125 ISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVL 184

Query: 195 GIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVI 254
           GIIGN+YV GTFRKNIVIS +GAMAP+GATLGC FAGLIGT NP QWPWAFYAYTIT++I
Sbjct: 185 GIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSII 244

Query: 255 NLILSIYAIPNNIPTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXX 314
           NL LS+Y+IPNNIPTN+  FSMDWIGS             WNQAPISGW+QAY       
Sbjct: 245 NLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIVLLVI 304

Query: 315 XXXXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIR 374
                     YE  FAKSPLLP+AV+KDRHMIQIML+LFFGWGSFGIFTFYYFQFQLNIR
Sbjct: 305 SVVFLVVFIIYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIR 364

Query: 375 HYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHET 434
           HY+ +WAGG+YFMFLIWGIIAALLVG  IK+VSPSVFLF +M+AFN+GSIMASVTPVHET
Sbjct: 365 HYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHET 424

Query: 435 YFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGAT 494
           YFR Q+GTMIILSFGMD SFPASSIIFSD LPMEYQGMAGSLVNTVVNYSMSLCLGMGAT
Sbjct: 425 YFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGAT 484

Query: 495 VEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKA 544
           VE  +DPDGKH+LKGYRGAQYLGIGLASLACIISGLYMVE  IKDH+AKA
Sbjct: 485 VETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKA 534

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/536 (59%), Positives = 387/536 (72%), Gaps = 2/536 (0%)

Query: 20  KEEDYLEIENEVALEAEDSS--PRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPW 77
           +EE  +       +E E SS     N E +   +  +  ED  +    KWQNP+YF+  W
Sbjct: 14  EEEKEITQSTSSIIEEECSSITKEENNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKW 73

Query: 78  QEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISG 137
           QEYLFIF+CM+SQLLNQ+ T QTLSIMNI+ DSF S+    +WL+ASFPLVSGSFILISG
Sbjct: 74  QEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISG 133

Query: 138 RMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGII 197
           R+GDI+GLK  L+ GY+  IIWSLI G T YS +D FFI+SRAFQGLGIAF+LPNV+GI+
Sbjct: 134 RIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIV 193

Query: 198 GNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLI 257
           GN+Y   T RKNIVIS IGA APIGA +G  FAGLIGT NP QWPWAFYA+ I + INL 
Sbjct: 194 GNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAINLA 253

Query: 258 LSIYAIPNNIPTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXXXX 317
           +SIY+IPNNIPTN+H F+MDWIGS             WNQ PI GW +AY          
Sbjct: 254 ISIYSIPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIISII 313

Query: 318 XXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYT 377
                  YEI +AKSP+LP  V K+RH+I I+ +LF GWGSFGIF+FYYF F LN+RHY+
Sbjct: 314 ALVLFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYS 373

Query: 378 PLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFR 437
            LWAG +YFMF IWG +AA++VG  IKR+S SV LFF+M+AFN+G IM SVTPV +TYFR
Sbjct: 374 ALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFR 433

Query: 438 MQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEM 497
           M +GTMIILSFGMD+SFPA++II SD L M+YQGMAGSL NT+VNYSMSLCLGMG TVE 
Sbjct: 434 MNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVER 493

Query: 498 QLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAEDKRSMS 553
           Q++  GK ILKGYR A+YLG+GLA L  +ISG+YM E      + +  +     MS
Sbjct: 494 QINKSGKEILKGYRAAEYLGVGLAGLGIVISGIYMAEVLWAKRKERLSSNRDHDMS 549

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/495 (62%), Positives = 377/495 (76%), Gaps = 4/495 (0%)

Query: 57  EDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDAN 116
           + + +   QKWQNP YF    +EYLF+ +C +SQLLNQ+G  QT  IMNI+ADS  S   
Sbjct: 40  DTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNG 99

Query: 117 SRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFI 176
            ++WLMA+FPL+SGSFILISGR+GDI+GLK  LL+GY+ +I+WSLICGLTKY+ SD+FFI
Sbjct: 100 KQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFI 159

Query: 177 VSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTM 236
           VSRAFQGLGI+ +LPN+LGI+G++Y+ G+ RKN+VIS IG MAPIGATLG  F+GLIGT 
Sbjct: 160 VSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTE 219

Query: 237 NPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFSMDWIGSXXXXXXXXXXXXXWN 296
           + NQWPWAFY+Y ITA IN +LSI+ IPN IPTNVH   MDWIGS             WN
Sbjct: 220 DANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWN 279

Query: 297 QAPISGWNQAYXXXXXXXXXXXXXXXXXYEIHFAK-SPLLPQAVMKDRHMIQIMLSLFFG 355
           QAPI GW+ AY                 YE+HF   +PLLP+ V+K    I ++ +LFFG
Sbjct: 280 QAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALFFG 339

Query: 356 WGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFA 415
           WGSFGIF+FYYF FQLN+RHYTPLWAGG+YFMFLIWGI+AAL+VGF+IK+V PS+ LF +
Sbjct: 340 WGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLS 399

Query: 416 MVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGS 475
           MVAFN GSI+ SVTP+H+TYFR  +G MIILSFGMDLSFPASSI+ SD LP++YQGMAGS
Sbjct: 400 MVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGS 459

Query: 476 LVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVEC 535
           LVNT+VNYSMS CLG+   VE  ++  GK +LKGYRGA YLGIGLAS+ACIISG  M+  
Sbjct: 460 LVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACIISGALMLSE 519

Query: 536 YI---KDHRAKAVAE 547
            I   K+ +  AV E
Sbjct: 520 IIQGRKNEKDSAVVE 534

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/528 (56%), Positives = 390/528 (73%), Gaps = 7/528 (1%)

Query: 26  EIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFT 85
           E+ +   +E  DS    +     T +  T+          KWQ+  YF+  WQEY+F+ T
Sbjct: 22  EVSSGWTVENTDSDKLGSGNETSTHVATTDPN-------CKWQDTTYFQNRWQEYIFVGT 74

Query: 86  CMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGL 145
           CM+SQLLNQ+   QTLS+MNIL  SF S+A +++WLMASFPLVSGSFILISGR+GDI+GL
Sbjct: 75  CMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGL 134

Query: 146 KNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGT 205
           K  L+ G +  IIW+LI G T Y+ SDTFFIVSR+FQGLG+AF+LPNV+G +GN+Y   T
Sbjct: 135 KWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNT 194

Query: 206 FRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPN 265
           FRKNIVIS IGA AP+GA +G FFAGLIGT NP+ WPW+FYA  I + + L+ ++Y+IPN
Sbjct: 195 FRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPN 254

Query: 266 NIPTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXXXXXXXXXXXY 325
           +IPTNVH FSMDWIGS             WNQ PI GW +AY                 Y
Sbjct: 255 HIPTNVHGFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYIIVLLIVSVFVLTLFFIY 314

Query: 326 EIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSY 385
           E+H+A SPLLP+ + ++RHM+ I+++LF GWGSFGIF+FYYF F LN+RHY+ +WAGG+Y
Sbjct: 315 EVHYAASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTY 374

Query: 386 FMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMII 445
           FMF IWG++A+++VG SI+++S S+ LFF+M+AF+VG IM SVTPV +TYFRM +GTMII
Sbjct: 375 FMFAIWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMII 434

Query: 446 LSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKH 505
           LSFGMD+SFPA++II SD LP +YQGMAGSL NT+VNYSMSLCLGMG+TVE Q++ +GK 
Sbjct: 435 LSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKD 494

Query: 506 ILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAEDKRSMS 553
           +LKGYR A+YLGIG+ASLA I+S +YM E    D + +  +  + ++S
Sbjct: 495 LLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDRKERMESTSETNLS 542

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/515 (59%), Positives = 379/515 (73%), Gaps = 5/515 (0%)

Query: 36  EDSSPRNNKEGALTTIVLTNSEDEVMKTKQKW---QNPNYFKYPWQEYLFIFTCMISQLL 92
           E  S ++ + G  +    T   D V    +KW   Q+P YF  PW+EYLFIF  M+SQLL
Sbjct: 8   ESVSSQSKELGTQSATAFTEHSD-VQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLL 66

Query: 93  NQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIG 152
           NQ+GTTQTLS++NIL+ +F S  + ++WLMASFPLVSGSFIL+SG++GDI+GLK  LL+G
Sbjct: 67  NQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVG 126

Query: 153 YVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVI 212
           YV+ IIWSLICGLT Y+ S  FFI+SRAFQGLGIAF+LPN++GI+GN+YV GT RKN+VI
Sbjct: 127 YVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVI 186

Query: 213 SFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVH 272
           S IGA APIGAT+G  F+GLIGT++  +W W FYAYTITA IN+ LSI+ IPN IPTNV 
Sbjct: 187 SLIGACAPIGATMGVLFSGLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVR 245

Query: 273 RFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIHFAKS 332
             SMDWIGS             WNQ PI GW+ AY                 YE  +A  
Sbjct: 246 GSSMDWIGSGIGLLGMILFNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETKYAND 305

Query: 333 PLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWG 392
           PL+P+  M +  ++  +L++FFGWGSFGI+TFYYF F LN+R YTPLWAGGSYFMFLIWG
Sbjct: 306 PLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWG 365

Query: 393 IIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDL 452
           IIAA+ VG++IKR+ PS+ LF +M+AF+ G IM SVTPV +TYFRM +G MIILSFGMDL
Sbjct: 366 IIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDL 425

Query: 453 SFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYRG 512
           SFPASSII SD LPME QGMAGSLV+T++NYSMS+CLG+  TVE Q++ +G  +LKGYR 
Sbjct: 426 SFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRA 485

Query: 513 AQYLGIGLASLACIISGLYMVECYIKDHRAKAVAE 547
           A YLGIGLASL   IS L+M+E Y++  R     E
Sbjct: 486 ALYLGIGLASLGVFISALFMLENYLRMRRRNVKEE 520

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/536 (58%), Positives = 388/536 (72%), Gaps = 5/536 (0%)

Query: 16  KTAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKY 75
           + + + E+ +E     ++  E S  ++     +   V++ +E   ++   KWQNP+YF+ 
Sbjct: 7   RKSHRSEEIME-SAASSITEETSIIKHGDIEEIEKDVISQTETPQLE-HSKWQNPDYFQN 64

Query: 76  PWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILI 135
            WQEYLFIF+CM+SQLLNQ+ T QTLSIMNI+ DSF S+    +WL+ASFPLVSGSFILI
Sbjct: 65  QWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILI 124

Query: 136 SGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLG 195
           SGR+GDI+GLK  L+ GY+  IIWS+I GLTKYS SDTFFIVSRAFQGL IAF+LPNV+G
Sbjct: 125 SGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMG 184

Query: 196 IIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVIN 255
           I+GN+Y   + RKNIVIS IGA APIGA  G  FAGLIGT +P+QWPWAFYA+ I +  N
Sbjct: 185 IVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFN 244

Query: 256 LILSIYAIPNNIPTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXX 315
           L +SIY+IPN++PTNVH F+MDWIGS             WNQ PI GW  AY        
Sbjct: 245 LAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIALLVVS 304

Query: 316 XXXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRH 375
                    YE+ +A+SPLLP  V K+RH+I I+ +LF GWGSFGIF+FYYF F LN+RH
Sbjct: 305 VFFLALFFTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRH 364

Query: 376 YTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETY 435
           Y+ LWAG +YFMF IWG +AA++VG  IK++S +  LF +MVAFN+G IM SVTPV +TY
Sbjct: 365 YSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTY 424

Query: 436 FRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATV 495
           FRM +GTMIILSFGMD+SFPA++II SD L M+YQGMAGSL NT+VNYSMSLCLGMG TV
Sbjct: 425 FRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTV 484

Query: 496 EMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECY---IKDHRAKAVAED 548
           E Q++  G  +LKGYRGA+YLGIGLA L  II+ +Y+ E      K H A  V  D
Sbjct: 485 ERQINKSGNDLLKGYRGAEYLGIGLAGLGIIITAIYLGEILWGKRKQHLAANVVPD 540

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/530 (56%), Positives = 386/530 (72%), Gaps = 2/530 (0%)

Query: 14  EVKTAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYF 73
           E K   + +D   I+ +++++AED    ++++  +TT+  +N   +V      WQ+P YF
Sbjct: 6   EEKVNVQSKDSPVID-KISMKAEDKVVVSSEDEDVTTVASSNKSTQV-SNDSPWQDPTYF 63

Query: 74  KYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFI 133
               +E +FI TCM++QLLNQ+G T  L+IMN+L+ SF S+++ ++WLMASFPLV+GSFI
Sbjct: 64  SSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFI 123

Query: 134 LISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNV 193
           LISGR+GDI+GLK ML+IGYV II+WSLICGL+KYS +D FFI  RAFQGLGIAF+LPNV
Sbjct: 124 LISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNV 183

Query: 194 LGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAV 253
           +G++G+VY  G+ RKN+VISFIGA AP G   G  F GLI   +  QWPW FYA+ I   
Sbjct: 184 MGLVGHVYKVGSTRKNLVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAIAFF 243

Query: 254 INLILSIYAIPNNIPTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXX 313
           +N+IL+ Y+IPNNIPTNVH FSMDW GS             WNQAP +GW  AY      
Sbjct: 244 LNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLI 303

Query: 314 XXXXXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNI 373
                      YE+ +AK PLLP AV K+RHMI I+L++F GWGSFGI+TFYY  FQLN+
Sbjct: 304 ISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNL 363

Query: 374 RHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHE 433
           RHY+P+W GG+YF+F+I+G IAA +V  SIKRV P+  L FA+VAF+VGSIM SV PV +
Sbjct: 364 RHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQ 423

Query: 434 TYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGA 493
           +++++  G   IL FGMDLSFPASSII SD LPMEYQGMAGSLVNTV+NYS SLCLGMGA
Sbjct: 424 SFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGA 483

Query: 494 TVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAK 543
           TVE Q++ +GK +LKGYRGA YLG+GLASL  +IS  YM+E +  + R +
Sbjct: 484 TVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDR 533

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/514 (55%), Positives = 361/514 (70%), Gaps = 1/514 (0%)

Query: 22  EDYLEIENEVALEAEDSSPRNNKEGALT-TIVLTNSEDEVMKTKQKWQNPNYFKYPWQEY 80
            D++ I  E      D +    K+   T +     SE E       WQNP YF   WQEY
Sbjct: 16  RDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEY 75

Query: 81  LFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMG 140
            FI TCM++QLLNQ+G  Q  + MNILAD+F S A  ++WLMASFPLVSGSFIL+SGR+G
Sbjct: 76  AFISTCMLAQLLNQAGQAQATAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIG 135

Query: 141 DIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNV 200
           DI+GLK  L+ GY++++IWSLICG   Y+ +D FFI+ RAFQGLGIAF+LPNV+G+IGN+
Sbjct: 136 DIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNI 195

Query: 201 YVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSI 260
           Y   T RKN VISF+G  APIGA LG  ++GLI   NP QWPW FYAY I   IN++++I
Sbjct: 196 YKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAI 255

Query: 261 YAIPNNIPTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXXXXXXX 320
           Y+IP+ +PTN+H F MDW GS             WNQ PI GWN+ Y             
Sbjct: 256 YSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLI 315

Query: 321 XXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLW 380
               YEI FAKSPLLP  V+K+RH+  I+L++F GWGSFGI+TFYY+ FQLN+RHY+ +W
Sbjct: 316 AFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVW 375

Query: 381 AGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQM 440
           AGG++FMF+IWG IAA LV  +IKRV PSV L F+M  F VG IM SVTPVH++Y++M +
Sbjct: 376 AGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNL 435

Query: 441 GTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLD 500
           G  IILSFGMDLSFPASSII SD+LP +YQGMAGSLVNT+VNYS SLCLG+G+T E Q++
Sbjct: 436 GMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVN 495

Query: 501 PDGKHILKGYRGAQYLGIGLASLACIISGLYMVE 534
            +G   LKGYR A Y+GIGL +   +++  Y+ E
Sbjct: 496 KNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFE 529

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/526 (53%), Positives = 376/526 (71%), Gaps = 7/526 (1%)

Query: 28  ENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCM 87
            + V+   ED +  +N++      V +NS D V+     WQNPNYF   ++EY FIFTCM
Sbjct: 16  SSTVSFPNEDKNISHNEKE-----VYSNSTDSVLDDDSPWQNPNYFSSKYKEYFFIFTCM 70

Query: 88  ISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKN 147
           ++ LLNQ+G TQ LS MN++++SF SD+  ++WLMASFPLVSGSFILISGR+GDI+GLK 
Sbjct: 71  VANLLNQAGQTQVLSTMNVISESFHSDSGKQTWLMASFPLVSGSFILISGRIGDIYGLKK 130

Query: 148 MLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFR 207
            ++ GY+ +IIWSL+CG   ++ +DTFFIV RAFQGLGI+F+LPNV+G+IGN+Y  GT R
Sbjct: 131 TMIGGYIFMIIWSLLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLR 190

Query: 208 KNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNNI 267
           KNIVIS IG  AP GA +G  + GLI T N  QWPW FYAY +T ++NLI+++Y++PN I
Sbjct: 191 KNIVISMIGLTAPTGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSVPNCI 250

Query: 268 PTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEI 327
           PTNVH F+MDWIGS             WNQ P++GW++AY                 YE+
Sbjct: 251 PTNVHNFAMDWIGSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFVVYEL 310

Query: 328 HFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFM 387
            +  SPLLP  V K+  ++ I+  LF GWG+FGI+TFYYF FQLN+R Y+P+W GG+YFM
Sbjct: 311 KYPISPLLPVEVTKNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTYFM 370

Query: 388 FLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILS 447
           F+IWG IAAL+V F+IK+V P++ LFF+ + F +GS+M SVTP+H+ Y+RM +G  IIL 
Sbjct: 371 FIIWGTIAALIVAFTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQIILC 430

Query: 448 FGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHIL 507
           FGMDLSFPASSII SD+LPM+YQGMAGSLVNTV+NY+ SLCLGMG TVE Q++  G+ +L
Sbjct: 431 FGMDLSFPASSIILSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSGEDLL 490

Query: 508 KGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAEDKRSMS 553
           KGYR A YL +GL  L   I+  ++  CY    + +    D +S+S
Sbjct: 491 KGYRSALYLAVGLGGLGSCIA--FINLCYTLWMKRRDRLADLKSVS 534

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/534 (54%), Positives = 386/534 (72%), Gaps = 5/534 (0%)

Query: 16  KTAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKY 75
           KT+ +  D  EI+ ++ ++A+D    + ++  +TTIV +    +V      WQ+P YF  
Sbjct: 8   KTSVQGTDS-EIDEKITVKAKDKVVVSTEDEEVTTIVSSTKSTQV-TNDSPWQDPTYFSS 65

Query: 76  PWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILI 135
             +E +FI TCM++QLLNQ+G T  L IMN+L+ SF S+AN+++WLMASFPL +GSFILI
Sbjct: 66  FGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILI 125

Query: 136 SGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLG 195
           SGR+GDI+GLK ML++GYV++I+WS+I GL+KYS SD FFI SRAFQG+GIAF+LPN++G
Sbjct: 126 SGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMG 185

Query: 196 IIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVIN 255
           ++G+VY  G+FRKNIVISFIGA AP G   G  F GLI T +PNQWPW FYA+ I   ++
Sbjct: 186 LVGHVYKVGSFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGIATFLS 245

Query: 256 LILSIYAIPNNIPTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXX 315
           L+++ Y+IPNN+PTN+H  SMDW GS             WNQAPI GW++ Y        
Sbjct: 246 LLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIVLLIIS 305

Query: 316 XXXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRH 375
                    YE  +A+ PLLP+A+ K+RHMI I+L++F GWGSFGI+TFYY  FQLN+RH
Sbjct: 306 VIFLVAFFVYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRH 365

Query: 376 YTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETY 435
           Y+P+W GG+YF+F+I+G +AA  V FSIKR+ P++ L F+++AF+ GSIM SV PV ++Y
Sbjct: 366 YSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVEQSY 425

Query: 436 FRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATV 495
           +++      IL FGMDLSFPASSII SD LPM+YQGMAGSLVNTV+NYS SLCLGMG TV
Sbjct: 426 WKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGGTV 485

Query: 496 EMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAEDK 549
           E Q++  G  +LKGYR A YLG+GLASL  +IS  YM+E     HR    +ED+
Sbjct: 486 EHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRK---SEDR 536

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/518 (54%), Positives = 372/518 (71%), Gaps = 9/518 (1%)

Query: 26  EIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFT 85
           E ++E   E   SS    +E         + + E +  K + QNP+YF  PW+EY+F+ +
Sbjct: 5   ENDDEENWEKLQSSSAAGEE--------RDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLS 56

Query: 86  CMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGL 145
            M+SQLLNQ+ TTQT  + ++L+    +  + + WLMASFPLVSGSFIL+SG++GDI+GL
Sbjct: 57  SMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGL 116

Query: 146 KNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGT 205
           K  LL GYV+++IWSLICGL+ Y+ +  FF+V+R+FQGLGIAFVLPNV+GI+GN+Y   T
Sbjct: 117 KKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNT 176

Query: 206 FRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPN 265
             KN+V S IGA APIGATLGC F+GLIG    + W W FYAY ITA +N +++++ IPN
Sbjct: 177 EAKNLVFSLIGACAPIGATLGCVFSGLIGA-RTDLWGWTFYAYAITAALNGLVALWIIPN 235

Query: 266 NIPTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXXXXXXXXXXXY 325
           NIPTNV+ + MDWIGS             WNQAPI+GW  AY                 Y
Sbjct: 236 NIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFITY 295

Query: 326 EIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSY 385
           EI FAK PLLP +V+ +R ++ I+ SLFFGWGSFGI+TFYY  F LN+RHY+PLWAGG+Y
Sbjct: 296 EIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTY 355

Query: 386 FMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMII 445
           FMF IWGI+A+LLVG++I +  P+V LF +MVAF+ G IM +VTPVH+TYFRM +G MII
Sbjct: 356 FMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMII 415

Query: 446 LSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKH 505
           LSFGMDLSFPA+SII SD LP +YQGMAGSLV+T+++YSMSLCLG+  T E Q++ +G  
Sbjct: 416 LSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGID 475

Query: 506 ILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAK 543
           +LKGY+ A Y+GIGLASL  +ISG +M+E +    R +
Sbjct: 476 LLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRKR 513

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/515 (56%), Positives = 379/515 (73%), Gaps = 1/515 (0%)

Query: 34  EAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLN 93
            + D    N+ + ++T+     S D+  +    +QNP YF+  ++E +FI +CM++QLLN
Sbjct: 40  SSSDECQSNSDQLSVTSKGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLN 99

Query: 94  QSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGY 153
           Q+G TQ+LS MN+LAD F S+++ + WLMASFPLVSGSFILISGR+GDI+GLK  L +GY
Sbjct: 100 QAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGY 159

Query: 154 VMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVIS 213
           +++ +WS+ICGL KY+ SD FFIV R+FQGLGIAF+LPN++G++GN+Y  GT RKNIVIS
Sbjct: 160 IIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVIS 219

Query: 214 FIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVHR 273
            IG MAP GA LG  F GLI T +  QWPW FYA+ I + +N++L++Y+IPNN+PTN++ 
Sbjct: 220 CIGCMAPAGAALGALFGGLIVTEDAEQWPWVFYAFGIASFVNMLLALYSIPNNVPTNLNN 279

Query: 274 FSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIHFAKSP 333
            +MDWIGS             WNQAPI GW +AY                 YEI +A SP
Sbjct: 280 LNMDWIGSLLGVSGLLLLNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIKYATSP 339

Query: 334 LLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGI 393
           LLP +V++++ ++ I+ +LFFGWGSFGI+T+YY+ FQLN+R YTPLWAGG++FMF+IWG 
Sbjct: 340 LLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGT 399

Query: 394 IAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDLS 453
           +AA +V  +IK+V P+V L F+MVAF+ GSIM SVTPVH+TY+RM +G  IILSFGMDLS
Sbjct: 400 VAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLS 459

Query: 454 FPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYRGA 513
           FPASSII SD+LPM+YQGMAGSLVNTVVNYS SLCLGMG TVE Q +  G  +LKGYR A
Sbjct: 460 FPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSA 519

Query: 514 QYLGIGLASLACIISGLYMVECYI-KDHRAKAVAE 547
            YL IGLAS    +S +++V   I K HR +  +E
Sbjct: 520 LYLAIGLASAGVCVSLVFLVTDIIAKRHRKRIESE 554

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/553 (53%), Positives = 378/553 (68%), Gaps = 6/553 (1%)

Query: 7   ECVIQNPEVKTAGKEEDYLEIENEV-----ALEAEDSSPRNNKEGALTTIVLTNSEDEVM 61
           E +  +  + +A  E+   ++   V      L  + S+  + K  A++    T+ + E  
Sbjct: 3   EIISSDNSITSASGEQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKF 62

Query: 62  KTKQK-WQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSW 120
                 WQNP+YF   W+EYLFI TCM+S LLNQ+G TQ  S MN++  +F +D++S++W
Sbjct: 63  SDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTW 122

Query: 121 LMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRA 180
           LMASFPLVSGSFIL+SGR+GDI+GLK  ++ G +++IIWSLICG   YS S TFFI+ RA
Sbjct: 123 LMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRA 182

Query: 181 FQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQ 240
           FQGLGIAFVLPNV+G++GN+Y  G+ RKNIVIS IG  AP GA  G F+AGLI T    Q
Sbjct: 183 FQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQ 242

Query: 241 WPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPI 300
           WPW FYAY    ++NL+L+IY+IP+ +P NVH FSMDW GS             WN+API
Sbjct: 243 WPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPI 302

Query: 301 SGWNQAYXXXXXXXXXXXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFG 360
            GW +AY                 YEI FAKSPLLPQAV  + ++I I+ ++F GWGSFG
Sbjct: 303 VGWEKAYIIVLLIFSLLIIVVFFIYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFG 362

Query: 361 IFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFN 420
           I+TFYY+ F LN+R YTPL AG S+ MF++WG IAA  V F+IKRV PSV LF +MVAF 
Sbjct: 363 IWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFT 422

Query: 421 VGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTV 480
           VGSIM S+TPVH+TY++M  G  IIL+FGMDLSFPASSII SD LPMEYQGMAGSLVNT+
Sbjct: 423 VGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTI 482

Query: 481 VNYSMSLCLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDH 540
           VNYS SLCLGMG T E+Q++ +G  +LKGYR A Y+GIGL  +  II+ L++ E   +  
Sbjct: 483 VNYSTSLCLGMGTTAEIQVNKNGTDLLKGYRAALYVGIGLGVVGVIIAALFLFESLRQKR 542

Query: 541 RAKAVAEDKRSMS 553
              A    K+ MS
Sbjct: 543 GRTAALTAKKDMS 555

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/500 (55%), Positives = 364/500 (72%), Gaps = 2/500 (0%)

Query: 54  TNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGS 113
           T S D +++    WQN  YF+   +EY FIFTCM + LLNQ+G TQ LS MN++++SF S
Sbjct: 15  TLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHS 74

Query: 114 DANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDT 173
           D  +++WLMASFPLVSGSFILISGR+GDI+GLK  ++ GY+ +IIW+L+CG   Y+ SDT
Sbjct: 75  DVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDT 134

Query: 174 FFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLI 233
           FFIV RAFQGLGI+F+LPN++G++GN+Y  GT RKNIVIS IG  AP GA +G  + GLI
Sbjct: 135 FFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLI 194

Query: 234 GTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFSMDWIGSXXXXXXXXXXXX 293
            T +  QWPW FYAY + A +NLI++IY++P N+PTNVH F+MDW+G+            
Sbjct: 195 ATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGVVGLILFNF 254

Query: 294 XWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLF 353
            WNQ P++GW + Y                 YE+ F  SPLLP+ V K+  ++ I+  LF
Sbjct: 255 VWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREVTKNGQILTILGILF 314

Query: 354 FGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLF 413
            GWGSFGI+TFYY+ FQLN+R+Y+PLWAG ++FMF+IWG IAA +VGF+I RV P+V LF
Sbjct: 315 LGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPAVLLF 374

Query: 414 FAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMA 473
           F+ + F +GS+M SVTP+H+TY+RM +G  IILSFGMDLSFPASSII SD+LPM+YQGMA
Sbjct: 375 FSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMA 434

Query: 474 GSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMV 533
           GSLVNT++NYS SLCLGMG TVE Q++  G+ +L+GYR A YL +GL  L   ++ L + 
Sbjct: 435 GSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAVGLGGLGACVAFLNL- 493

Query: 534 ECYIKDHRAKAVAEDKRSMS 553
            CY    + K+  +D RS++
Sbjct: 494 -CYDLWRKRKSRLDDIRSLN 512

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/515 (55%), Positives = 377/515 (73%), Gaps = 2/515 (0%)

Query: 27  IENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTC 86
           + ++++++ ED    +  E    T V ++S+   +     WQ+P YF    +E +FI TC
Sbjct: 18  VNDKISMKEEDKVIVSTDEE--VTTVASSSKSNQISNDSPWQDPTYFSSFGKELMFIGTC 75

Query: 87  MISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLK 146
           M++QLLNQ+G T  L IMN+L+ SFGS++N+++WLMASFPL +GSFILISGR+GDI+GLK
Sbjct: 76  MLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLK 135

Query: 147 NMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTF 206
            ML+IGYV+II+WS+I GL+KYS +D+FFI  RAFQG+GIAF+LPN++G++G+VY  G+ 
Sbjct: 136 KMLMIGYVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSL 195

Query: 207 RKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNN 266
           RKN+VIS IGA  P GA  G  F GLI T +PNQWPW FYA+ I   I+++++ Y+IPNN
Sbjct: 196 RKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNN 255

Query: 267 IPTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYE 326
           +PTNVH  SMDW GS             WN+API+GW++AY                 YE
Sbjct: 256 VPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIVLLVVSVFFLVAFFVYE 315

Query: 327 IHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYF 386
           I +A+ PLLP AV K+RHMI I+L++F GWGSFGI+TFYY  FQLN+RHY+P+W GG+YF
Sbjct: 316 IKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYF 375

Query: 387 MFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIIL 446
           +F I+G IAA  V FSIKR+ P++ L FA++AF+ GSIM SV PV ++Y+++      +L
Sbjct: 376 VFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVL 435

Query: 447 SFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHI 506
            FGMDLSFPASSII SD LPM+YQGMAGSLVNTV+NYS SLCLGMGATVE Q++  GK++
Sbjct: 436 CFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNV 495

Query: 507 LKGYRGAQYLGIGLASLACIISGLYMVECYIKDHR 541
           L+GYR A YLGIGLASL  +IS  YM+E    + +
Sbjct: 496 LEGYRAAVYLGIGLASLGVLISVTYMLETVWNERK 530

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/535 (55%), Positives = 386/535 (72%), Gaps = 5/535 (0%)

Query: 16  KTAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKY 75
           K + +  DY +I ++  ++ +D    + ++  +TT+  +N  ++V      WQ+P YF  
Sbjct: 8   KMSVQGTDY-QIHDKTIMKVDDKVVISTEDEEVTTVTSSNESNQV-TNDSPWQDPIYFSS 65

Query: 76  PWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILI 135
             +E +FI TCM++QLLNQ+G T  L IMN+L+ SF S++N+++WLMASFPL +GSFILI
Sbjct: 66  FGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILI 125

Query: 136 SGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLG 195
           SGR+GDI+GLK MLLIGYV+IIIWS+I GL+KYS SD FFI  RAFQGLGIAF+LPN++G
Sbjct: 126 SGRLGDIYGLKKMLLIGYVIIIIWSIISGLSKYSNSDAFFITCRAFQGLGIAFILPNIMG 185

Query: 196 IIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVIN 255
           ++G+VY  G+ RKN+VIS IGA AP G   G  F GLI T +P QWPW FYA++I   I+
Sbjct: 186 LVGHVYKVGSLRKNLVISVIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAFSIATFIS 245

Query: 256 LILSIYAIPNNIPTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXX 315
           L+++ Y+IPNN+PTNVH  SMDW GS             WNQAPI+GW +AY        
Sbjct: 246 LLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYIIVLLILS 305

Query: 316 XXXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRH 375
                    YEI +A+ PLLP AV K+RHMI I+L++F GWGSFGI+TFYY  FQLN+RH
Sbjct: 306 VFFLIAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRH 365

Query: 376 YTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETY 435
           Y+P+W GG+YF+F+I+G IAA  V FSIKR+ P++ L FA++AF+ GSIM SV PV ++Y
Sbjct: 366 YSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPVEQSY 425

Query: 436 FRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATV 495
           +++      IL FGMDLSFPASSII SD LPM+YQGMAGSLVNTV+NYS SLCLGMG TV
Sbjct: 426 WKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGVTV 485

Query: 496 EMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAEDKR 550
           E Q++  G+++LKGYR A YLGIGLASL  +IS  YM+E +   H+    +E KR
Sbjct: 486 ERQINKSGQNLLKGYRAAIYLGIGLASLGLLISVTYMLENFWNKHKE---SEKKR 537

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/516 (54%), Positives = 368/516 (71%), Gaps = 4/516 (0%)

Query: 33  LEAEDSSPRNNKEGA-LTTIVLTNSEDE--VMKTKQKWQNPNYFKYPWQEYLFIFTCMIS 89
           + +E +     + G+ ++  V+ N ED   ++ ++ + QNP+YF   W+EYLF+ + M+S
Sbjct: 1   MNSEYTPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLS 60

Query: 90  QLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNML 149
           QLLNQ+   Q   + ++L++   + A+ ++WLMASFPLVSGSFIL+SG++GDI+GLK  L
Sbjct: 61  QLLNQAAALQANPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTL 120

Query: 150 LIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKN 209
           L GY +++IWSLICGL+ Y+ +  FFIV+R+FQGLGIAFVLPNV GI+GN+Y   T  KN
Sbjct: 121 LGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKN 180

Query: 210 IVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPT 269
           +V S IGA APIGATLGC F+GLIGT     W W FYAYTI A +N +++ Y IP+NIPT
Sbjct: 181 MVFSMIGACAPIGATLGCLFSGLIGT-ESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPT 239

Query: 270 NVHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIHF 329
           NVH+F MDW+GS             WNQAP  GW+ AY                 +E  F
Sbjct: 240 NVHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARF 299

Query: 330 AKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFL 389
           AK PLLP+AV+ +R ++ I+ SLF GWGSFGI+T+YY  F LN+RHYTPLWAGGSYFMF 
Sbjct: 300 AKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFA 359

Query: 390 IWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFG 449
           I+G IAA LVG +I +  P++ L  +++AF+VG IM SVTPV +TYFRM +GTM+ILSFG
Sbjct: 360 IFGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFG 419

Query: 450 MDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKG 509
           MDLSFPASSII SD LP +YQGMAGSLVNT++NYSMSLCLG+  T E Q++ DG  +LKG
Sbjct: 420 MDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKG 479

Query: 510 YRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAV 545
           YR A Y+GIGLAS+   +SG Y +E +    R ++V
Sbjct: 480 YRAALYVGIGLASVGIFVSGAYAIEDWWTRRRERSV 515

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/533 (54%), Positives = 367/533 (68%), Gaps = 14/533 (2%)

Query: 17  TAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYP 76
           TA K     EIE    L  ED      KE  +           V + +  WQ+PNYFK  
Sbjct: 13  TALKSSHENEIERN--LSREDKMLTTEKEAPVF----------VEEPESPWQDPNYFKGK 60

Query: 77  WQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILIS 136
           W E LF+ +CM+ QLLNQ+G+T TLS M +L     S +   SWLMASFPLVSGSFILIS
Sbjct: 61  WDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDSSSAKSSWLMASFPLVSGSFILIS 120

Query: 137 GRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGI 196
           GR+GDI+GLK MLL+GY+ + IWSLICGL+ +S +DTFFI SRAFQGLGI+FVLPN+LGI
Sbjct: 121 GRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGI 180

Query: 197 IGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINL 256
           +GN+Y  GT RKNIVIS IG  APIGAT G  FAG++     + WPWAFYAYTI A +  
Sbjct: 181 VGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTT 240

Query: 257 ILSIYAIPNNIPTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXXX 316
           I+S + IPN+IP NV++F+MDWIGS             WNQ+ + GW   Y         
Sbjct: 241 IISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYIIALLIVSI 300

Query: 317 XXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHY 376
                   +EI +AK PLLP+ V + R +I I+ SL  GWGSFGI+ FYYFQF L +R+Y
Sbjct: 301 FLIALFFIFEIKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNY 360

Query: 377 TPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYF 436
           +P+WAGG++FM  I G IAAL VGFSIKRV P+V LFF+M+AF  GSI+ SVTPVHETYF
Sbjct: 361 SPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYF 420

Query: 437 RMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVE 496
           R  +G M+ILSFGMDLSFPA+SII SD L M+YQGMAGSLVNTVVNYSMSL LG+G T+E
Sbjct: 421 RSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIE 480

Query: 497 MQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAEDK 549
            Q++  G  +L+G+R A Y  IG+ SL  +ISG+++++  +   R+K+  E++
Sbjct: 481 RQINKSGDRLLEGFRAALYFAIGVGSLGILISGVFVLQKEL--MRSKSRKENE 531

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/493 (57%), Positives = 359/493 (72%), Gaps = 4/493 (0%)

Query: 55  NSEDEVMKTKQK-WQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGS 113
           N E   M+ K    +NP+YF    QEY FIF+CM+SQLLN +GTTQTLSIMN+L     S
Sbjct: 29  NDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHS 88

Query: 114 DANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDT 173
             + + WL+ASFPLVSGSFIL+SGR+GDI+GLK ML++GYV+++IWSLI GL+ YS S  
Sbjct: 89  SDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGI 148

Query: 174 FFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLI 233
           FFI++RAFQGLGI+ VLPNVLG+IG +Y  GT +KN+VIS +GAM+PIGATLG  F+GL+
Sbjct: 149 FFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLV 208

Query: 234 GTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFSMDWIGSXXXXXXXXXXXX 293
            T +   WPWAFYAYT+ A IN  +S Y+IPNNIPTNV+R SMDWIGS            
Sbjct: 209 ATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNF 268

Query: 294 XWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLF 353
            WNQAP  GWN AY                 YE+ +A++PLLP  ++++R +I I+ ++ 
Sbjct: 269 VWNQAPADGWNSAYLIVLLVISVIALIAFGIYELRYAENPLLPSEIIRNRQLIMILTAMT 328

Query: 354 FGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLF 413
           FGWGSFGI+TFYYF F LN+R+Y+PLWAGGSYF+F+I G I A+  GF +K++ P+V L 
Sbjct: 329 FGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLT 388

Query: 414 FAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMA 473
           F+MV FN+G I+ SVTPVH+TYFR  +GTMIIL  GMDLSFPASSII SD LP ++QGMA
Sbjct: 389 FSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMA 448

Query: 474 GSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMV 533
           GSLVNTV+NYS SL LG+  TVE   + +G  +L+GYRGA Y GI  + +A +I+GLYMV
Sbjct: 449 GSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMV 508

Query: 534 ECYI---KDHRAK 543
           E      KD + K
Sbjct: 509 ETIFDSYKDRKEK 521

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/534 (52%), Positives = 372/534 (69%), Gaps = 5/534 (0%)

Query: 20  KEEDYLEIENEV-ALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQ 78
            E + LE ++ +    +E  +    ++  + +   T S   + +    WQNP+YF   ++
Sbjct: 15  NEANLLESQSTIDCTSSERKTAIKEQDDEIGSDSTTTSSSSLQENNSSWQNPDYFSSSFK 74

Query: 79  EYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGR 138
           EY+F+ TCMI+ LLNQ+G +Q LS MN+++DSF S    ++WLMASFPLVSGSFILISGR
Sbjct: 75  EYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGR 134

Query: 139 MGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIG 198
           +GDI+GLK M++ G++ +IIWSLICG T Y+ SDTFFIV+RAFQGLGI+F+LPNV+G++G
Sbjct: 135 LGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVG 194

Query: 199 NVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLIL 258
           N+Y  GT RKN+VIS IG MAP G+  G  + GLI T NP QWPW FYAY + A + L++
Sbjct: 195 NIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFYAYAVAAAVCLVM 254

Query: 259 SIYAIPNNIPTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXXXXX 318
             Y +P+NIPTNV+ F+MDWIGS             WNQ PI GW +AY           
Sbjct: 255 GYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYIIVLLIVSVIF 314

Query: 319 XXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTP 378
                 YEI +AK PLLP+AV ++ H++ I+  LF GWGSFGI+TFYYF FQLN+R Y+P
Sbjct: 315 LIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSP 374

Query: 379 LWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRM 438
           +W+GG++F+F+I+G +AA  V  +IK+V P++ LFF+ + F  GSI+ SVTPVH+TY+R 
Sbjct: 375 VWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRN 434

Query: 439 QMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQ 498
             G  IIL FGMDL FPASSII SDYLPM+YQGMA SLVNT+VNYS SLCLGMG TVE Q
Sbjct: 435 TFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQ 494

Query: 499 LDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAEDKRSM 552
           ++  G  +LKGYR A Y G+G+A L   I+  ++  C+  D  +K  A+D + +
Sbjct: 495 INKSGDDLLKGYRAALYFGVGIAGLGACIA--FLNVCH--DIWSKRNAKDPKDL 544

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/546 (50%), Positives = 377/546 (69%), Gaps = 11/546 (2%)

Query: 11  QNPEVKTAGK-----EEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQ 65
           +NP   T  +      ED    E + +L+  DS  R++   +LT ++ T++ D       
Sbjct: 6   ENPSDNTINEINYTNNEDCKNPEQQ-SLKNIDS--RSSLNSSLTQVLSTDTADN--DESS 60

Query: 66  KWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASF 125
            +QNP+YFK  +QE+ FIF+ MI QLL+Q+G TQTLSIMN+LA    S ++ ++WLM+SF
Sbjct: 61  SYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSF 120

Query: 126 PLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLG 185
           PL  GSFIL+SGR+GDI+GLK +LL GY++  +WS+ICGL+ Y+ +D FFI +RAFQGLG
Sbjct: 121 PLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLG 180

Query: 186 IAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAF 245
           +AF LPN++G+IG +Y  G FRKN++IS IGAM+P GATLG  FAGL    + + WPW+F
Sbjct: 181 LAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATLGGLFAGLTVKYDKSNWPWSF 240

Query: 246 YAYTITAVINLILSIYAIPNNIPTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQ 305
           YA+ + + +NLI+S Y IPN+IPTN+H   MDW+GS             +NQAPI GW  
Sbjct: 241 YAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQS 300

Query: 306 AYXXXXXXXXXXXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFY 365
           AY                 YE+ +AK+PL+P+A+  +R M+ I+ SLF GWGSFGI+TFY
Sbjct: 301 AYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFY 360

Query: 366 YFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIM 425
           YF F+LN+RHY+PLWAG SYF+F+I G   A++ G +IK++ PSV    +M+ F  G+I+
Sbjct: 361 YFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNII 420

Query: 426 ASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSM 485
            + TPV++T+FR  +G M +L  GMD SFPASSII SD LPM+YQGMAGSLVNTV+NYS 
Sbjct: 421 FAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYST 480

Query: 486 SLCLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAV 545
           S+CLGM  TVEM+ +  GK +L GYR A Y  IGLA LA  +SG YM+EC  KD R  ++
Sbjct: 481 SICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKD-RVLSL 539

Query: 546 AEDKRS 551
            E+K++
Sbjct: 540 EENKQT 545

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/538 (50%), Positives = 362/538 (67%)

Query: 14  EVKTAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYF 73
           ++K   +E++ +E      + A+ S    +       I +T+ +   +    KWQ+P YF
Sbjct: 8   KLKQQEEEKNPIEDFQTTTVTAQTSLDVLSDSVKKDQISITDDDVSSISNNSKWQDPTYF 67

Query: 74  KYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFI 133
           K  WQEY FI TCM++ LLNQ+G TQTLS MN+LADS  SD  +++WLMASF L SGSFI
Sbjct: 68  KSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFI 127

Query: 134 LISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNV 193
           L+SGR+GDI+GLK   + G ++  IWS++CG++KY+ + TFFI+ RAFQGLG+AFVLPNV
Sbjct: 128 LVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNV 187

Query: 194 LGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAV 253
           +G++GN+Y  G+ RKNIVISFIG MAP+G T G  + GLI   N +QWPW F+A  I   
Sbjct: 188 MGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVF 247

Query: 254 INLILSIYAIPNNIPTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXX 313
           INLI+ IY+IPN++PTN++   MDWIGS             WNQAPISGW++AY      
Sbjct: 248 INLIMGIYSIPNHVPTNIYNLKMDWIGSLLGVIGLILMNFVWNQAPISGWSKAYIIVILI 307

Query: 314 XXXXXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNI 373
                      YE+  A+SPLLP  V K+RH++ I++SLF GWG+FGI+TFYY+ F LN+
Sbjct: 308 VAVFFLVAFFIYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNL 367

Query: 374 RHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHE 433
           RH++PLWAG ++F+F+I+G + A+ V F+I +V PSV    + + F  G+I+ SVT   +
Sbjct: 368 RHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSPDQ 427

Query: 434 TYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGA 493
           TY+R  +G  IIL+ GMDLSFP SSII SD LPM+YQGM+GSLVNT+ NY+ SLCLGMG 
Sbjct: 428 TYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGT 487

Query: 494 TVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAEDKRS 551
           T E+Q +  GK +LKGYR A Y+ IGL +L    S  YM E     +R +   E K  
Sbjct: 488 TAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQNEKKED 545

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/511 (54%), Positives = 372/511 (72%), Gaps = 1/511 (0%)

Query: 34  EAEDSSPRNNKEGALTTIVLTNSEDEVM-KTKQKWQNPNYFKYPWQEYLFIFTCMISQLL 92
           E+  SS + + +  ++    +N + EV+ + K KWQ+P YFK  +QEYLF+ +CM +QLL
Sbjct: 3   ESRTSSIKEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLL 62

Query: 93  NQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIG 152
           NQ+ T QTLSIMN+L+DSF S  ++++WL+ASFPLV+GSFILISGR+GDI+GLK  L+ G
Sbjct: 63  NQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGG 122

Query: 153 YVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVI 212
           Y+ +IIWSLICG T YS SDTF I++RAFQGLGIAF LPNV+G IGN+Y  G+ RKN+VI
Sbjct: 123 YIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVI 182

Query: 213 SFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVH 272
           S I A AP+GA +G  FAGLI T +P+QWPW+FYA+ I    NL++SIY+IP+NIPTNV+
Sbjct: 183 SLIAASAPVGAAIGGAFAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVN 242

Query: 273 RFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIHFAKS 332
            F MDWIGS             WNQ PI GW+ AY                 YEI+FA S
Sbjct: 243 GFKMDWIGSALIVTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAPS 302

Query: 333 PLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWG 392
           PL+ + +   R+MI  + +LF GWGS+GI++FYYF F LN+RHY+P+WAGGSYF+F I+G
Sbjct: 303 PLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFG 362

Query: 393 IIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDL 452
           ++A+  VG SIK+++  V L F+MV F VG+ + SV PV ++YF++ +  M IL  G+D 
Sbjct: 363 VLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDT 422

Query: 453 SFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYRG 512
           SFPA++II SD LPMEYQGMAGSL  T+VNYSMSLCLGMG TVE Q++ DG+ +LKGYR 
Sbjct: 423 SFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRS 482

Query: 513 AQYLGIGLASLACIISGLYMVECYIKDHRAK 543
           A+YLGIGL+ L  +++ + +++  +  +R K
Sbjct: 483 AEYLGIGLSGLGLLLACILVIDKLVAKYRNK 513

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  543 bits (1399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/524 (49%), Positives = 365/524 (69%), Gaps = 8/524 (1%)

Query: 13  PEVKTAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSED---EVMKTKQKWQN 69
           PE K   + +DY +++   + +++ ++  N   G+++++  +N  D   E ++++ K  +
Sbjct: 34  PESK---ERKDYFQLKKNYSQDSQTNTSMNEVIGSISSV--SNDSDINSENLQSENKVLS 88

Query: 70  PNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVS 129
           P YFK    EYLFI +CM+SQ ++Q+G TQ LSIMNILA+   ++ + ++WLMASF L  
Sbjct: 89  PKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSM 148

Query: 130 GSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFV 189
           GSFIL+SGR+GDI+GLK +LL GY ++ IWSLICG + YS +D FFI SRAFQGLG+AFV
Sbjct: 149 GSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFV 208

Query: 190 LPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYT 249
           LPN LG+IG +Y  G+ +KN++I  +GAM+PIGATLG  FAG+IGT +P QWPW+FY++ 
Sbjct: 209 LPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFG 268

Query: 250 ITAVINLILSIYAIPNNIPTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXX 309
           I +  N+ILS Y+IPNNIPTN++  SMDWIG+             +NQAPI GW  AY  
Sbjct: 269 IVSFCNMILSWYSIPNNIPTNIYNLSMDWIGAILGIFGLLILNFVFNQAPIVGWQSAYII 328

Query: 310 XXXXXXXXXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQF 369
                          YE+ +AK+PL+P+A+  +R M+ I+ +LF GWG+FG +TFYYF F
Sbjct: 329 VLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSF 388

Query: 370 QLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVT 429
            LN+R YT  WAGGSYF+F++ G   A L GF +K+V PSV L+ +M+ F  G +M +VT
Sbjct: 389 VLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVT 448

Query: 430 PVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCL 489
           P+H++YF+  +G M +L  G+DLSFPA+SII SD LP++YQGMAGSLV T+ NYS S+CL
Sbjct: 449 PIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICL 508

Query: 490 GMGATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMV 533
           GM  +VE   + +G++ILKGYR A      LA L  I+SG+YMV
Sbjct: 509 GMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMV 552

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/485 (51%), Positives = 342/485 (70%), Gaps = 1/485 (0%)

Query: 68  QNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPL 127
           Q P YF     E+ FIFTC++ QLLNQ+GTTQ++SIMNI+A+ FGS+ + ++WL ASFPL
Sbjct: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125

Query: 128 VSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIA 187
           VSGSFIL+ GR GDI+GLK MLL+GY ++ IWS+ICGLT Y+ SD FFIV++AFQGLG++
Sbjct: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185

Query: 188 FVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYA 247
           F+LPN++G++G +Y  G+ +KNI ISFIGAMAP+GAT G  F+G++   +   WPW FYA
Sbjct: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245

Query: 248 YTITAVINLILSIYAIPNNIPTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAY 307
           + I + +  +   + +P+N+PTN +   MDWIGS             WNQAP+ GW++AY
Sbjct: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAY 305

Query: 308 XXXXXXXXXXXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYF 367
                            YEI++A+ PLLP+A+  +RH+I I+L++F GWG+FGI++FYYF
Sbjct: 306 IIVLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365

Query: 368 QFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMAS 427
            F LN+RH++P+W GG+YF F++ G   A  VGF IK + PS+ L  ++  F +G+++ +
Sbjct: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFA 425

Query: 428 VTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSL 487
           VTP  +TY+R   G M++L  GMDLSFPASSII SD LP EYQGMAGSLVNT+VNYS S 
Sbjct: 426 VTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485

Query: 488 CLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKA-VA 546
           CLG+  TVE Q++  G  +LKGYR A Y G+G+ +L   I+ LYM E +  D++ K  +A
Sbjct: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLA 545

Query: 547 EDKRS 551
            D  S
Sbjct: 546 NDIES 550

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  441 bits (1134), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 222/537 (41%), Positives = 330/537 (61%), Gaps = 4/537 (0%)

Query: 16  KTAGKEEDYLEIENEVALEAEDSSPRNNKEGA--LTTIVLTNSEDEVMKTK-QKWQNPNY 72
           +  G  ++ L  +N+   + ++   +N  + A   +++  T  +++   T+ Q  + P+ 
Sbjct: 56  RKPGNNKNILTGKNDTMPKDQNLVCQNIMQFASFESSLSATPPDNKPFITESQNLRRPDI 115

Query: 73  FKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSF 132
           FK  +QE+ F+   +I Q L+Q G TQ LS MNILA+   +    + WLMA+FPL  G  
Sbjct: 116 FKNRFQEFGFVLVGVIGQFLSQVGLTQVLSTMNILAEELHTTKMRQPWLMAAFPLGLGCT 175

Query: 133 ILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPN 192
           ILISGR+GDIFGLK +LL+GY++  IW+LICG + Y+ SD  FIVSR FQGLG+A  LPN
Sbjct: 176 ILISGRLGDIFGLKKVLLLGYIITTIWTLICGFSSYAHSDDLFIVSRTFQGLGLACALPN 235

Query: 193 VLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITA 252
           +  +IG +Y    F+KN++   IGAM+PIGATLG  FAGL    N   WPW+FY++ I A
Sbjct: 236 MFELIGIIYKPHCFKKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKNWPWSFYSFAIVA 295

Query: 253 VINLILSIYAIPNNIPTNVHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXX 312
            +N I++ + IPN+I  N     MDWIGS             +NQ PI GW+ AY     
Sbjct: 296 FLNGIIAWFCIPNDIEKNPQGLKMDWIGSALGLFGLVVLNFVFNQTPIDGWSSAYLIVLL 355

Query: 313 XXXXXXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLN 372
                       YE+  A  PL+P+ +  +  +I I+L+LF GWG F I+TFYYF FQLN
Sbjct: 356 VVSVVALILFVIYELTMANFPLIPKGIHSNYRLILILLTLFCGWGGFAIWTFYYFAFQLN 415

Query: 373 IRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVH 432
           +RHY+PLWA  S F+ +I G I  ++   +++R+ P + LFF+M+ F  G+I+ +VTP+H
Sbjct: 416 LRHYSPLWASSSNFVLIISGTIYTIICCLAVQRMKPPILLFFSMLGFLGGNILFAVTPIH 475

Query: 433 ETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMG 492
           +T+FR   G+M +   GM  SFP++S++ ++ LP  Y+ MAGSLVN  +NY+ S+C+GM 
Sbjct: 476 QTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLPTHYKSMAGSLVNVAINYATSICVGMA 535

Query: 493 ATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAEDK 549
            +  +  +  G+ +L G+R A YL IGL+  +  +SGLYM+     D R + + E+K
Sbjct: 536 GSANVNHNNHGQDLLHGFRAASYLAIGLSGFSVFLSGLYMIGSIWTD-RNQKMKENK 591

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  317 bits (812), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/520 (36%), Positives = 283/520 (54%), Gaps = 17/520 (3%)

Query: 38  SSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGT 97
           SSP   +   +    L   +DEV+  +   Q        W E  F+     +QL+ Q+G 
Sbjct: 4   SSPVTEENLDMNVETL-KKDDEVLSDEFDVQEEKPESLLW-ESAFVGVLCSAQLMTQAGL 61

Query: 98  TQTLSIMNILADSFGS-DANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMI 156
            Q+L+ ++I+ DSFG+ +    SW  +++ L  G+FILI+GR+GDIFG K   ++G+   
Sbjct: 62  GQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWY 121

Query: 157 IIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIG 216
            +WSL+ G + YS +  FF   RAFQG+G AF+LPN + I+G  Y  G  RKN+V S  G
Sbjct: 122 ALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFG 179

Query: 217 AMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNN-IPT-NVHRF 274
           A AP G  LG  F+ ++G +    WPWA++   I   +  +   Y IP+  +P  +V  F
Sbjct: 180 ASAPGGFVLGAVFSSMLGQLA--WWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASF 237

Query: 275 SM----DWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIHFA 330
            +    D+ GS             WNQ P+ GW   Y                  E   A
Sbjct: 238 KLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESR-A 296

Query: 331 KSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLI 390
             PLLP A +       ++  +  GW SFGI+ FY +QF  + R  TPL +   +    I
Sbjct: 297 AFPLLPFAALSSDTAF-VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAI 355

Query: 391 WGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGM 450
            G  AAL+ GF +    PS  +FFAM AF VG+I+ +  PVH+TY+     ++I++ +GM
Sbjct: 356 SGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGM 415

Query: 451 DLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGY 510
           D+SFPA++I+ SD +P E+QG+A SLVNTVVNYS+S+ LG+  T+E  ++  G ++LKGY
Sbjct: 416 DMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGY 475

Query: 511 RGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAEDKR 550
           R + YLGIGL+     ++  Y V  ++K    K V+E + 
Sbjct: 476 RCSWYLGIGLSGFGIFVAATYAVSTFMKSK--KRVSEKQH 513

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  307 bits (787), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 184/511 (36%), Positives = 273/511 (53%), Gaps = 15/511 (2%)

Query: 38  SSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGT 97
           SSP   K+    T  L   +DEV+  +   Q+       W E  F+     +QL+ Q+G 
Sbjct: 4   SSPVMQKDFDTNTGTL-KKDDEVVLDEFDIQDETPGSLLW-ETAFVGVLCSAQLMTQAGL 61

Query: 98  TQTLSIMNILADSFGS-DANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMI 156
            Q+L+ ++I+  SFG+ +    SW  +++ L  G+FILI+GR+GDIFG K   ++G+   
Sbjct: 62  GQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWY 121

Query: 157 IIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIG 216
            +WSL+ G + YS +  FF   RAFQG+G AF+LPN + I+G  Y  G  RKN+V S  G
Sbjct: 122 ALWSLLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKNMVFSLFG 179

Query: 217 AMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFS- 275
           A AP G  LG  F+ L+G +    WPWA++   I      I   + IP+    + H  S 
Sbjct: 180 ACAPGGFVLGAVFSSLLGQLA--WWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSF 237

Query: 276 -----MDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIHFA 330
                +D+ GS             WNQ P+ GW   Y                  E   A
Sbjct: 238 KLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESR-A 296

Query: 331 KSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLI 390
             PLLP A +       ++  +  GW SFGI+ FY +QF  + R  TPL +   +    +
Sbjct: 297 AFPLLPFAALSSDTAF-VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAV 355

Query: 391 WGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGM 450
            G  AAL  G+ + R  PS  + FAM AF  G+I+ +  PVH+TY+     ++I++ +GM
Sbjct: 356 SGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGM 415

Query: 451 DLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGY 510
           D+SFPA++I+ SD +P E+QG+A SLVNTVVNYS+S+ LG+  T+E  ++  G   LKGY
Sbjct: 416 DMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGY 475

Query: 511 RGAQYLGIGLASLACIISGLYMVECYIKDHR 541
           R + Y+GIGL+ L   ++ +Y    + K  +
Sbjct: 476 RCSWYMGIGLSGLGIFVAAIYAWSTFKKSKK 506

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  306 bits (785), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 179/509 (35%), Positives = 279/509 (54%), Gaps = 14/509 (2%)

Query: 40  PRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQ 99
           P   ++   T+   T ++DEV+  + + Q+       W E  F+     +QL+ Q+G  Q
Sbjct: 5   PSVTQKNLETSAETTKTDDEVLLNQFELQDETPGSLVW-EAAFVGVLCSAQLMTQAGLGQ 63

Query: 100 TLSIMNILADSFGS-DANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIII 158
           +++ ++I+ DSFG+ +    SW  +S+ L  G+FILI+GR+GDIFG +   ++G+    +
Sbjct: 64  SIAPLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYAL 123

Query: 159 WSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAM 218
           WSL+ G + YS +  FF   RAFQG+G AF+LPN + I+G  Y  G  RKN+V S  GA 
Sbjct: 124 WSLLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGK-RKNMVFSLFGAS 181

Query: 219 APIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPN-NIPT-NVHRFSM 276
           AP G  LG  F+ ++G +    WPWA++   I   +  +   + IP+  +P+ +   F+M
Sbjct: 182 APGGFVLGAVFSSMLGQLA--WWPWAYWIMGIACFLLAVAGYFVIPHVQMPSRDSPSFNM 239

Query: 277 ----DWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIHFAKS 332
               D+ GS             WNQ P+ GW   Y                  E   A  
Sbjct: 240 LERVDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVFIESR-AAY 298

Query: 333 PLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWG 392
           PLLP A +       ++  +  GW SFGI+ FY +QF    R  +PL +   +    I G
Sbjct: 299 PLLPFAALSSDAAF-VLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQFAPVAISG 357

Query: 393 IIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDL 452
             AA+  GF +     S  + FAM AF VG I+ +  PVH+TY+     ++I++ +GMD+
Sbjct: 358 FCAAVTTGFLLSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVSIIVMPWGMDM 417

Query: 453 SFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYRG 512
           SFPA++I+ S+ +P E+QG+A SLVNTVVNYS+S+ LG+  T+E Q++  G + LKGYR 
Sbjct: 418 SFPAATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDGGANALKGYRC 477

Query: 513 AQYLGIGLASLACIISGLYMVECYIKDHR 541
           + Y+GIGL+ L   ++ +Y    ++K  +
Sbjct: 478 SWYMGIGLSGLGIFVAAVYASSTFLKSKK 506

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  303 bits (775), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 175/479 (36%), Positives = 267/479 (55%), Gaps = 15/479 (3%)

Query: 79  EYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGS-DANSRSWLMASFPLVSGSFILISG 137
           E  F+     +QL+ Q+G  Q+L+ ++I+ +SFG+ +A   SW  +++ L  G+FILI+G
Sbjct: 42  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAG 101

Query: 138 RMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGII 197
           R+GDIFG K   ++G+    +WSL+ G + YS +  FF   RAFQG+G AF+LPN + I+
Sbjct: 102 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAIL 160

Query: 198 GNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLI 257
           G  Y  G  RKN+V S  GA AP G  LG  F+ ++G +    WPWA++   I   +  +
Sbjct: 161 GRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSMLGQLA--WWPWAYWIMGIACFVLAV 217

Query: 258 LSIYAIPNN-IPT-NVHRFSM----DWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXX 311
              + IP+  +P+ +   F +    D+ GS             WNQ P+ GW   Y    
Sbjct: 218 AGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 277

Query: 312 XXXXXXXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQL 371
                         E   A  PLLP A +       ++  +  GW SFGI+ FY +QF  
Sbjct: 278 LIVGTFFLVIFAYIESR-AAFPLLPFAALSSDTAF-VLSCIAAGWASFGIWIFYTWQFME 335

Query: 372 NIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPV 431
           + R  TPL +   +    I G  AA+  GF +    PS  + FAM AF VG+I+ +  PV
Sbjct: 336 DSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPV 395

Query: 432 HETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGM 491
           H+TY+     ++I++ +GMD+SFPA++I+ SD +P E+QG+A SLVNTVVNYS+S+ LG+
Sbjct: 396 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 455

Query: 492 GATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAEDKR 550
             T+E +++  G   LKGYR + Y+GIGL+ L   ++  Y    ++K    K ++E + 
Sbjct: 456 AGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSK--KRISEKQH 512

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  301 bits (771), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 178/512 (34%), Positives = 272/512 (53%), Gaps = 16/512 (3%)

Query: 37  DSSPRNNKEGALTTIVLTNSEDEVMKTKQKW-QNPNYFKYPWQEYLFIFTCMISQLLNQS 95
           D      K+  LT     +   E+ +      Q P        E  F+     +QL+ Q+
Sbjct: 5   DKEENQKKDDGLTRESTHDQGQELSQPHHNGIQKPESLL---GEAAFVGVICGAQLMTQA 61

Query: 96  GTTQTLSIMNILADSFGS-DANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYV 154
           G  Q+++ ++I+ DSFG+ +    SW  A++ L  G+FILI+GR+GD++G K   +IG+ 
Sbjct: 62  GLGQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFF 121

Query: 155 MIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISF 214
              +WSL+ G + YS +  FF   RAFQG+G A +LPN + I+G  YV G  RK +++S 
Sbjct: 122 WYALWSLLAGFSVYS-NQIFFDCCRAFQGIGPALLLPNAIAILGRTYVPGR-RKAMILSL 179

Query: 215 IGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPN----NIPTN 270
            GA AP G  LG  F+ + G +    WPWA++A  I      +  I  IP      + T+
Sbjct: 180 FGATAPAGFVLGAVFSSIFGQLT--WWPWAYWAMGIVCFFLAVAGILVIPRMPLPELDTS 237

Query: 271 VHRFS-MDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIHF 329
           V  +  +D  GS             WNQ P+ GW   Y                  E   
Sbjct: 238 VSTYQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLLIVSAVFLCVFAFIESR- 296

Query: 330 AKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFL 389
           A  PLLP + +       ++  +  GW SFGI+ +Y++ F   +R ++PL     +    
Sbjct: 297 APHPLLPLSALSSDAAF-VLGCVGAGWSSFGIWIYYFWLFLEELRGHSPLLTSAQFAPVA 355

Query: 390 IWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFG 449
           I G+ AAL  GF I RV  S+ + FAM AF VG I+ +  PV + Y+     ++I++ +G
Sbjct: 356 ISGLCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVKQVYWAQAFVSIIVMPWG 415

Query: 450 MDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKG 509
           MD+SFPA++I+ SD +P E+QG+A SLVN VVNYS+S+ LG+  TVE +++  G ++LKG
Sbjct: 416 MDMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLAGTVEGRVNNGGANLLKG 475

Query: 510 YRGAQYLGIGLASLACIISGLYMVECYIKDHR 541
           YRGA Y+GIGL+    +I+ +Y    + K  +
Sbjct: 476 YRGAWYMGIGLSGFGILIAFMYEYHTFKKSKK 507

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  295 bits (755), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 172/508 (33%), Positives = 276/508 (54%), Gaps = 17/508 (3%)

Query: 51  IVLTNSEDEVMKTKQKW-QNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILAD 109
           + L N E E ++  Q   + P       +E LF+     +QL+ Q+G  Q+++ + I+ +
Sbjct: 13  VELKNEEGESLQLVQSHVEKPQSLM---REALFVGILSCAQLMTQAGLAQSIAPVRIIGN 69

Query: 110 SFG-SDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKY 168
           SFG S+    SW  A++ L  G+FILI+GR+GD+FG K + ++G++   +WSL+ G + Y
Sbjct: 70  SFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVY 129

Query: 169 SGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCF 228
           S +  FF   RA QG+G AF+LPN + I+G  Y  G  RK +V S  GA AP G  LG  
Sbjct: 130 S-NQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSV 187

Query: 229 FAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFS-----MDWIGSXX 283
           F+ +   +    WPWA++A     ++  +  I  IP   P  +   +     +D  G+  
Sbjct: 188 FSSIFSQLA--WWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDAAGATT 245

Query: 284 XXXXXXXXXXXWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIHFAKSPLLPQAVMKDR 343
                      WNQ P+ GW   Y                  E   A+ PLLP A +   
Sbjct: 246 GILGLALVNFAWNQGPVVGWQTPYTYALLIVGFVFLLVFSLIESR-ARFPLLPFAALST- 303

Query: 344 HMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSI 403
            +  ++  +  GW SFGI+ FY++QF  + R  +PL     +    I G+ AAL  G+ +
Sbjct: 304 DLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYIL 363

Query: 404 KRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSD 463
             V     +  AM+AF VG ++ +  P+++TY+     ++II+ +GMD+SFPA++I+ S+
Sbjct: 364 SHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISN 423

Query: 464 YLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASL 523
            +P E+QG+A SLVNTVVNYS+SL LG   T+E +++  G + L+GYRGA Y+GIGL+ L
Sbjct: 424 AMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGL 483

Query: 524 ACIISGLYMVECYIKDHRAKAVAEDKRS 551
             +++ +Y     +K  + + ++E   +
Sbjct: 484 GVLVAIVYAWST-LKKFKEEQLSEKSSN 510

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  287 bits (735), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 175/531 (32%), Positives = 289/531 (54%), Gaps = 27/531 (5%)

Query: 16  KTAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKY 75
           K   KE+ Y+        E  + S   N+E          S  E    +  W   + F +
Sbjct: 3   KKHDKEDQYVFFS-----ECTERSISCNQE----------SSKEAYD-RCSWLKSSNFHF 46

Query: 76  PWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILI 135
             +EY F+FT +++Q  NQ+G T  L ++N+L+DSF        +L+ S+P+V GSF+LI
Sbjct: 47  LCKEYAFVFTGVMAQAFNQAGGTMILPLVNVLSDSFHGK-----FLLNSYPMVCGSFMLI 101

Query: 136 SGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLG 195
            GR+G++ G K  LL GY+++I+ SL+ GL++YS S  F+++ RAFQG+G+A +LPN   
Sbjct: 102 GGRLGEVHGYKETLLGGYIILILSSLLGGLSRYSKSSIFYVICRAFQGVGMALILPNFSA 161

Query: 196 IIGNVYV--GGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAV 253
                Y       RK I+ + IG  A  GA LG F +G+  T + + W WA+Y YTI A 
Sbjct: 162 AYDYRYQSQAKAHRKTILSTIIGCGASTGAFLGTFLSGICVTRSESNWSWAYYTYTIAAT 221

Query: 254 INLILSIYAIPNNIPTNVHRFSMDWIG-SXXXXXXXXXXXXXWNQAPISGWNQAYXXXXX 312
           + L LS Y++P+NI T  ++  ++ +G                N A ++  N ++     
Sbjct: 222 LTLALSYYSVPDNI-TKKNKPCLNGLGWFSNRSCGLLMLNVACNLAAVASSNWSHIIVLL 280

Query: 313 XXXXXXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLN 372
                       +E+ F++ P+  + +  +  +  ++ S+FFGWG++GI++ Y+F+F LN
Sbjct: 281 VVFVCLLLLFLVFELKFSEDPVFSKELFTNASVSLVLASIFFGWGTYGIWSGYFFRFLLN 340

Query: 373 IRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVH 432
           +R+Y+PL AG +Y   +I G +A + +   +KR  P +FL F+ + F    I+ SVTP+H
Sbjct: 341 LRNYSPLAAGSTYLTLVIGGYVAEIGISMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIH 400

Query: 433 ETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMG 492
           ++YFR  +G+MI L+ G+D SFP+S+II  + LP +Y  M   L N + NY++S   G+ 
Sbjct: 401 QSYFRSTLGSMIFLALGLDFSFPSSAIILQNELPSKYHEMTAVLTNGIFNYAISFWPGIC 460

Query: 493 ATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAK 543
            +    L      ++K YR   Y  IGL+++    +G+ +    I  +R K
Sbjct: 461 NSALRSLSSI--ELIKYYRYVYYFAIGLSAIGLFAAGIQLARASIMYYRGK 509

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  277 bits (709), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 166/470 (35%), Positives = 248/470 (52%), Gaps = 18/470 (3%)

Query: 55  NSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFG-S 113
           NS +E  +     QN   +    +E   I     +QL+ Q+G  Q++  + I+ DSFG  
Sbjct: 7   NSHEE--QDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIK 64

Query: 114 DANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDT 173
           +    SW  ++F L  G+FILI+GR+GD FG K   ++G++   +WS++ G + YS +  
Sbjct: 65  NPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYS-NQI 123

Query: 174 FFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLI 233
           FF   RAFQG+G AF LPN + II   Y  G  ++N++ S  GA AP G  +G  F+ L+
Sbjct: 124 FFDCCRAFQGIGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL 182

Query: 234 GTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTN-------VHRFSMDWIGSXXXXX 286
                  WPWA++   IT  +  +     IP++ P +       V R  +D  GS     
Sbjct: 183 SEFA--WWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVER--IDVAGSVTGVV 238

Query: 287 XXXXXXXXWNQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIHFAKSPLLPQAVMKDRHMI 346
                   WNQ P+ GW  +Y                  E   AK PLLP   +     I
Sbjct: 239 GLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSS-DTI 296

Query: 347 QIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRV 406
            +M  +  GW SFGI+ +Y +Q   N+R   PL +   +    I G+ AA+   F + R 
Sbjct: 297 FVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRT 356

Query: 407 SPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLP 466
           SPS  +  AM+AF VGSI+ +  PV +TY+     ++I++ +GMD+SFPA++II S  +P
Sbjct: 357 SPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMP 416

Query: 467 MEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYRGAQYL 516
             +QG+A SLVNT++NYS+S+ LG   T+E Q+      +LKGYRGA Y+
Sbjct: 417 ASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRGAYYM 466

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  216 bits (551), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 158/561 (28%), Positives = 260/561 (46%), Gaps = 35/561 (6%)

Query: 14  EVKTAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYF 73
            + +    E+   +EN+      DS   N  + +  T    +S+D V    +    P   
Sbjct: 3   SINSDSNSENIFRLENKEVNGTYDSINFNGGDDSSKT--RRDSDDNVSDINKSAPAPEEH 60

Query: 74  KYPW------------QEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRS-W 120
             P              E +F+     SQ+L  +G  Q +  M+++ + F     S S W
Sbjct: 61  DPPCTGEEATLNMSLLHEIIFVLLVSSSQVLGLAGAVQGIPQMDVIVEWFKLTHPSDSGW 120

Query: 121 LMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRA 180
               +    GSF+LI+G+MGD+ G K+M LIGY  + +WSL+ G ++Y  S  FF   RA
Sbjct: 121 CNGGYATTYGSFVLIAGKMGDMNGHKSMFLIGYAWLALWSLLTGFSRYCPSSHFFFFCRA 180

Query: 181 FQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQ 240
            QG+G AF   + L I+G  Y     RKN + SF GA    G  LG  F+ L   +    
Sbjct: 181 AQGIGAAFTFTSALSILGKSYPPCK-RKNFIFSFFGACGSFGVVLGMVFSALFTQL--AH 237

Query: 241 WPWAFYAYTITAVINLILSIYAIPNNI-----PTNVHRFSMDWIGSXXXXXXXXXXXXXW 295
           W WA+++  I  V+ +ILSI+ IP ++      +NV  F  D++G+             W
Sbjct: 238 WSWAYWSMAIACVVIIILSIFFIPGDVVEKHETSNV--FYFDYLGAFLFVTGLVLFSVAW 295

Query: 296 NQAPISGWNQAYXXXXXXXXXXXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFG 355
           NQAP  G+ + Y                  E      PLLP   +   + ++++L++FF 
Sbjct: 296 NQAPTYGFGRTYVYVLLIVSVVILALAMYVETK-VDDPLLPWTHIS-ANTLKVLLAIFFA 353

Query: 356 WGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIK-RVSPSVFLFF 414
           + SF ++  Y F+F L  +  T L A        + G+ AAL     +   V   + +  
Sbjct: 354 YASFTMWAAYTFRFNLMAKGDTLLLAAAKMTPMAVSGVFAALFSALLLNIHVQVQIRMLI 413

Query: 415 AMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAG 474
           +++AF V  I+ +     +TY+     T I++SFG+D+SFP+++++ S+ +P +++G+  
Sbjct: 414 SLLAFLVPPILMATMGAGQTYWGEVFVTTIVISFGLDISFPSATLLLSNRIPDKFKGLGA 473

Query: 475 SLVNTVVNYSMSLCLGMGATVEMQLDPD-----GKHILKGYRGAQYLGIGLASLACIISG 529
           SLV  V+NY+ +L     A+V     PD     G    K      Y+GIG A L  +++ 
Sbjct: 474 SLVGAVLNYATALGPPTAASVLRYQCPDCMAHKGNAFTKTINIIGYVGIGTAGLGTLVAI 533

Query: 530 LYMVECYIKDHRAKAVAEDKR 550
             ++  Y K    K   ED++
Sbjct: 534 FGVITEYPKVAGKK--GEDRK 552

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  184 bits (466), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 93/190 (48%), Positives = 125/190 (65%), Gaps = 34/190 (17%)

Query: 87  MISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLK 146
           M+SQLLNQ GTTQTL ++N+L+  F S    ++ L+AS PLVSGSFIL+SG++GDI+GLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 147 NMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTF 206
           N LL GY  +I+WS ICGLT+Y+GS  FF+++RAFQGLG+AFVLPNV+G + NVY+ G+ 
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 207 RKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNN 266
           RKN+V                                  YAYT+   +N+ L ++A+P N
Sbjct: 121 RKNMV----------------------------------YAYTVAVSLNMALCVWALPWN 146

Query: 267 IPTNVHRFSM 276
           IPTNV   +M
Sbjct: 147 IPTNVRGQAM 156

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  177 bits (448), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 151/544 (27%), Positives = 258/544 (47%), Gaps = 37/544 (6%)

Query: 28  ENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVM-KTKQKWQNPNYFKYPWQEYLFIFTC 86
           E+E  L +    P        + + +  S +E++ KT +   N  +     +E + +   
Sbjct: 5   ESEETLTSSKLQPHEPT----SPVKVVPSHNEILSKTDEHPLNMQF-----KEIIIVLLI 55

Query: 87  MISQLLNQSGTTQTLSIMNILADSFG--SDAN-SRSWLMASFPLVSGSFILISGRMGDIF 143
              Q ++  G  Q +  M  +A +F    D N    W  A++   + +F++I+G++GDI 
Sbjct: 56  SSGQFISLLGAVQGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFVIIAGKLGDIN 115

Query: 144 GLKNMLLIGYVMIIIWSLICGLTKYSGSDT-FFIVSRAFQGLGIAFVLPNVLGIIGNVYV 202
           G KNM + GY  + +WSL+ G +KY+ ++  FF   R  QG+G AF+ P  L ++G  Y 
Sbjct: 116 GHKNMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTGLALLGKHYP 175

Query: 203 GGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYA 262
               RKN V SF GA  P G   G  F+ L   +    W W +++  +T +I  ILS   
Sbjct: 176 PCK-RKNYVFSFYGACGPFGIVAGSVFSALFTQL--TTWAWTYWSMAVTCLIITILSYIF 232

Query: 263 IPNNIPTNVHR---FSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXXXXXX 319
           IP +      R   +S D++G              WNQAP+S +   Y            
Sbjct: 233 IPKDNTPKRERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYSLLIVSVVFM 292

Query: 320 XXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPL 379
                 +    K PL+P   M   ++I+ ++ +FFG+  F I+ FY ++F L  ++ + L
Sbjct: 293 TMALIIDSR-VKDPLIPWKSMCS-NVIKALIVVFFGFLGFTIWLFYSWRFYLVAKNDSLL 350

Query: 380 WAGGSYFMFLIWGIIAALLVGFSI----KRVSPSVFLFFAMVAFNVGSIMASVTPVHETY 435
            A   +    I GI AA    FS+    K+V   + L  A+ AF + +I+ S   + ETY
Sbjct: 351 LAAAKFIPLGISGIFAAC---FSVLLLNKKVPVQLRLLTAVCAFLICAILISTMTLQETY 407

Query: 436 FRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGA-T 494
           +       +I++ G+D++FP+++++ S+ +  E QG+A +L  T +NY  +L  G+    
Sbjct: 408 WGNAFVATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALGPGVATLI 467

Query: 495 VEMQLD-----PDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAEDK 549
           +  Q D      DG+ +      A Y+ IG A +A +++    +  Y K+ R   + E K
Sbjct: 468 ITYQCDDCLARSDGRFV-HAVHIAGYVAIGTAGIAVVVAIFGSITEYYKE-RMDDLREKK 525

Query: 550 RSMS 553
           R +S
Sbjct: 526 RPIS 529

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  155 bits (393), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 123/448 (27%), Positives = 214/448 (47%), Gaps = 23/448 (5%)

Query: 77  WQEYLFIFTCMIS-QLLNQSGTTQTLSIMNILADSF---GSDANSRSWLMASFPLVSGSF 132
           W   +F+   +IS QL+   G  Q + I   L + +    +      W  AS+ L S   
Sbjct: 35  WIREIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWANASYMLGSAVM 94

Query: 133 ILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYS-GSDTFFIVSRAFQGLGIAFVLP 191
           +LI+G++GD+ G K M++ G++ + IWSLI G + Y  G+  F+  +RA QG+G  F++P
Sbjct: 95  VLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSGFIVP 154

Query: 192 NVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTIT 251
           N L I+G  Y     +K I+ S  G M   G  +G  F+ L   +   +W W ++A    
Sbjct: 155 NSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQLT--KWAWNYWALACV 212

Query: 252 AVINLILSIYAIPNNIPTN-VHRFS-------MDWIGSXXXXXXXXXXXXXWNQAPISGW 303
            V+  + +I  IP   P N VH+ +        D++G+             + QA   GW
Sbjct: 213 CVLYTVGAILFIP---PDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFDVAFTQASALGW 269

Query: 304 NQAYXXXXXXXXXXXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFT 363
           +  +                  +      PL+P   ++   ++ I++ ++FG+ SF I+ 
Sbjct: 270 SPPHTYITLIIGVILILIAMFVDWR-VDDPLVPLQHLR-ADVVVILICVYFGFLSFVIWA 327

Query: 364 FYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIK-RVSPSVFLFFAMVAFNVG 422
            +++QF   + + +PL          I  I AA+     ++  +     +  +MV F V 
Sbjct: 328 NWFWQFYELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQLNIKAPTMMVISMVCFLVP 387

Query: 423 SI-MASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVV 481
           +I MA+VTP + TY+     + II  F +D++ P ++++FSD +  E QG+A SL+ TV+
Sbjct: 388 NILMATVTP-NTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLIITVI 446

Query: 482 NYSMSLCLGMGATVEMQLDPDGKHILKG 509
           +Y++S+     A V   + P G     G
Sbjct: 447 SYAISIGPSYTAMVMWYVAPLGNDSTPG 474

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  145 bits (366), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 133/522 (25%), Positives = 237/522 (45%), Gaps = 40/522 (7%)

Query: 40  PRNNKEGAL----TTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQS 95
           P N+   +L    T    +N +    + + +  NP       +E +FI     SQ ++ +
Sbjct: 28  PSNSTASSLHSQRTKEQCSNLQPAQAQDQLESMNPPPGPSRLRECMFIVIIASSQFISLA 87

Query: 96  GTTQTLSIMNILADSFGSDANSR---SWLMASFPLVSGSFILISGRMGDIFGLKNMLLIG 152
             +Q +  M+ +   F   A+      W  A+F +  G+FI+ +G++ D+ G K + + G
Sbjct: 88  AASQAILQMDAITAWFQLPADRSLEAGWANAAFAITCGTFIIPAGKLCDLIGSKTVFIFG 147

Query: 153 YVMIIIWSLICGLTKYS--GSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNI 210
           Y    +WSL+ G+++Y+  G  TFF   R  QG+G A + P+ L ++G  Y   + +KNI
Sbjct: 148 YAWYTLWSLLVGISRYAPKGQATFFFFGRGCQGIGAAALFPSSLALLGKYY-PPSCKKNI 206

Query: 211 VISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTI-TAVINLILSIYAIPNNIPT 269
           V S  G   P+G  +G  F+ +   +    W W +++  I +A   LI   Y  P+ I  
Sbjct: 207 VFSLYGFCVPLGVVVGGVFSAIFTQLA--HWSWNYWSMAIVSAFFTLISCFYIPPDEIIK 264

Query: 270 N---------VHRFSMDWIGSXXXXXXXXXXXXXWNQAPISGWN----QAYXXXXXXXXX 316
           +          H    D++G+             WNQA  +G+     Q Y         
Sbjct: 265 SEEQKKKRAWFHLPKFDYLGTFLYVASLLLFAVCWNQA--TGFKFKSVQVYVTLIVSLVC 322

Query: 317 XXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHY 376
                   +   +   P++P   +  +  I+ +L +FF + SF I+ FY +++   +R+ 
Sbjct: 323 FVAMVIVEF---YVDDPIIPARKIHPQ-TIKALLVVFFSYLSFTIWLFYLWKYFTVVRND 378

Query: 377 TPLWAGGSYFMFLIWGIIAALLVGFSIKRVSP-SVFLFFAMVAFNVGSIMASVTPVHETY 435
           T L     +    I G IAAL     I    P  + L     +F +  I+       E+Y
Sbjct: 379 TVLLGAAKFVPLSIAGFIAALFSILLISTAVPVQIRLLAGACSFLLAHILFITLSRTESY 438

Query: 436 FRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGAT- 494
           +     T+II+S G+D+SFP+++++ S+ +P E +G++ +LV T +NY   +   +  T 
Sbjct: 439 WARPFLTIIIISIGLDISFPSATLLLSNGVPQELRGISAALVGTALNYGTGIGPPIAQTI 498

Query: 495 VEMQLDP-----DGKHILKGYRGAQYLGIGLASLACIISGLY 531
           +  Q D      D    +K    A  +GIG + +A ++ GLY
Sbjct: 499 IGYQCDKCMASGDMDQFVKAIHIAAAVGIGASGIAVVV-GLY 539

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  133 bits (335), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 124/538 (23%), Positives = 234/538 (43%), Gaps = 82/538 (15%)

Query: 65  QKWQNP--NYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSR---S 119
           QK Q+P  +Y      + +FIF    SQ +  +  +Q +  M+ L+  F     S     
Sbjct: 59  QKLQSPTNSYL----NDIIFIFLICSSQFITLASASQAILQMDSLSVWFKIPPTSTLQLG 114

Query: 120 WLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFI-VS 178
           W+ ASF +  G+FI+++G++ DI   + + + GYV   +W+LI G   Y   +  F+ + 
Sbjct: 115 WVNASFAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWTLITGFASYVPKNMIFLYIC 174

Query: 179 RAFQGLGIAFVLPNVLGIIGNVYVGGTF-------------------------------- 206
           R  QG+G A + P+ L ++   Y                                     
Sbjct: 175 RGCQGIGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSPSHDIEKNLSSDDDND 234

Query: 207 --------------RKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITA 252
                          K+I  S  GA AP+G  +G  F+ +   +    WPW +++ +I  
Sbjct: 235 GDSSIADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSAIFTQLA--TWPWNYWSMSIVT 292

Query: 253 VINLILSIYAIPNNIP-----TNVHRF----SMDWIGSXXXXXXXXXXXXXWNQAPISGW 303
            +  ILS + +   IP     +N +      + D++G              W+QA +  +
Sbjct: 293 TLLSILSYFYVVVPIPVEKLDSNPNSLKNWKNFDFLGVILGISALILFGVSWDQATMYKF 352

Query: 304 NQAYXXXXXXXXXXXXXXXXXYEIHFAKSPLLPQAVMKDRH--MIQIMLSLFFGWGSFGI 361
              +                 +E +F  +P++P   ++  H   I+ +L +FF + SF  
Sbjct: 353 KTIHVYLTLLFSLVSFIAMIIWEYYF-NNPIIP---IRQIHPGTIKALLVVFFSYISFTQ 408

Query: 362 FTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALL-VGFSIKRVSPSVFLFFAMVAFN 420
           + FY ++    ++  +P+     +    + GII+A   +   +KRV   + L     +F 
Sbjct: 409 WLFYTWKLFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIVKRVPVQIRLLAGASSFL 468

Query: 421 VGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTV 480
           +  I+     +  +Y+  Q  ++I +S G+D+SFP+++++ ++ +P E QG+  +LV +V
Sbjct: 469 LSHILLLTCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTNGIPPEIQGICAALVGSV 528

Query: 481 VNYSMSLCLGMGATV------EMQLDP-DGKHILKGYRGAQYLGIGLASLACIISGLY 531
           +NY  ++   +  T+          DP D K  LKG   A  +G+G + +A +I G+Y
Sbjct: 529 LNYGTAIGPPIAQTIIQYQCESCMSDPHDKKAFLKGIHIAGAVGVGCSGIAVLI-GIY 585

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 113/557 (20%), Positives = 211/557 (37%), Gaps = 80/557 (14%)

Query: 54  TNSEDEVMKTKQKWQNPNYFKYPWQEYL---FIFTCMISQLLNQSGTTQTLSIMNILADS 110
           +N    + K  Q+ +N    K P+Q  +    IF      LLN       +S+++ LA  
Sbjct: 3   SNKIANLTKALQEIRNKCQ-KSPYQLNVNVGLIFLGCTFDLLN---VASMISLIDDLAKK 58

Query: 111 FGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSG 170
           +     + SW + S+ +    FI   GR+GDI G   +  I      I SL+C +     
Sbjct: 59  YNISYTTASWSLTSYAVTFAGFIACMGRLGDIVGNSVLFTISCSCFAILSLLCAVMPNFP 118

Query: 171 SDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATL---GC 227
           +   F V RA QG+  A ++P    +I  +      +K   I   G  + IG  L   G 
Sbjct: 119 A---FAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIGLGLIIGGA 175

Query: 228 FFAGLIGTMNPNQWPWAFY-AYTITAVINLILSIYAI--------PNNIPTNVHRFSMDW 278
           F A  IG      +   FY  + + ++I++I   +          P  I       S+D+
Sbjct: 176 FAATKIG------YRGIFYLTFAVMSLISVIAFFFTYNVENFDKKPQKIQAQTSVKSLDF 229

Query: 279 IGSXXXXXXXXXXXX-------XWNQAPIS---------------GWNQAYXXXXXXXXX 316
           IGS                    WN+ P++                WN  Y         
Sbjct: 230 IGSLIFVAGSILIVVGLTEGGESWNR-PVTYVTLIIGILLFFGFFVWNCTYAKIVRGIRF 288

Query: 317 XXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYF--QFQLNIR 374
                   +E       L+P  V+  ++ I I+L+  F   +  +F+  Y   Q+     
Sbjct: 289 VGIDTSKYFE---KVQLLIPVDVLFMKNFIPIVLA--FALNNACLFSCLYIIDQYSQYAE 343

Query: 375 HYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVH-- 432
             +PL AG      +I  ++   L  F   ++ P V +         GSI+  +  +H  
Sbjct: 344 KDSPLLAGVKLVPLIICMVVGNALCAFESTKLKPRVGVALGFSLALAGSII--LIQLHLI 401

Query: 433 --ETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLG 490
               ++++   +  ++ FG+ + +P +  I     P + +G+A  +  T     + +   
Sbjct: 402 KDNVFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDQSKGIASGVAQTFGQLGIEITFS 461

Query: 491 MGATV-----EMQLDPDG-KHILKGYRGAQYLGIGLASLACIISGLYMVECY-----IKD 539
           + A+V     EM+   D  ++   G++   Y  + + +L  +++ + + + +     I D
Sbjct: 462 VMASVLGDINEMKGKEDAIQNFRTGFQNCSYFTVAVGALGFLVTAICIRDIHTPNDDISD 521

Query: 540 -----HRAKAVAEDKRS 551
                HR K   + ++ 
Sbjct: 522 LESSIHRTKIEMDQEKD 538

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 105/520 (20%), Positives = 196/520 (37%), Gaps = 63/520 (12%)

Query: 53  LTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFG 112
           L+N+ +E+   + K Q   Y +      L    C    LLN       +S+++ LA ++ 
Sbjct: 9   LSNALEEI---RNKCQKSRY-QLNVNVGLIFLGCTF-DLLN---VASMISLIDDLAKTYN 60

Query: 113 SDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSD 172
               + SW + S+ +    FI   GR+GDI G   +  I      + SL+C +     + 
Sbjct: 61  ISYTTASWSLTSYAVTFAGFIACMGRLGDIIGNSVLFTISCSCFAVLSLLCAVMPNFPA- 119

Query: 173 TFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGL 232
             F V RA QG+  A ++P    +I  +      +K   I   G  + IG  LG    G 
Sbjct: 120 --FAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIG--LGLIIGGA 175

Query: 233 IGTMNPNQWPWAFYAYTITAVINLILSIYAI--------PNNIPTNVHRFSMDWIGSXXX 284
             T         +  + +  +I++I   +          P     +    S+D+IGS   
Sbjct: 176 FATTKIGYRGIFYLTFAVMTLISIIAFFFTYGVEKLNKKPQKDQASTSVKSLDFIGSLIF 235

Query: 285 XXXXXXXXX-------XWNQAPIS---------------GWNQAYXXXXXXXXXXXXXXX 322
                            WN+ P++                WN  Y               
Sbjct: 236 VAGSILIVVGLTEGGESWNR-PVTYVTLVIGIILFFGFFVWNCTYTKIVRGFKYCGIDTS 294

Query: 323 XXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYF--QFQLNIRHYTPLW 380
             +E       L+P  V+  ++ I I+L+  F   +  +F+  Y   Q+       +PL 
Sbjct: 295 KYFE---KVQLLIPIDVLFMKNFIPIVLA--FALNNACLFSCLYIIDQYSQYAERNSPLL 349

Query: 381 AGGSYFMFLIWGIIAALLVGFSIKRVSPSVFL---FFAMVAFNVGSIMASVTPVHETYF- 436
           AG      +I  +I   L  F   ++ P V +   FF  +A ++  I+  +  V E  F 
Sbjct: 350 AGVKLVPLIICMVIGNALCAFESTKLRPRVGVAIGFFLALAGSI--ILIQLHLVKEDLFW 407

Query: 437 RMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATV- 495
           ++      ++ FG+ + +P +  I     P E +G+A  +  T     + +   + A+V 
Sbjct: 408 KIFFSAQALVGFGVAIFYPYALQIAVGGAPDESRGIASGVAQTFGQLGIEITFSVMASVL 467

Query: 496 ----EMQLDPDG-KHILKGYRGAQYLGIGLASLACIISGL 530
               EM+   +  +    G++   Y  + + +L  +++ +
Sbjct: 468 GNINEMKGKSNAIQKFRTGFQNCSYFTVAVGALGFLVTAI 507

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 65/135 (48%), Gaps = 4/135 (2%)

Query: 58  DEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANS 117
           + ++KT+   ++ N+    +  Y+ +   M+S   +    T  LS    + +++  +  +
Sbjct: 3   NTIIKTRDSIRS-NFQNISFHRYINLVLIMVSCAFDLINVTAVLSATRDIENTYQIEFTT 61

Query: 118 RSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIV 177
            SW + ++ +    FI   GR+GDI G   + +    +  I SLIC +    G+   F V
Sbjct: 62  ASWALTAYAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAVVNNFGT---FAV 118

Query: 178 SRAFQGLGIAFVLPN 192
            RA QG+  A ++P+
Sbjct: 119 FRALQGIAAAGIVPS 133

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/225 (18%), Positives = 99/225 (44%), Gaps = 10/225 (4%)

Query: 334 LLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGI 393
           L+P+ V+  ++ I I +++F  +G      +   Q+   +   +PL A       ++  +
Sbjct: 303 LIPKDVLMMKNFIPITVAVFANYGCLFSNLYIVNQYCQYVSKNSPLLAAVKLLPLVVSML 362

Query: 394 IAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVH----ETYFRMQMGTMIILSFG 449
           I  +++      +SP   +        +GSI+  +  +H      Y+++   +  +++FG
Sbjct: 363 IPNVVIAIKSDLISPRKAVVLGFFIMFIGSII--LIQLHLITDNLYWKIFFCSQSLIAFG 420

Query: 450 MDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDP-DGKHILK 508
             + FP S  I   + P EY+G+A  ++ T   + + +   +  ++   ++   GK    
Sbjct: 421 AAIFFPYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGNINELSGKSGSA 480

Query: 509 GYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAEDKRSMS 553
           G    ++      +LA  + GL     ++K+++     +D  S+S
Sbjct: 481 GIYKTRFQNCTYFTLASSVVGLISTAFFVKENKP---TDDTGSLS 522

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 71/146 (48%), Gaps = 6/146 (4%)

Query: 84  FTC-MISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDI 142
           F C +I+  L+ +     + ++  +   F        W + S+ +    FI   GR+GDI
Sbjct: 25  FICILIACGLDLASVGAMIVLVTDIETRFNVSHTQSGWALTSYVITFAGFIAFFGRVGDI 84

Query: 143 FGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYV 202
            G   M+ +  V+  I+SL+C +     +   F V RAFQG+  A ++P    ++  ++ 
Sbjct: 85  VGNGIMMCVFSVIFGIFSLLCAVVP---NFIAFTVFRAFQGMAGAGIVPCAYALVNKMFQ 141

Query: 203 GGTFRK--NIVISFIGAMAPIGATLG 226
           G   ++  +I+ S I AMA +G  +G
Sbjct: 142 GPNLQRYFSILSSVISAMAGVGFIIG 167

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 98/477 (20%), Positives = 181/477 (37%), Gaps = 69/477 (14%)

Query: 101 LSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWS 160
           +S+++ LA  +     + SW + S+ +    FI   GR+GDI G   +  +      I S
Sbjct: 49  ISLIDDLAQKYDISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSILFTVSCFFFAILS 108

Query: 161 LICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAP 220
           L+C +     +   F V RA QG+  A ++P    +I  +      +K   I   G  + 
Sbjct: 109 LLCAVMPNFPA---FAVFRAIQGISAAGLVPCAYALIPMLAPEEEVQKYFSIVSCGFSST 165

Query: 221 IGATL---GCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSI------YAIPN------ 265
           IG  L   G F A  IG      +   FY   +T  +  ++SI      Y + N      
Sbjct: 166 IGLGLIIGGAFAATKIG------YKGIFY---LTFAVMFLISIVAFFFTYGVENLSEPPR 216

Query: 266 -NIPTNVHRFSMDWIGSXXXXXXXXXXXX-------XWNQAPI--------------SGW 303
            +  TN  R S+D+IGS                    WN+                   W
Sbjct: 217 KDQATNRVR-SLDFIGSLIFVTGSILIVVGLTEGGESWNRPATYVTLVIGIILFFGFFFW 275

Query: 304 NQAYXXXXXXXXXXXXXXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFT 363
           N +Y                 +E       L+P  V+  ++ I I+L+  F   +  +F+
Sbjct: 276 NCSYARIVRGIRCCGIDTSRYFE---KVQLLIPVDVLFMKNFIPIVLA--FALNNACLFS 330

Query: 364 FYYF--QFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNV 421
             Y   Q+       +PL+AG      +I  +I   L  F   ++ P V +         
Sbjct: 331 CIYIIDQYSQYEEKNSPLYAGVKLVPLIICMVIGNGLCAFESTKLKPKVGVVLGFSLALA 390

Query: 422 GSIMASVTPVH----ETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLV 477
           GSI+  +T +H    + ++++   +  ++ FG+ + +P +  I     P   +G+A  + 
Sbjct: 391 GSII--LTQLHLIKEDMFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDRSKGIASGVA 448

Query: 478 NTVVNYSMSLCLGMGATVEMQLD------PDGKHILKGYRGAQYLGIGLASLACIIS 528
            T     + +   + A+V   +D         +    G++   Y  + + +L  +++
Sbjct: 449 QTFGQLGIEITFSVMASVLGNIDGIRGKSGASQKFRTGFQNCTYFTVAVGALGFLVT 505

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 96/232 (41%), Gaps = 26/232 (11%)

Query: 64  KQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMA 123
           + K QN  Y +      L  F C    LLN +G    +S++  L +++       SW + 
Sbjct: 16  RLKCQNSRY-QLGINITLIFFGCTF-DLLNVAGV---ISVIEDLGETYKLGYTGASWALT 70

Query: 124 SFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQG 183
           S+ +    FI   GR+GDI G   +  I   +  ++SL+C + +   +   F V RA QG
Sbjct: 71  SYAITFAGFIAFMGRLGDIVGNSVLFTISCFLFTLFSLLCAVVRDFPT---FAVFRALQG 127

Query: 184 LGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATL--------------GCFF 229
           +  A ++P    +I  +      +K   I   G  + IG  L              G F+
Sbjct: 128 ISAAGIVPCGYALIPLLAEPQDIQKFFSIVSCGFSSTIGIGLIVGGAFALTKVGYAGIFY 187

Query: 230 AGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFSMDWIGS 281
               G M       +FY Y I     L + +  IP++ P      S+D++GS
Sbjct: 188 LSFAG-MLVVSIAASFYTYRIEERKFLEVKVEDIPHDHPKVA---SLDFVGS 235

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 65/123 (52%), Gaps = 11/123 (8%)

Query: 65  QKWQNPNYF--KYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLM 122
           QK+   N    K+P      +F+  +   L+   +T   +IMN +A+ F S+++ + W+ 
Sbjct: 24  QKYHEYNLALPKFP-----ILFSLWLGSFLSSLDSTIVANIMNRVAEDF-SESSRKQWIA 77

Query: 123 ASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQ 182
            SF L + +F  + G++ DI G K+ LLI       + L C LT ++ + T F ++RA  
Sbjct: 78  TSFLLTNTAFQPLYGKLSDITGRKSALLIAQ---FFFGLGCLLTCFARNVTEFSIARAIC 134

Query: 183 GLG 185
           G+G
Sbjct: 135 GIG 137

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 78/172 (45%), Gaps = 11/172 (6%)

Query: 107 LADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLT 166
           L   F  D N  +  +  + L  G    +SG + D+FG + ++L G V+ ++ S+     
Sbjct: 128 LEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASIGLACA 187

Query: 167 KYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLG 226
              G   F    R  Q +GI+  +    G++G+  +     K+   +F+GA + +   LG
Sbjct: 188 PSYGVICFL---RCIQSIGISPTIAISSGVVGDFTL-----KHERGTFVGATSGL-VLLG 238

Query: 227 CFFAGLIGTMNPNQWPWA--FYAYTITAVINLILSIYAIPNNIPTNVHRFSM 276
             F  LIG +   +W W   F+   I + + LI++ + +P    T V   S+
Sbjct: 239 QCFGSLIGAVLTARWDWRAIFWFLAIGSGVALIVAAFTLPETKRTIVGNLSI 290

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 77/172 (44%), Gaps = 11/172 (6%)

Query: 107 LADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLT 166
           L   FG D N  +  +  + L  G    ISG + D+FG + ++LIG ++ ++ S+     
Sbjct: 117 LEKQFGLDENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVILIGMLIYVVASIGLACA 176

Query: 167 KYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLG 226
              G   F    R  Q +GI+  +    G++G+  +     K+   +F+GA + +   LG
Sbjct: 177 PSYGVIVFL---RIIQSIGISPTIAISSGVVGDFTL-----KHERGTFVGATSGL-VLLG 227

Query: 227 CFFAGLIGTMNPNQWPWA--FYAYTITAVINLILSIYAIPNNIPTNVHRFSM 276
             F  LIG +    W W   F+  TI    + I++   +P    T V   S+
Sbjct: 228 QCFGSLIGAVLAAAWNWRAIFWFLTIGCGTSFIIAFLLLPETKRTLVGNLSI 279

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 62/136 (45%), Gaps = 10/136 (7%)

Query: 57  EDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDAN 116
            + +   +++ QN  Y +      L    C    LLN +G    +S++  L +++G +  
Sbjct: 13  SEGIYNLRRRCQNSKY-QLIINMALIFLGCTF-DLLNVAGV---ISVIEDLGETYGLEYT 67

Query: 117 SRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICG-LTKYSGSDTFF 175
           + SW + S+ +     I   GR+GDI G   +  I      ++ L+C  +T +      F
Sbjct: 68  TASWALTSYAITFAGLIAFMGRLGDIIGNSVLFTISGFFFSLFCLLCAVVTNFPA----F 123

Query: 176 IVSRAFQGLGIAFVLP 191
            V RA QG+  A ++P
Sbjct: 124 AVLRALQGIAAAGLVP 139

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 61/139 (43%), Gaps = 17/139 (12%)

Query: 113 SDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSD 172
           +D N   WL+  + L S  F L+ GRM  + GLK  L++  ++  I SLI  ++   G  
Sbjct: 75  NDYNDVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIAAVSNSMG-- 132

Query: 173 TFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTF----RKNIVISFIGAMAPIGATLGCF 228
              I  R   G G +       GI   VY+ GT     R   ++  +   A +G+  G  
Sbjct: 133 -MLIAGRVVAGAGGS-------GIQSLVYIVGTSLVSERSRGMVIMVLTFAFVGSNAGGP 184

Query: 229 FAGLIGTMNPN-QWPWAFY 246
             G  G +N +  W W F+
Sbjct: 185 ILG--GALNEHASWRWCFF 201

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 111/270 (41%), Gaps = 33/270 (12%)

Query: 12  NPEVKTAGKEEDYLEI--------ENEVALEAEDSSPRNNK--EGALTTIVLTNSEDEVM 61
           NP      KE D  +I        +++ + E + S  RN K  E A T +     E E+ 
Sbjct: 43  NPNENRLEKESDMTDISEIKDTDFDSDKSKEEQSSIVRNEKHPETAFTAL-----EPEIA 97

Query: 62  KTKQKWQNPNYFKYPWQEYLFIFTCMIS-QLLNQSGTTQTLSIMNILADSFGSDANSRSW 120
                  NP Y  +   + + I   +I    L        +  + IL   F +   + + 
Sbjct: 98  ------YNPPYSAFSNYQVVSILLIIIYIGFLGPVTGNIYIPALPILQSEFNTSTTAING 151

Query: 121 LMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWS--LICGLTKYSGSDTFFIVS 178
            +A+F  V      +     D FG +  L I  +MI + +  L+  + K+  +     + 
Sbjct: 152 TVAAFMGVFAVGPFLWAVHAD-FGGRKFLYIFSLMIALIANVLLAAVPKHLAA---LYIL 207

Query: 179 RAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGA-MAPIGATLGCFFAGLIGTMN 237
           R FQ +G + V+P  +G + ++       K +    +G  M PI   LG  F GLI  MN
Sbjct: 208 RVFQAIGTSAVIPLGVGTVSDLISPMNRAKGVSYFMLGPNMGPI---LGPIFGGLI-LMN 263

Query: 238 PNQWPWAFYAYTITAVINLILSIYAIPNNI 267
            NQW W F   +IT  + LIL +  +P  +
Sbjct: 264 GNQWRWLFGFTSITTGVGLILIVTFLPETL 293

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 52/106 (49%), Gaps = 11/106 (10%)

Query: 80  YLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRM 139
           YL IF   I   +  + +    S  N L+          SW+  S+ L S +F  + G++
Sbjct: 118 YLGIFLAAIDNTIVSTTSAHVASEFNQLSKV--------SWIATSYLLSSATFQPLYGKV 169

Query: 140 GDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLG 185
            DIFG K +L+   V  +I  L+CGL+K   S  + +++R   G+G
Sbjct: 170 SDIFGRKCLLVFTNVAFLIGCLMCGLSK---SFWWLVIARFVAGVG 212

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 65/141 (46%), Gaps = 6/141 (4%)

Query: 27  IENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTC 86
           + N +  E  +  P         T  L  SEDE  +  Q  +         + ++ I + 
Sbjct: 13  VRNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSEMSRA-----RLHIIISSM 67

Query: 87  MISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLK 146
            +   L     T   ++++ +A  F ++ +  SW+  ++ L S +F  + G++ DIFG +
Sbjct: 68  CLGSFLAALDNTIVTTLLSHIASEF-NELSHISWIATAYLLSSATFQPLYGKISDIFGRR 126

Query: 147 NMLLIGYVMIIIWSLICGLTK 167
            +++I  +  I+  LICGL+K
Sbjct: 127 PLIIISNLFFILGCLICGLSK 147

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 40/69 (57%), Gaps = 3/69 (4%)

Query: 102 SIMNILADSFGSDANSR---SWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIII 158
           +I+  L D   S+ N     SW+  ++ L S +F  + G++ DIFG + +L+   ++  +
Sbjct: 158 TIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCL 217

Query: 159 WSLICGLTK 167
            +LICG++K
Sbjct: 218 GALICGMSK 226

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (43%), Gaps = 22/170 (12%)

Query: 86  CMISQLLNQSGTTQTLSIMNILADSFG---SDANSRSWLMASFPLVSGSFILISGRMGDI 142
           C+IS LL        + I+  L D+ G    D  +  WL+  + L +  F+L+ GR+ +I
Sbjct: 10  CVISLLLTLFLAALDIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEI 69

Query: 143 FGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYV 202
            G K  L+I  ++  I SLI  L   S S    I  R   G G +       GI    +V
Sbjct: 70  LGTKECLMISVIVFEIGSLISAL---SNSMATLISGRVVAGFGGS-------GIESLAFV 119

Query: 203 GGT--FRKN---IVISFIGAMAPIGATLGCFFAGLIGTMNPN-QWPWAFY 246
            GT   R+N   I+I+ +     I   +G F     G  N +  W W FY
Sbjct: 120 VGTSIVRENHRGIMITALAISYVIAEGVGPFIG---GAFNEHLSWRWCFY 166

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 67/147 (45%), Gaps = 10/147 (6%)

Query: 101 LSIMNILADSFGSDANSR-SWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIW 159
           ++I+N +AD F  +A S+  WL+  + L +  F L+ GR   IFG K  L++  ++  I 
Sbjct: 41  VTILNTIADKF--NAYSKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIG 98

Query: 160 SLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMA 219
           SL+  +   S S    I  R   G G + +   V  I  ++    T  +  +++ +    
Sbjct: 99  SLVIAV---SNSMDMIIGGRVIAGCGASGIQTLVFAIATSLVDEHT--RGTIVTLLSLSY 153

Query: 220 PIGATLGCFFAGLIGTMNPNQWPWAFY 246
            + + LG +  G +       W W FY
Sbjct: 154 AVASALGPYIGGAL--TEYVTWRWCFY 178

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 82/181 (45%), Gaps = 25/181 (13%)

Query: 9   VIQNPEVKTAGKEEDYLEIENEVALEAEDSSPRNNKEGALT-TIVLTNSEDEVMKTKQKW 67
           ++Q+      G     +E   E+  EA  +S +++  G++  +I+L N ++ +  T+ + 
Sbjct: 37  LLQDSSFSLPGFVAAEIEEREELYREASIASNQHHDYGSVANSIILDNDKNNLSPTRLRL 96

Query: 68  QNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSR---SWLMAS 124
              +        YL IF   +S L N        +I++ L    GS+ N     SW+  +
Sbjct: 97  AMSSM-------YLGIF---LSALDN--------TIVSTLLARIGSEFNELPRISWIATA 138

Query: 125 FPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGL 184
           + L S +F  + G++ DIFG K +L    V   I  LICG  K   S    ++ R   G+
Sbjct: 139 YLLSSATFQPLYGKISDIFGRKIVLTFCNVNFFIGCLICGTAK---SFWVLVIGRFISGV 195

Query: 185 G 185
           G
Sbjct: 196 G 196

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 62/126 (49%), Gaps = 9/126 (7%)

Query: 55  NSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSD 114
           N ++  ++ +    N +  K P      +F+  +   L     T   +IMN +A+ F  +
Sbjct: 31  NRKNSSLEEEYHKHNLDLPKLP-----IVFSLWMGSFLGALDGTIVANIMNRVAEEF-QE 84

Query: 115 ANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTF 174
           ++ + W+  SF L + +F  + G++ DI G K  LL+ +     + L C LT ++ + T 
Sbjct: 85  SDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFALLVAHTF---FCLGCLLTCFARNVTE 141

Query: 175 FIVSRA 180
           F ++RA
Sbjct: 142 FSIARA 147

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 67/330 (20%), Positives = 134/330 (40%), Gaps = 27/330 (8%)

Query: 92  LNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLI 151
           L  +  T   +IM  +A  F ++    SW+  ++ L S +F  + G++ DIFG K +L++
Sbjct: 91  LAAADGTLVSTIMAHIASEF-NELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLML 149

Query: 152 GYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNV--YVGGTFRKN 209
             ++ ++  L+CGLT    S    + +R   G+G   V       I ++         + 
Sbjct: 150 NNIVFLVGCLMCGLTP---SFWGLVGARFISGIGGGGVTSMCSITISDIVPLRDRALYQG 206

Query: 210 IVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFY-AYTITAVINLILSIY-AIPN-- 265
           +   F G     G  +G +F+   G      W  AF     ++A+ +L+++++  +P   
Sbjct: 207 MCNFFFGLGTACGGVVGGWFSDHGG-----GWRMAFLIQVPLSALSSLLIAVFMKLPPRS 261

Query: 266 ---NIPTNVHR--FSMDWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXXXXXXXXXXX 320
              N P ++     S+DWIG+                A + G   A+             
Sbjct: 262 KRVNSPASIKNKLLSVDWIGASALVVFLSLFLV---TASLGGKEIAFNSKTFVALCIGSS 318

Query: 321 XXXXY----EIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHY 376
               +    E++ AK P+LP + +++R ++    S +F   +    ++Y   +   + + 
Sbjct: 319 LACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNM 378

Query: 377 TPLWAGGSYFMFLIWGIIAALLVGFSIKRV 406
            P   G           + +L  G+ +KR 
Sbjct: 379 NPTRVGKRLMPNFFSTALGSLGAGYYMKRT 408

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 3/90 (3%)

Query: 98  TQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMII 157
           +  +S+++ L+  +     + SW + S+ +    FI   GR+GDI G   +  +      
Sbjct: 46  SSMISLIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFA 105

Query: 158 IWSLICGLTKYSGSDTFFIVSRAFQGLGIA 187
           I SL+CGL     +   F V RA QG+  A
Sbjct: 106 ILSLLCGLMPNFEA---FAVMRALQGIAAA 132

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 101/227 (44%), Gaps = 19/227 (8%)

Query: 54  TNSEDEVMKTKQ-KWQNPNYFKYPWQEYLFIFTCM-ISQLLNQSGTTQTLSIMNILADSF 111
           TNS+  + +T++ +  N +  K P      I T + +   L     +   +IMN +A+ F
Sbjct: 22  TNSDKTLTETQRCQEHNRSLPKAP------ILTSLWLGSFLASIDASIVANIMNKIAEEF 75

Query: 112 GSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGS 171
             +++ + W+  SF L + +F  + GR  DI G K  LLI     ++ +L   LT ++ +
Sbjct: 76  -HESDKKQWMATSFLLTNAAFQPLYGRCSDIVGRKCALLIAQSFFLLGTL---LTCFARN 131

Query: 172 DTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAG 231
            T F ++RA  G+G   +       + ++    T  + +   +   +   G  LG    G
Sbjct: 132 VTEFAIARAICGMGGGGIGAMSSITVSDICT--TKERGMYQGYANVIFGAGQVLGAPVGG 189

Query: 232 LIGTMNPNQWPWAFYAYTITAVINLILSIYAIP---NNIPTNVHRFS 275
           LI  M    W   F A  +  +I +IL+   I     +IP    RF+
Sbjct: 190 LI--METFNWRIIFAAQVVAIMICMILAYRNINLKLLHIPPFHQRFT 234

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 88/201 (43%), Gaps = 16/201 (7%)

Query: 54  TNSEDEVMKTKQKWQNPNYFKYPWQEYL----FIFTCMISQLLNQSGTTQTL----SIMN 105
           T++E      K+   N  Y K    E L     ++TC  S  L        +    +I+ 
Sbjct: 44  TDAEVSNHVEKKPNFNSKYGKNAMGEDLPSGIVLYTCAFSLALAIFLAALDIMIVSTIIE 103

Query: 106 ILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGL 165
            +A  FG+ + +  W+ A + L +    L+ GR+  I G K+ +L   ++  I SLI G+
Sbjct: 104 DVAKKFGAYSKT-GWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSLISGV 162

Query: 166 TKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATL 225
              + S    I  R   G+G + +  ++  +IG+  V    R+ ++I+ + +   + + +
Sbjct: 163 ---ANSMNMLIGGRVIAGVGGSGI-QSLAFVIGSNLVDER-RRGLIIACMSSAFAVASVI 217

Query: 226 GCFFAGLIGTMNPNQWPWAFY 246
           G F  G   T     W W FY
Sbjct: 218 GPFLGGAFTTH--ATWRWCFY 236

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 72/165 (43%), Gaps = 12/165 (7%)

Query: 86  CMISQLLNQSGTTQTLSIMNILADSFG---SDANSRSWLMASFPLVSGSFILISGRMGDI 142
           C+ S LL        + I+  L D+ G    D  +  WL+  + L +  F+L+ GR+ +I
Sbjct: 10  CITSLLLTLFLAALDIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEI 69

Query: 143 FGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYV 202
            G    L+I  V+  I SLI  L+   G+     V   F G GI     ++  ++G   V
Sbjct: 70  LGTTECLMISVVIFEIGSLISALSNTMGTLIGGRVIAGFGGSGI----ESLAFVVGTSIV 125

Query: 203 GGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPN-QWPWAFY 246
              +R  I+I+ +     I   +G F     G  N +  W W FY
Sbjct: 126 QENYR-GIMITALAVSYVIAEGVGPFIG---GAFNEHLSWRWCFY 166

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 66/145 (45%), Gaps = 8/145 (5%)

Query: 102 SIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSL 161
           +I++++A+ FG+ + +  WL+  + L +    LI GR   I G ++ L++  ++    SL
Sbjct: 59  TIIDVVAEQFGNYSKT-GWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSL 117

Query: 162 ICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPI 221
           I  L   + S    I  R   G+G    L  +  +IG   VG   R  +VIS +     +
Sbjct: 118 IAAL---ASSMNMLIFGRVVAGVG-GSGLQTLCFVIGCTMVGERSRP-LVISILSCAFAV 172

Query: 222 GATLGCFFAGLIGTMNPNQWPWAFY 246
            A +G    G   T     W W FY
Sbjct: 173 AAIVGPIIGGAFTT--HVTWRWCFY 195

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 30/48 (62%)

Query: 119 SWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLT 166
           SW+  ++ L S +F  + G++ DIFG K +L+   VM  +  LICGL+
Sbjct: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 73/173 (42%), Gaps = 6/173 (3%)

Query: 326 EIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQ--FQLNIRHYTPLWAGG 383
           E + +K P+LP A +K+R ++   L+ +F     G+ T  YF   +   + +  P   G 
Sbjct: 382 ETYVSKDPILPVAFLKNRTILGSSLANWFSM--MGMMTTSYFLPVYWAGVLNMKPTDMGK 439

Query: 384 SYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFN-VGSIMASVTPVHETYFRMQMGT 442
                     + +L  G+ +K+     +L  A  A   VG +  S+   +   +R Q   
Sbjct: 440 RTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWR-QYIL 498

Query: 443 MIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATV 495
           ++I  FG+ +    + +     +P E+Q    S+     +   +L + +G  +
Sbjct: 499 LVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAI 551

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 95/228 (41%), Gaps = 14/228 (6%)

Query: 53  LTNSED-EVMKTKQKWQNP-NYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADS 110
           L +++D + +K  Q++  P   F Y  Q+++ +    +    +  G+      +  L   
Sbjct: 74  LESADDVKTIKDSQEYVAPYTLFSYS-QKWIMVGLLTMCGFWSSLGSPIYYPALRQLEKQ 132

Query: 111 FGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSG 170
           F  D N  +  +  + L  G    + G + DI+G + ++L G ++ I+ S+        G
Sbjct: 133 FDIDENLVNVTVVVYLLFQGISPTVCGGLADIYGRRPVILFGMLVYIVASIALACANSYG 192

Query: 171 SDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFA 230
              F    R  Q  GI+ ++    G +G+  +     K    +F+GA++ +   LG  F 
Sbjct: 193 VIIFL---RCLQSCGISPIIAISSGCVGDFTM-----KAERGTFVGAVSGL-VLLGQAFG 243

Query: 231 GLIGTMNPNQWPWA--FYAYTITAVINLILSIYAIPNNIPTNVHRFSM 276
            LIG      W W   F+   I A   L + I  +P    T V   S+
Sbjct: 244 SLIGAALAAAWDWRAIFWFLAIGAGCCLFVGILVLPETKRTIVGNMSI 291

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 74/170 (43%), Gaps = 22/170 (12%)

Query: 86  CMISQLLNQSGTTQTLSIMNILADSFG---SDANSRSWLMASFPLVSGSFILISGRMGDI 142
           C+IS LL        + I+  L D+ G    D  +  WL+  + L +  F+L+ GR+ +I
Sbjct: 10  CIISLLLTLFLAALDIVIVVTLYDTIGIKFHDFGNIGWLVTGYALTNAVFMLLWGRLAEI 69

Query: 143 FGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYV 202
            G    L+I  ++  + SLI  L+   G+    I  R   G G +       GI    +V
Sbjct: 70  LGTNECLMISVIIFEVGSLISALSNSMGT---LISGRLIAGFGGS-------GIESLAFV 119

Query: 203 GGT--FRKNIVISFIGAMAP---IGATLGCFFAGLIGTMNPN-QWPWAFY 246
            GT   ++N   + I A+A    I   +G F     G  N +  W W FY
Sbjct: 120 VGTSIVQENHRGTMITALATSYVIAEGVGPFIG---GAFNEHLSWRWCFY 166

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 62/149 (41%), Gaps = 20/149 (13%)

Query: 104 MNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLIC 163
           + ++A+ F  D +   W+++ + L      L+ GR   I G K+ LL+  ++    SLI 
Sbjct: 142 IEVIAEQF-KDYSKSGWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGSLIS 200

Query: 164 GLTKYSGSDTFFIVSRAFQGLG------IAFVLPNVLGIIGNVYVGGTFRKNIVISFIGA 217
            +   S S    I  R   G+G      + FV+ + L             + I+IS +  
Sbjct: 201 AI---SNSMNMLIGGRVVAGIGGSGIQSLCFVIASTL--------TPDRSRVIIISVLSC 249

Query: 218 MAPIGATLGCFFAGLIGTMNPNQWPWAFY 246
              + A +G F  G + T     W W FY
Sbjct: 250 SYAVAAVVGPFLGGALTTH--VTWRWCFY 276

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 61/143 (42%), Gaps = 10/143 (6%)

Query: 107 LADSFGSDANSRS---WLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLIC 163
           L D+ G + N  +   WLMA + L +  F+L+ GR+  + GLK  L+   V+    SL+ 
Sbjct: 30  LYDTIGQEFNDYANVGWLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAGSLMA 89

Query: 164 GLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGA 223
           G     G     I +R   G G + +   V G +G   V    R   VI+ +G    +  
Sbjct: 90  GAANSMG---MLIGARVISGFGGSGIESLVYG-VGTSIVEEKHRAR-VITVLGIAYMLAE 144

Query: 224 TLGCFFAGLIGTMNPNQWPWAFY 246
             G F  G  G      W W FY
Sbjct: 145 GAGPFVGG--GLAEHVSWRWCFY 165

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 65/145 (44%), Gaps = 8/145 (5%)

Query: 102 SIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSL 161
           +I+  +A  FG D +   W+ A + L S    LI GR+  + G K+ +L   ++  + SL
Sbjct: 77  TIIENVAREFG-DYSKTGWIYAGYSLPSALLTLIWGRIAAVCGFKSSMLTAIIIFEVGSL 135

Query: 162 ICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPI 221
           +  L   + S    I  R   GLG + +      II  +      ++ ++I+ +G+   I
Sbjct: 136 VAAL---ANSMDMLIGGRVIAGLGGSGIQTLCFVIISTLVEES--KRGLLIACMGSAFGI 190

Query: 222 GATLGCFFAGLIGTMNPNQWPWAFY 246
            + +G F  G   T     W W F+
Sbjct: 191 ASVVGPFLGGAFTT--HVTWRWCFW 213

>Suva_4.275 Chr4 complement(487620..489671) [2052 bp, 683 aa] {ON}
           YBR043C (REAL)
          Length = 683

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 41/204 (20%), Positives = 80/204 (39%), Gaps = 20/204 (9%)

Query: 40  PRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQ 99
           PRN + G L  + +      + + K     P     P  + + +F    S ++   GT+ 
Sbjct: 78  PRNERRGLLPQLSI------IPEFKDARDYP-----PMMKKMIVFLIAFSSMMGPMGTSI 126

Query: 100 TLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIW 159
               +N +   F +     +  +  + L  G F L    + ++ G +   +  + M+  +
Sbjct: 127 IFPAINAITTEFKTSVIMVNVSIGVYLLSLGVFPLWWSSLSELEGRRTTYITSFAMLFAF 186

Query: 160 SLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMA 219
           S+   L     S   FI  R   G   A V     G + ++Y+     KN+   ++G + 
Sbjct: 187 SIGSALAPDINS---FIALRMLCGAASASVQSVGAGTVADLYISEDRGKNLSYYYLGPL- 242

Query: 220 PIGATLGCFFAGLIGTMNPNQWPW 243
                L    + +IG++  N+WPW
Sbjct: 243 -----LAPLLSPIIGSLLVNRWPW 261

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 30/48 (62%)

Query: 119 SWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLT 166
           SW+  ++ L S +F  I G++ DIFG K +L+   +   + SLICGL+
Sbjct: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 92/204 (45%), Gaps = 11/204 (5%)

Query: 47  ALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNI 106
           ++ ++ +  S+ +  +T ++    N F  P  + + ++ C  +  L        + I+  
Sbjct: 21  SVDSVQVHTSKTDTAQTLEEEVEYNEFGQPLPKGIILWACTGALALANFLAALDIMIVTT 80

Query: 107 LADSFGS--DANSRS-WLMASFPLVSGSFILISGRMG-DIFGLKNMLLIGYVMIIIWSLI 162
           + +  G+  DA +++ W++A + L +    L+ GR+     G K  +L   V+  I SLI
Sbjct: 81  IINDVGAHFDAYAKTGWIIAGYSLPNALMSLLWGRIAFSFLGFKTAMLSAIVIFEIGSLI 140

Query: 163 CGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIG 222
           C L   + S    I  R   G+G + +  ++  +IG+  V    R   +I+F+ A   I 
Sbjct: 141 CAL---ANSMDMLIGGRVIAGIGGSGI-QSLSFVIGSTLVSPRGR-GFIIAFMSASFGIA 195

Query: 223 ATLGCFFAGLIGTMNPNQWPWAFY 246
           + +G F  G     +   W W F+
Sbjct: 196 SVIGPFIGG--AFTSHVTWRWCFW 217

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 70/165 (42%), Gaps = 11/165 (6%)

Query: 107 LADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLT 166
           L   F  D N  +  +  + L  G    ISG + D FG + ++L G ++ ++ S+     
Sbjct: 127 LEKQFNVDENMINITVVVYLLFQGVSPTISGGLADCFGRRPIILAGMLIYVVASIGLACA 186

Query: 167 KYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLG 226
              G   F    R  Q +GI+  +    G++G+  +     K+   +F+GA +     LG
Sbjct: 187 PSYGVIIFL---RCIQSIGISPTIAISSGVVGDFTL-----KHERGTFVGATSGF-VLLG 237

Query: 227 CFFAGLIGTMNPNQWPWA--FYAYTITAVINLILSIYAIPNNIPT 269
             F  LIG +   +W W   F+  TI      +++   +P    T
Sbjct: 238 QCFGSLIGAVLTARWDWRSIFWFLTIGCGSCFLIAFLVLPETKRT 282

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 60/137 (43%), Gaps = 9/137 (6%)

Query: 107 LADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLT 166
           L   F  D N  +  +  + L  G    +SG + D FG + ++L G ++ +I S+     
Sbjct: 127 LEKQFNVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRRPIILAGMLIYVIASIGLACA 186

Query: 167 KYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLG 226
              G   F    R  Q +GI+  +    G++G+  +     K+   +F+GA +     LG
Sbjct: 187 PSYGVIIFL---RCIQSIGISPTIAISSGVVGDFTL-----KHERGTFVGATSGF-VLLG 237

Query: 227 CFFAGLIGTMNPNQWPW 243
             F  LIG +   +W W
Sbjct: 238 QCFGSLIGAVLTARWDW 254

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 66/145 (45%), Gaps = 8/145 (5%)

Query: 102 SIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSL 161
           +I+  +A  FGS  +   WL   + L +    LI GR+    G K  +L   V+  I SL
Sbjct: 89  TIIEEVAKQFGS-YSEIGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIGSL 147

Query: 162 ICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPI 221
           I  L   + S +  I  R   G+G    + ++  +IG+  V  + ++ I+I+ +     I
Sbjct: 148 ISAL---ANSMSMLIGGRVIAGVG-GCGIQSLSFVIGSTLVEES-QRGILIAVLSCSFAI 202

Query: 222 GATLGCFFAGLIGTMNPNQWPWAFY 246
            + +G F  G+    +   W W FY
Sbjct: 203 ASVVGPFLGGVF--TSSVTWRWCFY 225

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 37.7 bits (86), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 60/137 (43%), Gaps = 9/137 (6%)

Query: 107 LADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLT 166
           L   F  D N  +  +  + L  G    +SG + D FG + ++L G ++ ++ S+     
Sbjct: 126 LEKQFNVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRRPIILAGMLIYVVASIGLACA 185

Query: 167 KYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLG 226
              G   F    R  Q +GI+  +    G++G+  +     K+   +F+GA +     LG
Sbjct: 186 PSYGVIIFL---RCIQSIGISPTIAISSGVVGDFTL-----KHERGTFVGATSGF-VLLG 236

Query: 227 CFFAGLIGTMNPNQWPW 243
             F  LIG +   +W W
Sbjct: 237 QCFGSLIGAVLTARWDW 253

>Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W
           (REAL)
          Length = 560

 Score = 37.7 bits (86), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 91/231 (39%), Gaps = 13/231 (5%)

Query: 39  SPRNNKEGALTTIVLTNS---EDEV-MKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQ 94
           SP  NK+G   +I +T +   ED   ++   K ++    + P   ++   T   +  L+ 
Sbjct: 9   SPNKNKDGIYGSIEVTETSLVEDNADIEDVDKDEDMALSRIP-NLWIIEATLFSNVFLSG 67

Query: 95  SGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYV 154
              T T S    + + F   + S +W+  ++ + S SF  + G   D  G +N L     
Sbjct: 68  FDGTVTASTYQTIGNEFNQMSIS-NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANA 126

Query: 155 MIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISF 214
              I  L C L     S   + +S      GI       L  I N  V  + ++ I  +F
Sbjct: 127 AFTIGCLACSL-----STNIYTLSLMRALAGIGGGGLITLSTIVNSDVIPSSKRGIFQAF 181

Query: 215 IGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPN 265
              +   GA  G  F G I +     W W F      ++I+ +L  Y +PN
Sbjct: 182 QNLLLGFGAICGASFGGTIASTI--GWRWCFLIQVPISIISSVLMNYYVPN 230

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 37.7 bits (86), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 54/264 (20%), Positives = 107/264 (40%), Gaps = 19/264 (7%)

Query: 17  TAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQN-PNYFKY 75
           T  K  DY ++   ++    +    ++     T+   ++ E E     +  QN P+    
Sbjct: 31  TITKWRDYQKLHGTISRTTTNELGDDD-----TSSECSHDEQEQQHIVEGEQNYPHTLLT 85

Query: 76  PWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILI 135
             Q++  +F   I+   +  G+      +  L   F  D N  +  +  + L  G    I
Sbjct: 86  YRQKWFMVFLMTITGFWSSLGSPIYYPALKELEQKFNIDENKVNVTVVVYLLFQGVAPAI 145

Query: 136 SGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLG 195
           SG + D++G + ++L G ++ ++ S+  G+ K + S    +  R  Q +GI+  +    G
Sbjct: 146 SGGLADVYGRRPVILGGMLIFVVASI--GIAK-APSYGVIVFLRCIQSIGISPTIAISSG 202

Query: 196 IIGNVYVGGTFRKNIVISFIGA---MAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITA 252
           ++ +  V     K    +F+GA   +  IG  +G     +I       W   F+  TI  
Sbjct: 203 VVSDFTV-----KRERGTFVGATSGLVLIGQGIGPLLGAVITAA--LHWRAVFWFLTIGC 255

Query: 253 VINLILSIYAIPNNIPTNVHRFSM 276
              +I+  + +P    T V   S+
Sbjct: 256 GSCMIIGFFLLPETKRTIVGNLSI 279

>CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065w
          Length = 592

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 58/137 (42%), Gaps = 9/137 (6%)

Query: 107 LADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLT 166
           L   F  D N  +  +  + L  G     SG + D FG + +LLIG ++ ++ S+     
Sbjct: 126 LEKQFDIDENMVNITVVVYLLFQGLAPTCSGGLADKFGRRPVLLIGMLIYVVASIGLACA 185

Query: 167 KYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLG 226
              G   F    R  Q +GI+  +    G++G+  V     K+   +F+GA +     LG
Sbjct: 186 PSYGVIVFL---RCVQSIGISPSIAISSGVVGDFTV-----KSERGTFVGATSGF-VLLG 236

Query: 227 CFFAGLIGTMNPNQWPW 243
             F  LIG      W W
Sbjct: 237 QAFGSLIGAALAAAWDW 253

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 58/127 (45%), Gaps = 7/127 (5%)

Query: 120 WLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSR 179
           WL   + L +   +LI GR+    G K  +L   V+  I SLI  L   + S    I  R
Sbjct: 100 WLFTGYSLPNALLVLIWGRIATPIGFKATMLFAIVIFEIGSLISAL---ASSMNMLIGGR 156

Query: 180 AFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPN 239
              G+G    + ++  +IG+  V  + ++ ++I+ + +   I + +G F  G+    +  
Sbjct: 157 VIAGIG-GCGIQSLSFVIGSTLVEES-KRGMLIAILSSSFAIASVVGPFLGGVF--TSSV 212

Query: 240 QWPWAFY 246
            W W FY
Sbjct: 213 TWRWCFY 219

>Smik_8.117 Chr8 (181800..183344) [1545 bp, 514 aa] {ON} YHR048W
           (REAL)
          Length = 514

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 60/267 (22%), Positives = 107/267 (40%), Gaps = 35/267 (13%)

Query: 10  IQNPEVKTAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIV----LTNSED--EVMKT 63
           +Q+   K   +E   + ++ E  L+ E SS RN+  G    ++    L + ED    M T
Sbjct: 10  MQSLSSKLTEEEHCSILLDREAKLDLELSSERNDDGGKEHEVIFREDLADPEDIARHMST 69

Query: 64  KQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMA 123
            +++         +   L  FT M+  +++ S T  +  I+     S   + ++    + 
Sbjct: 70  VRRY---------YISSLITFTSMVITMISSSWTLPSAHIIKSFHIS--HEVSTLGITLY 118

Query: 124 SFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQG 183
            F L  G   L    + +++G +   L    + IIW     LT +S + T  +  R   G
Sbjct: 119 VFGLGIGPLFL--SPLSELYGRRITFLYALTLSIIWQC---LTIWSRTITGVMFGRFLSG 173

Query: 184 L-GIAFVLPNVLGIIGNVYVGGTFRKN---IVISFIGAMAPIGATLGCFFAGLIGTMNPN 239
             G AF     L + G   +   F K+   I ++     A +G +LG    G    +   
Sbjct: 174 FFGSAF-----LSVAGGA-IADIFDKDQIGIPMAIYTTSAFLGPSLGPIIGG---ALYHE 224

Query: 240 QWPWAFYAYTITAVINLILSIYAIPNN 266
            + W F    IT+   L+L ++ IP  
Sbjct: 225 SYKWTFITLLITSGCCLVLIMFTIPET 251

>SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180W DTR1
           Multidrug resistance dityrosine transporter of the major
           facilitator superfamily essential for spore wall
           synthesis facilitates the translocation of bisformyl
           dityrosine through the prospore membrane
          Length = 596

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 52/241 (21%), Positives = 101/241 (41%), Gaps = 12/241 (4%)

Query: 33  LEAEDSSPRNNKEG---ALTTIVLTNSEDEVMKTKQKWQNPN-YFKYPWQEYLFIFTCMI 88
           +E+E+   + +KE           T++E+  +K+  + + P  Y  +  ++ L IF  +I
Sbjct: 87  IESEEDIEKKSKEELKIEKRIATATSTEETSLKSANRSKEPPPYTAFSKKQRLIIFLVII 146

Query: 89  -SQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKN 147
               L        +  + +L +SF   A + +  ++ F  V     L      D  G K 
Sbjct: 147 YVGFLGPLSGNIYIPALPLLQESFNVSATTINATVSVFMAVFSVGPLFWALFADFGGRKF 206

Query: 148 MLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFR 207
           + ++  ++ II +++      +    FF+  R  Q  G + V+   +G + ++    +  
Sbjct: 207 LYIVSLLLTIIVNILLSAVPTNIGALFFL--RIAQAFGSSSVMSLGIGTVSDITPPKSRG 264

Query: 208 KNIVISFIGA-MAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNN 266
           + +    +G  M PI   L    AGLI  M+ N W W F    I + I L L +  +P  
Sbjct: 265 RAVSYFMLGPNMGPI---LAPIIAGLI-LMSSNNWRWLFGFICIISGIALFLVVLLLPET 320

Query: 267 I 267
           +
Sbjct: 321 L 321

>Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 48/246 (19%), Positives = 94/246 (38%), Gaps = 24/246 (9%)

Query: 26  EIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFT 85
           EIE ++  E    S  +  + +L     T +   ++   QKW               +  
Sbjct: 59  EIEGDLESETSSHSGDDKLDPSLPITTETGAPYTLLSYGQKWG-------------MVAV 105

Query: 86  CMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGL 145
             +    +  G+      +  L   F  D N  +  +  + +  G    + G + D FG 
Sbjct: 106 LTMCGFWSSLGSPIYYPALRQLEKEFNVDENMINITVVVYLMFQGIAPTVCGGLADCFGR 165

Query: 146 KNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGT 205
           + ++L G ++ ++ S+        G   F    R  Q +GI+  +    G++G+  +   
Sbjct: 166 RPIILGGMLVYVVASVGLACAPSYGVIIFL---RCVQSIGISPTIAISSGVVGDFTL--- 219

Query: 206 FRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWA--FYAYTITAVINLILSIYAI 263
             K+   +F+GA +     LG  F  LIG +   +W W   F+  TI      +++ + +
Sbjct: 220 --KHERGTFVGATSGF-VLLGQCFGSLIGAVLTARWDWRSIFWFLTIGCGTCFLIAFFIL 276

Query: 264 PNNIPT 269
           P    T
Sbjct: 277 PETKRT 282

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/124 (20%), Positives = 58/124 (46%), Gaps = 3/124 (2%)

Query: 42  NNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTL 101
           +     L  ++   +E  ++ T ++    +    P +  + +   ++   L+   TT   
Sbjct: 3   DETAALLVPVISPTTETALVDTGEESTTSHSELPPTKVRITVLALLMGSFLSALDTTIVA 62

Query: 102 SIMNILADSFGSDANSR-SWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWS 160
           +++  +A     DA+S+ SW+  ++ L   +F  + G++ DIFG K +L++  +   +  
Sbjct: 63  TLLPTIASDL--DASSQMSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGC 120

Query: 161 LICG 164
            ICG
Sbjct: 121 AICG 124

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 56/110 (50%), Gaps = 11/110 (10%)

Query: 135 ISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVL 194
           ISG + D++G + ++L+G ++ +I S+    +K  G+  F    R  Q  GI+ ++    
Sbjct: 137 ISGGLADVYGRRPIILLGMLIYVIASIGLACSKSYGAVVFL---RCLQSAGISPIIAINS 193

Query: 195 GIIGNVYVGGTFRKNIVISFIGAMAPIGATL-GCFFAGLIGTMNPNQWPW 243
           G+ G+  V     K+   +F+GA++  G TL G  F  LIG      + W
Sbjct: 194 GVAGDFTV-----KSERGTFVGAVS--GFTLMGQAFGSLIGAALTAAYDW 236

>ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR043C
          Length = 631

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 39/198 (19%), Positives = 86/198 (43%), Gaps = 13/198 (6%)

Query: 76  PWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILI 135
           P  + L +     + +L   GT+     +  +   FG+     S  + ++    G F + 
Sbjct: 91  PRVKKLILVIVAFACILGPMGTSIIYPAIGTIMQDFGTSRFLVSVSVGTYLAALGIFPIW 150

Query: 136 SGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLG 195
              + D  G + + ++ + +++++S+    T +S +   FI+ R   G   A V     G
Sbjct: 151 WSSLADKNGRRTVYVLSFALLVVFSVG---TAFSRNIETFIILRILCGAASASVQSVGAG 207

Query: 196 IIGNVYVGGTFRKNIVISFIGA-MAPIGATLGCFFAGLIGTMNPNQWPWAFYAY--TITA 252
            I ++YV     +N+   ++G  MAP+        + ++ ++  N+W W    +   I A
Sbjct: 208 TIADLYVPEERGRNLGYYYLGPLMAPL-------LSPIVSSLLVNRWSWRSTQWFMVILA 260

Query: 253 VINLILSIYAIPNNIPTN 270
            +  +L ++A+P  + T 
Sbjct: 261 ALTFLLLVFALPETLRTQ 278

>TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 68/170 (40%), Gaps = 10/170 (5%)

Query: 98  TQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMII 157
           T T S    + + F +  N  SW+  ++ + S SF  + G   D  G +N L        
Sbjct: 73  TVTASTYQTIGNEF-NHMNISSWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANTSFT 131

Query: 158 IWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGA 217
           I  L CGL     S    ++S      GI       L  I N  +  + ++ I  +F   
Sbjct: 132 IGCLACGL-----SPNIVVLSFMRALTGIGGGGLITLSTIVNSDMIPSSKRGIFQAFQNL 186

Query: 218 MAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVIN-LILSIYAIPNN 266
           +  +GA  G  F G I +     W W F+      + N LI+S Y +PN 
Sbjct: 187 LLGLGAICGASFGGSIAS--SIGWRWCFFVQVPICITNSLIMSSY-VPNQ 233

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 102 SIMNILADSFGSDANSR---SWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIII 158
           +I++ L D   S+  +    SW+ AS+ L +  F  + G++ DIFG K +LL   +M  +
Sbjct: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229

Query: 159 WSLICG 164
             L+CG
Sbjct: 230 GCLVCG 235

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 63/145 (43%), Gaps = 8/145 (5%)

Query: 102 SIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSL 161
           +I+  ++  FG D +   WL   + L +   +LI GR+  + G K   L   V+  + SL
Sbjct: 65  TIIEEVSQKFG-DYSKVGWLFTGYSLPNALLVLIWGRIATLVGFKTSTLAAIVIFEVGSL 123

Query: 162 ICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPI 221
           +  L   + S    I  R   G+G + V   V  +I +  V    R  ++I+ + +   I
Sbjct: 124 VSAL---ANSMDMLIGGRVIAGIGGSGVQSLVF-VISSTLVEERNR-GLIIAVMSSSFGI 178

Query: 222 GATLGCFFAGLIGTMNPNQWPWAFY 246
            + +G F  G   T     W W FY
Sbjct: 179 ASVVGPFLGGAFTTH--VTWRWCFY 201

>Smik_2.161 Chr2 complement(302754..304823) [2070 bp, 689 aa] {ON}
           YBR043C (REAL)
          Length = 689

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 45/235 (19%), Positives = 94/235 (40%), Gaps = 23/235 (9%)

Query: 11  QNPEVKTAGKEEDYLEIENEV-ALEAED-SSPRNNKEGALTTIVLTNSEDEVMKTKQKWQ 68
           +   +KTA    D+   +N++  L++ D   P+N + G L  + +      V + K    
Sbjct: 48  EKANLKTA-VSNDHKHEDNQINRLKSNDYVVPKNERRGLLPQLAI------VPEFKDARD 100

Query: 69  NPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLV 128
            P     P  + + +F    S ++   GT+     +N +   F +     +  +  + L 
Sbjct: 101 YP-----PKMKKMIVFLIAFSSMMGPMGTSIIFPAINAITTEFKTSVIMVNVSIGVYLLS 155

Query: 129 SGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAF 188
            G F L    + ++ G +   +  + ++  +++   L     S   FI  R   G   A 
Sbjct: 156 LGVFPLWWSSLSELEGRRTTYITSFALLFAFNIGSALAPDINS---FIALRMLCGAASAS 212

Query: 189 VLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPW 243
           V     G + ++Y+     KN+   ++G +      L    + + G++  N+WPW
Sbjct: 213 VQSVGAGTVADLYISEDRGKNLSYYYLGPL------LAPLLSPIFGSLLVNRWPW 261

>KLTH0E13222g Chr5 complement(1175450..1177150) [1701 bp, 566 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 566

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 59/267 (22%), Positives = 102/267 (38%), Gaps = 23/267 (8%)

Query: 29  NEVALEAEDSSPRN--NKEGALTTIVLTNSE-------DEVMKTKQKWQN------PNYF 73
           NE    A +  P N  N+E      + +  E       +E +KT+   QN      P Y 
Sbjct: 41  NEFIHRAVNEGPSNPENRENITNVDIESEKEHPSGKLKEEELKTEDADQNLSEQPDPPYT 100

Query: 74  KYPWQEYLFIFTCMI-SQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSF 132
            +  ++ L IF  +I    L        +  + IL + FG  A + +  ++ F  V    
Sbjct: 101 AFSQRQVLVIFIIVIFVGFLGPLSGNIYIPALPILQNVFGLSATAINATVSVFMAVFAVG 160

Query: 133 ILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPN 192
            LI     D  G K + +I  +M ++ +++      +    F +  R  Q    + V+  
Sbjct: 161 PLIWASFADFGGRKILYMISLLMTVVVNVLLASVPVNVGALFTL--RVVQAFASSSVMAL 218

Query: 193 VLGIIGNVYVGGTFRKNIVISFIGA-MAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTIT 251
             G + ++       K I    +G  M PI   L    AGLI  M+ + W W F    I 
Sbjct: 219 GAGTVSDIRPPKVRGKAIAYFMLGPNMGPI---LAPIIAGLI-LMHGSYWRWLFGFTCIL 274

Query: 252 AVINLILSIYAIPNNIPTNVHRFSMDW 278
           +   L++ +  +P  +   V    + W
Sbjct: 275 SGFGLLMVVVLLPETLRCIVGNGDIKW 301

>Skud_2.155 Chr2 complement(291487..293553) [2067 bp, 688 aa] {ON}
           YBR043C (REAL)
          Length = 688

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 37/194 (19%), Positives = 77/194 (39%), Gaps = 11/194 (5%)

Query: 76  PWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILI 135
           P  + + +F    S ++   GT+     +N +   F +     +  +  + L  G F L 
Sbjct: 103 PMMKKMIVFLIAFSSMMGPMGTSIIFPAINAITTEFKTSVIMVNVSIGVYLLSLGVFPLW 162

Query: 136 SGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLG 195
              M ++ G +   +  + ++  +++         S   FI  R   G   A V     G
Sbjct: 163 WSSMSELEGRRTTYITSFALLFAFNIGSAFAPDINS---FIALRMLCGAASASVQSVGAG 219

Query: 196 IIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAY--TITAV 253
            + ++Y+     KN+   ++G +      L    + +IG++  N+WPW    +   I + 
Sbjct: 220 TVADLYISEDRGKNLSYYYLGPL------LAPLLSPIIGSLLVNRWPWRSTQWFMVILSG 273

Query: 254 INLILSIYAIPNNI 267
            N+IL    +P  +
Sbjct: 274 CNVILLTVLLPETL 287

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 78/190 (41%), Gaps = 12/190 (6%)

Query: 83  IFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDI 142
           +F   +   L    TT   +++  +A    + +N  SW+  S+ L   +F  + G++ D+
Sbjct: 35  VFALFVGSYLAALDTTIVTTLLPTIASELDA-SNQMSWIATSYLLSCSAFQPLYGKLSDV 93

Query: 143 FGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYV 202
           FG K +L+   +      ++CG   ++ S     + R   G+G   +  N L  I    +
Sbjct: 94  FGRKPLLIWSNLCFGFGCILCG-APFTKSLWMLCIGRFIAGVGGGGL--NSLSTITTSDI 150

Query: 203 GGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQ--WPWAFYAYTITAVI--NLIL 258
               ++ +       M  I   LGC    LIG     +  W WAF      +++  +LI+
Sbjct: 151 IPLRQRGVY----QGMGNIVFALGCASGSLIGAFLQQRIGWRWAFLCQVPLSLLSCSLIM 206

Query: 259 SIYAIPNNIP 268
               +P   P
Sbjct: 207 KFLNLPAGSP 216

>TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {ON}
           Anc_2.241 YIL121W
          Length = 562

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 74/172 (43%), Gaps = 11/172 (6%)

Query: 107 LADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLT 166
           L   F  D N  +  +  + +  G      G + D+FG + ++L G ++  + S+    +
Sbjct: 118 LEKQFDVDENMVNVTVVVYLIFQGLSPTFCGGLADLFGRRPVILTGMLIYTVASIGLACS 177

Query: 167 KYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLG 226
              G   F    R  Q  GI+  +    G +G+  V     K+   +F+GA++ +   LG
Sbjct: 178 NSYGVIVFL---RCLQSAGISPTISISSGAVGDFTV-----KSERGTFVGAVSGL-VLLG 228

Query: 227 CFFAGLIGTMNPNQWPWA--FYAYTITAVINLILSIYAIPNNIPTNVHRFSM 276
             F  LIG      + W   F+  TI   ++++++ + +P    T V   S+
Sbjct: 229 QAFGSLIGAALAASFNWRAIFWFLTIGCGVSMMVAFFVLPETKRTIVGNLSI 280

>KLLA0B06798g Chr2 (596500..598491) [1992 bp, 663 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 663

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 63/132 (47%), Gaps = 13/132 (9%)

Query: 139 MGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIG 198
           + +I G + + ++ + ++  +++   L   S + + FIV R  QG   A V     G I 
Sbjct: 169 LSEIEGRRTVYVLSFTLLTAFTIGSAL---SPNISAFIVFRMLQGASSASVQSVGAGTIS 225

Query: 199 NVYVGGTFRKNIVISFIGA-MAPIGATLGCFFAGLIGTMNPNQWPWAFYAY--TITAVIN 255
           ++++     KN+   ++G  MAP+        + +IG +  N+W W    +   I AV+N
Sbjct: 226 DLFIPEERGKNLGYYYLGTLMAPL-------LSPIIGALLVNRWSWRSTQWFMVILAVVN 278

Query: 256 LILSIYAIPNNI 267
           ++L    +P  +
Sbjct: 279 VLLFTLLLPETL 290

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 64/161 (39%), Gaps = 9/161 (5%)

Query: 10  IQNPEVKTAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQN 69
           +Q+P     G   + +E ++ + L+ E    R       ++I   N  ++          
Sbjct: 18  MQDPSTDLPGFVANQIEQQDHL-LDIEQG--RAYGSTTKSSISSENEREDAGGATVAGCG 74

Query: 70  PNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANS---RSWLMASFP 126
              F  P    L I   M S  L         +I++ L    GS+ NS    SW+  S+ 
Sbjct: 75  SAEFYLPSSRILII---MFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYL 131

Query: 127 LVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTK 167
           L S +   + G++ D  G K +L+    +  I  LICGL+ 
Sbjct: 132 LSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSN 172

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 56/132 (42%), Gaps = 17/132 (12%)

Query: 120 WLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSR 179
           WL+  + L +  F L+ GR+  I GLK  L    V+  I SLI  ++   G     I  R
Sbjct: 46  WLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIVAVSNSMG---MIIGGR 102

Query: 180 AFQGLGIAFVLPNVLGIIGNVYVGGT-----FRKNIVISFIGAMAPIGATLGCFFAGLIG 234
              G G +       GI   V+V GT       + +VI+ +G    +   +G    G   
Sbjct: 103 VVAGCGGS-------GIQSLVFVVGTSLVEERNRGMVITVLGLAFAVAFAVGPVIGGAF- 154

Query: 235 TMNPNQWPWAFY 246
           T N + W W FY
Sbjct: 155 TENVS-WRWCFY 165

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 85/214 (39%), Gaps = 16/214 (7%)

Query: 33  LEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLL 92
           +E E  S R  +E +     L   ++E   +K K  N       +   L +F   +  L+
Sbjct: 4   IEIESGSNRT-REMSTGKESLCPEQEECETSKAKNNNTRLLLSLFSLGLSMFVTALDVLI 62

Query: 93  NQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIG 152
              GT     I++ +  SFG D     W++  + L +  F L+ GR+    G +  ++  
Sbjct: 63  --VGT-----IIDTVCKSFG-DYTKSGWIVTGYSLPNALFSLLWGRISANLGPRISIVAC 114

Query: 153 YVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVI 212
            V+    SLI  L +   S    I  R   G+G    L  +  +IG   V    R  +V+
Sbjct: 115 IVLFEAGSLISALAR---SMNMLIAGRVVSGVG-GSGLQTLSLVIGCQLVDEKSRP-LVL 169

Query: 213 SFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFY 246
           S +     I + +G F  G   T     W W FY
Sbjct: 170 SLLNCTFAIASIIGPFIGGAFTT--HVTWRWCFY 201

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 58/147 (39%), Gaps = 7/147 (4%)

Query: 119 SWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVS 178
           +W+  ++ + S SF  + G   D  G +N L        I  L CG      S   +++S
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANATFTIGCLACGF-----SSNIYMLS 59

Query: 179 RAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNP 238
                 GI       L  I N  V  T ++ I  +F   +   GA  G  F G I +   
Sbjct: 60  FMRALTGIGGGGLITLSTIVNSDVIPTSKRGIFQAFQNLLLGFGAICGASFGGTIASTI- 118

Query: 239 NQWPWAFYAYTITAVINLILSIYAIPN 265
             W W F      ++I+ IL  Y +PN
Sbjct: 119 -GWRWCFLIQVPISMISSILMNYYVPN 144

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 62/145 (42%), Gaps = 8/145 (5%)

Query: 102 SIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSL 161
           +I++ +  SFG D     W++  + L +  F L+ GR+  + G +  ++   ++    SL
Sbjct: 66  TIIDTVCTSFG-DYTKSGWIVTGYSLPNALFSLLWGRLSAVLGPRISVISCIILFETGSL 124

Query: 162 ICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPI 221
           I  L K   S    I  R   G+G    L  +  +IG   V    R  +V+S +     +
Sbjct: 125 ISALAK---SMNMLISGRVIAGVG-GSGLQTLSLVIGCQLVNEKSRP-LVLSLLNCTFAV 179

Query: 222 GATLGCFFAGLIGTMNPNQWPWAFY 246
            + +G F  G   T     W W FY
Sbjct: 180 ASIVGPFLGGAFTT--HVTWRWCFY 202

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 64/145 (44%), Gaps = 8/145 (5%)

Query: 102 SIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSL 161
           +I+  +A  FGS  +   WL   + L +    LI GR+    G K  +L   V+  + SL
Sbjct: 98  TIIEEVAKQFGS-YSEIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIFEVGSL 156

Query: 162 ICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPI 221
           I  L   + S    I  R   G+G    + ++  +IG+  V  + R  ++I+ +     I
Sbjct: 157 ISAL---ANSMNVLIGGRVIAGVG-GCGIQSLSFVIGSNLVEESNR-GVLIAILSCSFAI 211

Query: 222 GATLGCFFAGLIGTMNPNQWPWAFY 246
            + +G F  G+    +   W W FY
Sbjct: 212 ASVVGPFLGGVF--TSRVTWRWCFY 234

>Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON}
           (33230..34975) [1746 nt, 582 aa]
          Length = 581

 Score = 34.7 bits (78), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 46/222 (20%), Positives = 84/222 (37%), Gaps = 18/222 (8%)

Query: 59  EVMKTKQKWQNPNYFKYP-------WQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSF 111
            +MKT+     PN    P        ++ L I  C  +   +         ++ ++   F
Sbjct: 72  HIMKTQSVKLGPNTTDSPPYSRFGRTEKSLLIIQCAFTGFFSSVAGAIYYPVLTVIEKKF 131

Query: 112 GSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGS 171
                  +  +  + +  G      G + D  G + ++L     I+++   C     S +
Sbjct: 132 NITEELVNITVVVYFIFQGLAPSFMGGLADSLGRRPVVLFS---ILVYCCACIGLALSQN 188

Query: 172 DTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAG 231
            T  +V R  Q  GI+ V+    GI G++       +   + ++     IG+     F  
Sbjct: 189 YTQIVVLRCLQAAGISPVIAINSGICGDITTRA--ERGAYVGYVSGFIVIGSA----FGA 242

Query: 232 LIGTMNPNQWPWA--FYAYTITAVINLILSIYAIPNNIPTNV 271
           LIG    + W W   F+  TI + I L++SI  +P    T V
Sbjct: 243 LIGAGLSSTWGWRSIFWFLTIGSGICLMISIIVLPETKRTLV 284

>YBR043C Chr2 complement(321876..323945) [2070 bp, 689 aa] {ON}
           QDR3Multidrug transporter of the major facilitator
           superfamily, has a role in polyamine homeostasis;
           expression is upregulated under polyamine stress;
           required for resistance to quinidine, barban, cisplatin,
           and bleomycin
          Length = 689

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 48/247 (19%), Positives = 99/247 (40%), Gaps = 23/247 (9%)

Query: 33  LEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNY-----FKY-----PWQEYLF 82
           LE+  S+ R +++  L+   L + E  V K +++   P       FK      P  + + 
Sbjct: 52  LESTASNSREHRDNQLSR--LKSEEYVVPKNQRRGLLPQLAIIPEFKDARDYPPMMKKMI 109

Query: 83  IFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDI 142
           +F    S ++   GT+     +N +   F +     +  +  + L  G F L    + ++
Sbjct: 110 VFLIAFSSMMGPMGTSIIFPAINSITTEFKTSVIMVNVSIGVYLLSLGVFPLWWSSLSEL 169

Query: 143 FGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYV 202
            G +   +  + ++  +++   L     S   FI  R   G   A V     G + ++Y+
Sbjct: 170 EGRRTTYITSFALLFAFNIGSALAPDINS---FIALRMLCGAASASVQSVGAGTVADLYI 226

Query: 203 GGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAY--TITAVINLILSI 260
                KN+   ++G +      L    + + G++  N+WPW    +   I +  N+IL  
Sbjct: 227 SEDRGKNLSYYYLGPL------LAPLLSPIFGSLLVNRWPWRSTQWFMVILSGCNVILLT 280

Query: 261 YAIPNNI 267
             +P  +
Sbjct: 281 VLLPETL 287

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 57/145 (39%), Gaps = 8/145 (5%)

Query: 102 SIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSL 161
           +IM  +A  F   + +  WL+  + L +    L+ GR G + G K  +L+  V+  + SL
Sbjct: 97  TIMETVAAKFNGYSMT-GWLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSL 155

Query: 162 ICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPI 221
           I        S T  I  R   G+G + +      I   +    T  +   IS +     +
Sbjct: 156 IAAAAT---SMTMLIGGRVISGIGGSGIQTLCFVITSTLVTDRT--RGTAISILSCAFAV 210

Query: 222 GATLGCFFAGLIGTMNPNQWPWAFY 246
            +  G F  G   T     W W FY
Sbjct: 211 ASVAGPFLGGAFATH--VTWRWCFY 233

>TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.241
           YIL121W
          Length = 557

 Score = 34.7 bits (78), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 50/263 (19%), Positives = 107/263 (40%), Gaps = 24/263 (9%)

Query: 20  KEEDYLEIENEVALEAED---SSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYP 76
           ++ED  +   E   E++    S P +N+  ++ +I +  S     +TK     P+Y   P
Sbjct: 5   EKEDIRKTPTEKDTESKHERLSLPGDNE--SMCSIDVEQSS--CTRTKSARLEPHYTSPP 60

Query: 77  W------QEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSG 130
           +      +++L +  C  +   +         ++ ++ D F       +  +  + +  G
Sbjct: 61  YSRFGRREKFLLVVQCAFTGFFSTIAAAIYYPVLTVIEDLFDISEEKVNITVVVYFIFQG 120

Query: 131 SFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVL 190
               + G + D  G + ++++   +++ +S   GL   S S    I  R  Q  GI+ V+
Sbjct: 121 ISPTLMGGLADYLGRRPIVILS--VLVYFSACVGLA-CSQSYAQIIALRCLQAAGISPVI 177

Query: 191 PNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWA--FYAY 248
               GI+G+V       +   + ++     +G+     F  LIG    ++W W   F+  
Sbjct: 178 AINSGIMGDVTTRA--ERGGYVGYVSGCQVVGSA----FGALIGAGLSSRWGWRSIFWFL 231

Query: 249 TITAVINLILSIYAIPNNIPTNV 271
            I +   L+ ++  +P    T V
Sbjct: 232 AIGSGACLVATVLFLPETKRTVV 254

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 103 IMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLI 151
           IMN +A+ F + +N + W+  S+ L + +F  + GR+ DI G K   LI
Sbjct: 89  IMNRVAEDFNA-SNQKQWIATSYLLTNTAFQPLYGRLSDIIGRKYTQLI 136

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 62/158 (39%), Gaps = 7/158 (4%)

Query: 119 SWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVS 178
           +W+  ++ + S SF  + G   D  G +N L        I  L CG +K       +++S
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANGAFTIGCLACGFSK-----NIYMLS 59

Query: 179 RAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNP 238
                 GI       L  I N  V  + ++ I  +F   +   GA  G  F G I +   
Sbjct: 60  FMRALTGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNLLLGFGAICGASFGGTIAS--S 117

Query: 239 NQWPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFSM 276
             W W F      +VI+ IL  Y +PN    N    S+
Sbjct: 118 IGWRWCFLIQVPISVISSILMNYYVPNQKEYNRQNSSI 155

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 6/87 (6%)

Query: 102 SIMNILADSFGSDAN---SRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIII 158
           ++++ L    GS+ N      W+  S+ L S  F  + G++ DIFG K +L+   ++   
Sbjct: 415 TVVSTLMAHIGSEFNQIPKVPWVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFF 474

Query: 159 WSLICGLTKYSGSDTFFIVSRAFQGLG 185
             +ICG+   S S    +  R   G+G
Sbjct: 475 GCIICGM---SNSLNMLVWGRFVAGIG 498

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 44/212 (20%), Positives = 84/212 (39%), Gaps = 15/212 (7%)

Query: 38  SSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGT 97
           S+  +N    L T   +++ + V + K+        K        ++ C+ S  L    +
Sbjct: 2   SALEDNSSKELCTQAESSTSEVVEQNKKVVSQDQVVKG-----FALYACLGSLTLALFLS 56

Query: 98  TQTLSIMNILADSFGSDANSRS---WLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYV 154
              + I++ + ++   D N  S   WL+  + L +    L+ GR   I G K+ +L+  +
Sbjct: 57  ALDILIVSTIIETVSRDFNEYSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSII 116

Query: 155 MIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISF 214
           +  + SL+  L   + S    I  R   G+G + +      II  +       + + IS 
Sbjct: 117 IFEVGSLVSAL---ANSMNMLIGGRVISGVGGSGLQTLCFLIISTLV--NERSRGMAISV 171

Query: 215 IGAMAPIGATLGCFFAGLIGTMNPNQWPWAFY 246
           +     + + +G F  G   T     W W FY
Sbjct: 172 LSCSFAVASIVGPFLGGAFTTH--VTWRWCFY 201

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 53/110 (48%), Gaps = 11/110 (10%)

Query: 135 ISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVL 194
           ISG + D++G + ++LIG ++ +  S+    +   G   F    R  Q  GI+ ++    
Sbjct: 141 ISGGLADVYGRRPVILIGMLIYVCASIGLACSNSYGVIVFL---RCLQSAGISPIIAINS 197

Query: 195 GIIGNVYVGGTFRKNIVISFIGAMAPIGATL-GCFFAGLIGTMNPNQWPW 243
           G++G+  V     K    +F+GA++  G TL G  F  LIG      + W
Sbjct: 198 GVVGDFTV-----KQERGTFVGAVS--GFTLMGQAFGSLIGAALTAAFDW 240

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 63/137 (45%), Gaps = 11/137 (8%)

Query: 135 ISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVL 194
           ISG + D++G + ++L G ++ ++ S+    +   G   F    R  Q  GI+ ++    
Sbjct: 152 ISGGLADVYGRRPIILAGMLIYVVASIGLACSNSYGVIVFL---RCVQSAGISPLIAISS 208

Query: 195 GIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWA--FYAYTITA 252
           G++G+        K+   SF+GA++   A +G  F  LIG      + W   F+  TI  
Sbjct: 209 GVVGDFTT-----KSERGSFVGAVSGF-ALMGQAFGSLIGAGLTAAYDWRAIFWFLTIGC 262

Query: 253 VINLILSIYAIPNNIPT 269
               +++ + +P    T
Sbjct: 263 GTCFVINFFLLPETKRT 279

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 42/238 (17%), Positives = 93/238 (39%), Gaps = 17/238 (7%)

Query: 42  NNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEY------LFIFTCMISQLLNQS 95
           ++ + ++  I   N ++++ +TK     P+    P+  +      + +  C  +   +  
Sbjct: 34  DDDDESVINISDINPKNQLCQTKSNQNEPDIASPPYSRFGTTEKMILVIQCAFTGFFSSI 93

Query: 96  GTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVM 155
                  +++++ + F       +  +  + +  G    I G + D  G + ++L     
Sbjct: 94  AGAIYYPVLSVIENEFNITEEMVNITVVVYFIFQGIAPSIMGGLADSMGRRPVVLSS--- 150

Query: 156 IIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFI 215
           ++++   C     S +    IV R  Q  GI+ V+    GI+G++       +   + ++
Sbjct: 151 VLVYCCACIGLACSHTYAQIIVLRCLQAAGISPVIAINSGIMGDITTRA--ERGGYVGYV 208

Query: 216 GAMAPIGATLGCFFAGLIGTMNPNQWPWA--FYAYTITAVINLILSIYAIPNNIPTNV 271
                IG+     F  LIG      W W   F+   I + + L+ SI  +P    T V
Sbjct: 209 SGFQVIGSA----FGALIGAGLSATWSWRSIFWFLAIGSGVCLVASIIILPETKRTVV 262

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 69/145 (47%), Gaps = 13/145 (8%)

Query: 135 ISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVL 194
           ISG + D++G + ++L+G ++ +  S+    ++  G   F    R  Q  GI+ ++    
Sbjct: 141 ISGGLADVYGRRPVILMGMLIYVCASIGLACSQSYGVIVFL---RCLQSAGISPIIAINS 197

Query: 195 GIIGNVYVGGTFRKNIVISFIGAMAPIGATL-GCFFAGLIGTMNPNQWPWA--FYAYTIT 251
           G++G+  +     K+   +F+GA++  G TL G  F  LIG      + W   F+  TI 
Sbjct: 198 GVVGDFTL-----KHERGTFVGAVS--GFTLMGQAFGSLIGAALTAAFDWRAIFWFLTIG 250

Query: 252 AVINLILSIYAIPNNIPTNVHRFSM 276
               +I++   +P    T V   S+
Sbjct: 251 CGTCMIINFLILPETKRTLVGNLSI 275

>Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W
           (REAL)
          Length = 562

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 58/147 (39%), Gaps = 7/147 (4%)

Query: 119 SWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVS 178
           SW+  ++ + S SF  + G   D  G +N L     +  I  L C     S S   +++S
Sbjct: 96  SWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANAVFTIGCLAC-----SFSTNIYMLS 150

Query: 179 RAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNP 238
                 GI       L  I N  V  + ++ I  +F   +   GA  G  F G I +   
Sbjct: 151 FMRALAGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNLLLGFGAICGASFGGTITSTI- 209

Query: 239 NQWPWAFYAYTITAVINLILSIYAIPN 265
             W W F      ++I  +L  Y +PN
Sbjct: 210 -GWRWCFLIQVPISMIASLLMNYYVPN 235

>Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011W
           (REAL)
          Length = 541

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 54/236 (22%), Positives = 98/236 (41%), Gaps = 34/236 (14%)

Query: 29  NEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYL------- 81
           +E+A    +S+ +     + + +    ++D  ++TK +  +    + P   Y        
Sbjct: 2   SELATNPVESASQEPSIHSTSAVKKLETDDFQLQTKSEHNSAELPQKPITAYWTVICLCL 61

Query: 82  ------FIF---TCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMAS-FPLVSGS 131
                 F+F   T  IS  +NQS   +    M      + SD   R+ L+ S F +    
Sbjct: 62  MIAFGGFVFGWDTGTISGFVNQSDFKRRFGQMKSDGTYYLSDV--RTGLIVSIFNIGCAV 119

Query: 132 FILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTF--FIVSRAFQGL---GI 186
             L  GR+GDI+G K    IG + +I+  ++  + + + +D +  + + R   G+   GI
Sbjct: 120 GGLTLGRLGDIYGRK----IGLMCVILVYIVGIVIQIASTDKWYQYFIGRIISGMGVGGI 175

Query: 187 AFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLG-CFFAGLIGTMNPNQW 241
           A + P ++      ++ GT      +SF   M  +G  LG C   G     N  QW
Sbjct: 176 AVLSPTLISETAPKHIRGT-----CVSFYQLMITLGIFLGYCTNYGTKDYSNSIQW 226

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 87/212 (41%), Gaps = 20/212 (9%)

Query: 33  LEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLL 92
           L ++DSS   + +G L+T       DE     Q+   P+     W ++  +    +    
Sbjct: 60  LHSDDSSIDTSLDGELST------PDE---EAQEHTPPHSMLSYWNKWGMVAVLTMCGFW 110

Query: 93  NQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIG 152
           +  G+      +  L   F  D N  +  +  + +  G    +SG + DI+G + ++L G
Sbjct: 111 SSLGSPIYYPALKQLEKKFNVDENLVNVSVVVYLIFQGFAPAVSGGLADIYGRRPVILFG 170

Query: 153 YVMIIIWSL-ICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIV 211
            ++ ++ S+ I     Y       I  R  Q  GI+ ++    G +G+  V     K   
Sbjct: 171 MLVYVVASIGIAACNSYG----VIIFLRCLQSTGISPLIAISSGAVGDFTV-----KAER 221

Query: 212 ISFIGAMAPIGATLGCFFAGLIGTMNPNQWPW 243
            +F+GA++ +   +G  F  LIG      + W
Sbjct: 222 GTFVGAVSGL-VLMGQAFGSLIGAALAAAYNW 252

>Ecym_5357 Chr5 (722150..727048) [4899 bp, 1632 aa] {ON} similar to
           Ashbya gossypii ACL079C
          Length = 1632

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 6/35 (17%)

Query: 223 ATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLI 257
           A LGCF AGLIG       P +F  YT+  +I +I
Sbjct: 238 ALLGCFIAGLIGV------PVSFETYTLNEIIEII 266

>TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa]
           {ON} Anc_5.84 YGR241C
          Length = 680

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 36/83 (43%)

Query: 30  EVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMIS 89
           E  L+ E ++P NNKE  + +   T+   E    +QK       K   QE L   T ++S
Sbjct: 254 EDHLKEEQNNPPNNKESTIYSATTTSPNGEKSLAQQKLDQVREQKRVLQEQLRNQTVLMS 313

Query: 90  QLLNQSGTTQTLSIMNILADSFG 112
             L Q G T  L+      + FG
Sbjct: 314 PTLPQPGNTPNLTSTVNDTNPFG 336

>Kpol_1004.24 s1004 (52837..54528) [1692 bp, 563 aa] {ON}
           (52837..54528) [1692 nt, 564 aa]
          Length = 563

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 70/167 (41%), Gaps = 17/167 (10%)

Query: 5   KEECVIQNPEVKTAGKEEDY-----LEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDE 59
           ++E  + N    +   +E++     +E+ NE    +E +S   +K      ++     D+
Sbjct: 33  RKEIQLLNKNNDSIDNDENHNYETTIELRNEGTDYSESNSSTKDKLDHQEHVLEKCDSDK 92

Query: 60  VMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRS 119
              ++ K   PNY    W              +N S  T +L +  I  DS+    NS +
Sbjct: 93  GSNSRFK---PNY----WALITSGSGLFSDGYINASIGTVSLCLKRIYGDSY---TNSNA 142

Query: 120 WLMASFPLVSGSFI--LISGRMGDIFGLKNMLLIGYVMIIIWSLICG 164
               S    +G+    LI G + D +  K  +L+G  M+I++S++C 
Sbjct: 143 IKNVSSIAFAGTVCGQLIFGHLADNYSRKFAMLLGTSMLILFSILCA 189

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 102 SIMNILADSFGSDANSRS---WLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIII 158
           +I++ L  +  SD ++ S   W+  S+ L   +F  + G++ DIFG K +L+   ++  I
Sbjct: 59  TIVSTLLPTIASDLDASSQMSWIATSYLLSCSAFQPLYGKLSDIFGRKILLVWSNLVFAI 118

Query: 159 WSLICG 164
              +CG
Sbjct: 119 GCALCG 124

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 64/164 (39%), Gaps = 8/164 (4%)

Query: 83  IFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDI 142
           IF+  ++  L        +++ + +   F   AN   WLM  + L +   +L+ GR+  +
Sbjct: 10  IFSLSLTLFLGALDIVICITLYDTIGKVFNDYANV-GWLMTGYNLPNALCMLLWGRIASL 68

Query: 143 FGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYV 202
            GLKN L+   V+    SL+  L    G     I  R   G G + +   V   +G   V
Sbjct: 69  VGLKNSLVASIVIFEAGSLLAALATSMG---MLIGGRVIAGFGGSGIETLVFA-VGTRMV 124

Query: 203 GGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFY 246
               R   V++ +G    +    G F  G         W W F+
Sbjct: 125 DEKHRAR-VVTILGIAYMLAEGAGPFIGGAFA--EHVSWRWCFF 165

>NCAS0B06480 Chr2 complement(1225523..1227286) [1764 bp, 587 aa]
           {ON} 
          Length = 587

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 42/224 (18%), Positives = 85/224 (37%), Gaps = 21/224 (9%)

Query: 56  SEDEVMKTKQKWQNPNYFKYPWQEY------LFIFTCMISQLLNQSGTTQTLSIMNILAD 109
           +E+ +++TK     P+    P+  +      + +  C  +   +   ++    ++ ++  
Sbjct: 64  NENSLVRTKSTNDEPDVTTAPYSRFGPREKMILVVQCAFTGFFSSIASSIYYPVLTVIEK 123

Query: 110 SFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYS 169
            F     S +  +  + +  G    I G + D  G + ++L    +       C     +
Sbjct: 124 LFDISEESVNITVVVYFIFQGLSPSIMGGLADSLGRRPVVLFSVAV-----YFCACVGLA 178

Query: 170 GSDTF--FIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGC 227
            + T+   IV R  Q  GI+ V+    GI+G+V       +   + ++         LG 
Sbjct: 179 CAQTYPQIIVLRCLQAAGISPVIAINSGIMGDVTTRA--ERGGYVGYVSGF----QVLGN 232

Query: 228 FFAGLIGTMNPNQWPWA--FYAYTITAVINLILSIYAIPNNIPT 269
            F  LIG    + W W   F+   I + I L+ S   +P    T
Sbjct: 233 SFGALIGAGISSTWSWRAIFWFLAIGSGICLLASFIVLPETKRT 276

>SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 667

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 62/141 (43%), Gaps = 13/141 (9%)

Query: 130 GSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFV 189
           G F L    + ++ G + + L+ + ++  +   C  T  S +   FI+ R   G   A V
Sbjct: 149 GVFPLWWSSISELKGRRTVYLVSFTLLFAF---CIGTAVSPNIQAFIILRVLCGASSASV 205

Query: 190 LPNVLGIIGNVYVGGTFRKNIVISFIGAM-APIGATLGCFFAGLIGTMNPNQWPWAFYAY 248
                G I ++Y      KN+   ++GA+ AP+        + +IG++  N W W    +
Sbjct: 206 QSVGAGTIADLYAPEERGKNLGYFYLGALTAPL-------LSPIIGSLLVNHWSWRSTQW 258

Query: 249 --TITAVINLILSIYAIPNNI 267
              I A  N+IL +  +P  +
Sbjct: 259 FMVILAGANVILIVLFLPETL 279

>NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 77/175 (44%), Gaps = 24/175 (13%)

Query: 325 YEIHFAKSPLLPQAVMKDRHMI-QIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGG 383
           +E  FAK PL P  ++KDR +   ++++LF  +  +   T+ Y    ++    T L A  
Sbjct: 324 WEWKFAKFPLTPWNLVKDRGVYGGLLIALFLDFAYYVQSTYKYTVLLVSF-DTTVLAATR 382

Query: 384 SYFMFLIWGIIAALLVGF----SIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQ 439
           +  MF   G+I A L+G      ++R    +F   +M   + G +       H      +
Sbjct: 383 TNNMFTFVGVITANLLGIFVAKKLRRTKGFIFFGISMYIVSTGLLYRYRIGAHA-----K 437

Query: 440 MGTMI---ILSFGMD-LSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLG 490
           +GT++   +L FG   L FPA + I         Q  A +  N  +  S+ L LG
Sbjct: 438 VGTIVACCLLGFGNGFLKFPARASI---------QAAAYTHKNLAIITSLFLALG 483

>TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.570
           YBR180W
          Length = 653

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 61/146 (41%), Gaps = 7/146 (4%)

Query: 137 GRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGI 196
           G   D+ G K + L   +++ + +L+  +   + +  F  V R FQ  G + V+    G 
Sbjct: 167 GVYADVCGRKWLYLCSLILVTVINLLLAVLPANLASLF--VLRVFQAFGSSSVITLGSGT 224

Query: 197 IGNVYVGGTFRKNIVISFIGA-MAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVIN 255
           + ++       K I    +G  M PI   LG   AGLI  +N + W W F    I + I 
Sbjct: 225 VTDITPMKHRGKAIAYFMLGPNMGPI---LGPIIAGLI-LINGDYWRWLFGFTCIMSAIG 280

Query: 256 LILSIYAIPNNIPTNVHRFSMDWIGS 281
            +L +  +P  +   V      W  S
Sbjct: 281 FLLVLIFLPETLRCIVGNGDPRWRNS 306

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 61/145 (42%), Gaps = 8/145 (5%)

Query: 102 SIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSL 161
           +I++++A+ FG+ + +  WL+  + L +    L+ GR   I G ++ L++  ++    SL
Sbjct: 57  TIIDVVAEQFGNYSKT-GWLVTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAGSL 115

Query: 162 ICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPI 221
           +  L     +    ++            L  +  +IG   V    R  +VIS +     +
Sbjct: 116 VAAL----ANSMNMLIVGRVVAGVGGSGLQTLCFVIGCTMVNERSRP-LVISILSCAFAV 170

Query: 222 GATLGCFFAGLIGTMNPNQWPWAFY 246
            A +G    G   T     W W FY
Sbjct: 171 AAIVGPIIGGAFTT--HVTWRWCFY 193

>Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}
           YBR293W - Hypothetical ORF [contig 294] FULL
          Length = 590

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 75/370 (20%), Positives = 140/370 (37%), Gaps = 64/370 (17%)

Query: 102 SIMNILADSFGSDANSRSWLMASFPLVSGSFIL-------ISGRMGDIFGLKNMLLIGYV 154
           +I++ L    GS+ N     M +  LV+ S++        + G+  D+FG K +L+   +
Sbjct: 99  TIVSTLLPHIGSELND----MPNVSLVATSYVFSCAIFQPLFGKTSDVFGRKPLLISSNL 154

Query: 155 MIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISF 214
           +     L CGL+K   +  + I+ R   G+G   +      II ++      R   V   
Sbjct: 155 LFFAGCLTCGLSK---TIWWLILGRLVTGIGGGGLTSMCTIIINDIV---PLRNRAVYQG 208

Query: 215 IGAM-APIGATLGCFFAGLIGTMNPNQWPWAF---YAYTITAVINLILSIYAIPNNIPTN 270
            G +   +G   G    GL      N W  AF     +   + I++I  +Y   ++   +
Sbjct: 209 FGNLFYALGTACGGLVGGLFSEYG-NGWRMAFMIQLPFCFLSTISII--VYLDLSDDKQD 265

Query: 271 VHRFSM-------DWIGSXXXXXXXXXXXXXWNQAPISGWNQAYXXXX----XXXXXXXX 319
           + R S+       DW+G+                  I G +  Y                
Sbjct: 266 LGRSSLYCKLRLIDWLGALTLVTFLLLFLVTMT---IGGQHVPYGSLRFFLLCVAVCASG 322

Query: 320 XXXXXYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPL 379
                 EI  A  P+LP + +++++++   L+ +F        T+Y   +  ++ +  P+
Sbjct: 323 LALAYVEIFLANDPILPISFLRNKNVLGSSLANWFCMMGMMTITYYLPIYWSSVSNQGPI 382

Query: 380 WAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQ 439
             G                     K+  PS   FF+M   + G+  A     + TY+R+ 
Sbjct: 383 QVG---------------------KKSIPS---FFSMALGSFGT--AYYVQKNGTYYRLL 416

Query: 440 MGTMIILSFG 449
           M + +I+ FG
Sbjct: 417 MTSCLIIIFG 426

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 45/93 (48%), Gaps = 1/93 (1%)

Query: 325 YEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGS 384
           +EI FA+ PL P+  +K+R ++  ++ + F   ++ + + Y +   L     +   A   
Sbjct: 324 WEIKFARYPLTPKDALKNRGIVSALVLVLFLQFAYQMQSTYLYTVLLVAVDESKKSATRI 383

Query: 385 YFMFLIWGIIAALLVGFSIKRVSPSV-FLFFAM 416
             +F    +I   L GF + +V  +  F+FF +
Sbjct: 384 NKLFSFVSVITGFLSGFVVAKVRRTKEFIFFGI 416

>ZYRO0F08228g Chr6 (665663..667612) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 649

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 29/140 (20%), Positives = 63/140 (45%), Gaps = 11/140 (7%)

Query: 130 GSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFV 189
           G F L    + ++ G + + ++ +++++ +++ C L+   G+   FI  R   G   A V
Sbjct: 141 GVFPLWWSSISEMNGRRTVYVVSFMLLLGFNIGCALSPNIGA---FIALRFLSGAASASV 197

Query: 190 LPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAY- 248
                G + ++YV     +N+ I ++G +      L    + +IG    + W W    + 
Sbjct: 198 QSVGAGTVSDLYVSEQRGRNLGIYYLGPL------LAPLISPIIGAALVSHWSWRSTQWF 251

Query: 249 -TITAVINLILSIYAIPNNI 267
             I A  N+++ I  +P  +
Sbjct: 252 LVILAGANVLILILFLPETL 271

>TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432
          Length = 649

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 3/55 (5%)

Query: 134 LISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAF 188
           L+S  + D  G K  L   +V  I+W + CG+   S      +V R   G+GI F
Sbjct: 83  LLSPSVSDALGRKCSL---HVSCILWCIGCGIQSGSTGVAMLVVGRVIAGVGIGF 134

>Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 bp,
           602 aa] {ON} ANNOTATED BY YGOB -
          Length = 602

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 39/190 (20%), Positives = 75/190 (39%), Gaps = 19/190 (10%)

Query: 21  EEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEV-----MKTKQKWQNPNYFKY 75
           EE   E +N     AE     +N+      + +T+S  ++      K++  +    Y ++
Sbjct: 25  EEHATEPQNLYMEHAEKIQKTDNR------LDVTDSNRQLSLLNSTKSETNFDGIPYTRF 78

Query: 76  PWQEYLF-IFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFIL 134
              + LF +  C +S   +    T     ++I+   F    +  +  +  + L  G F +
Sbjct: 79  SKHDKLFLVVICALSGFYSTIAQTIYFPALSIIEKEFNVSVSLVNVTVVVYSLCQGIFPV 138

Query: 135 ISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTF--FIVSRAFQGLGIAFVLPN 192
           I G + D  G + +      M  I    C     +   TF   I  R  QG GI+ ++  
Sbjct: 139 IMGGLADRLGRRPV-----AMFCIMVYFCACIGIACCRTFGEMIFLRCLQGGGISPIIAI 193

Query: 193 VLGIIGNVYV 202
             G++G++ V
Sbjct: 194 NNGLMGDITV 203

>KLTH0B10384g Chr2 complement(877070..878725) [1656 bp, 551 aa] {ON}
           similar to uniprot|P15365 Saccharomyces cerevisiae
           YJR152W DAL5 Allantoin permease ureidosuccinate permease
           expression is constitutive but sensitive to nitrogen
           catabolite repression
          Length = 551

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 53/115 (46%), Gaps = 4/115 (3%)

Query: 156 IIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGT--FRKNIVIS 213
           II W L+  LT    S   FI++R   G+  + + P ++  +   Y      FR +I+I+
Sbjct: 178 IIAWGLLLCLTSLVKSYPTFILTRTLLGVLESSITPAMVLFMSQWYKKDEQFFRTSILIA 237

Query: 214 FIGAMAPIGATLG--CFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNN 266
                  +GA++    +   L GT++ + W   F    +  ++  ++ ++ IP+ 
Sbjct: 238 CNAVGGLVGASVSYRLYERQLAGTLSMDAWRILFIIVGLITIVTGLMVLFIIPDT 292

>KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {ON}
           Anc_2.241 YIL121W
          Length = 570

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 56/128 (43%), Gaps = 13/128 (10%)

Query: 151 IGYVMIIIWSLI-----CGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGT 205
           +G   +++WS++     C     S + T  I+ R  Q  GI+ V+    GI+G+V     
Sbjct: 138 LGRRPVVLWSVVIYFGACIGLALSQNYTQIIILRCLQAAGISPVIAINSGIMGDVTTKA- 196

Query: 206 FRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWA--FYAYTITAVINLILSIYAI 263
             +   + ++     +G+ LG     LIG    ++W W   F+   I +    ++S + +
Sbjct: 197 -ERGGYVGYVAGFQILGSALG----ALIGAALSSRWDWRAIFWFLAIGSGACALVSFFVL 251

Query: 264 PNNIPTNV 271
           P    T V
Sbjct: 252 PETKRTVV 259

>Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W
           (REAL)
          Length = 599

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 54/255 (21%), Positives = 100/255 (39%), Gaps = 23/255 (9%)

Query: 19  GKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQ 78
            +E   + + N+   E  +S    NKE   T   L+    E +K + +   P + ++   
Sbjct: 24  ARETSNIMLGNDFEDELAESIRSYNKE---TADKLSLHRTESVKPEPEITAPPHSRFSRS 80

Query: 79  -EYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISG 137
            + + I  C  +   +         +++++   F  D    +  +  + +  G    + G
Sbjct: 81  FKTVLIAQCAFTGFFSTIAGAIYYPVLSVIERKFNIDEQLVNVTVVVYFVFQGLAPTLMG 140

Query: 138 RMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGII 197
              D  G + ++LI    III+   C     + +    IV R  Q  GI+ V+    GI+
Sbjct: 141 GFADSLGRRPVVLIA---IIIYFGACVGLACTQTYAQIIVLRCLQAAGISPVIAINSGIM 197

Query: 198 GNVYV----GGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWA--FYAYTIT 251
           G++      GG         ++G  A     LG  F  LIG    ++W W   F+  TI 
Sbjct: 198 GDITTRAERGG---------YVGYAAGF-QVLGSAFGALIGAGLSSRWGWRAIFWFLTIG 247

Query: 252 AVINLILSIYAIPNN 266
           + I  + S+  +P  
Sbjct: 248 SGICFLASLLILPET 262

>YHR048W Chr8 (204607..206151) [1545 bp, 514 aa] {ON}  YHK8Presumed
           antiporter of the DHA1 family of multidrug resistance
           transporters; contains 12 predicted transmembrane spans;
           expression of gene is up-regulated in cells exhibiting
           reduced susceptibility to azoles
          Length = 514

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 56/252 (22%), Positives = 105/252 (41%), Gaps = 25/252 (9%)

Query: 21  EEDYLEIENEVA--LEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQ 78
           EE++  I ++ A  L+ E +S R N +G  +  V  N  +++   +   ++ +  +  + 
Sbjct: 19  EEEHCSINSDKAAKLDLELTSERKN-DGKQSHEVTFN--EDIADPEDIARHMSTARRYYI 75

Query: 79  EYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGR 138
             L  FT M+  +++ S T  +  I+     S   + ++    +  F L  G   L    
Sbjct: 76  SSLITFTSMVITMISSSWTLPSTHIIEHFHIS--HEVSTLGITLYVFGLGIGPLFL--SP 131

Query: 139 MGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGL-GIAFVLPNVLGII 197
           + +++G +   L    + IIW     LT +S + T  +  R   G  G AF     L + 
Sbjct: 132 LSELYGRRITFLYALTLSIIWQC---LTIWSKTITGVMFGRFLSGFFGSAF-----LSVA 183

Query: 198 GNVYVGGTFRKN---IVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVI 254
           G   +   F K+   I ++     A +G +LG    G    +    + W F    IT+  
Sbjct: 184 GGA-IADIFDKDQIGIPMAIYTTSAFLGPSLGPIIGG---ALYHQSYKWTFITLLITSGC 239

Query: 255 NLILSIYAIPNN 266
            L++ I+ IP  
Sbjct: 240 CLVMIIFTIPET 251

>TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.242
           YNL065W
          Length = 529

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 59/137 (43%), Gaps = 9/137 (6%)

Query: 107 LADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLT 166
           L   F  D +  +  +  + L  G     SG + DI+G + +++IG  MII  ++  GL 
Sbjct: 90  LEKEFNIDEDKVNVTVVVYLLFQGIAPTFSGGLADIYGRRPVIVIG--MIIYVAVSVGLA 147

Query: 167 KYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLG 226
             S S    +  R  Q   I+  +    G +G+  +   F +    +F+GA +   A LG
Sbjct: 148 -CSNSYGVLVFLRILQSACISPTIAISSGFVGDFTL--KFERG---TFVGATSGF-ALLG 200

Query: 227 CFFAGLIGTMNPNQWPW 243
             F  LIG      W W
Sbjct: 201 QAFGSLIGAALAAAWDW 217

>TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON}
           Anc_8.570 YBR180W
          Length = 608

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 64/159 (40%), Gaps = 14/159 (8%)

Query: 121 LMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRA 180
           L A  PLV G F        D  G K + +I   +  + +++  L     +     + R 
Sbjct: 182 LFAFMPLVWGMF-------ADFGGRKFLYIISLFIFTVANIL--LASLPANIIALYLVRV 232

Query: 181 FQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGA-MAPIGATLGCFFAGLIGTMNPN 239
            Q +G +  +    G + ++       K++ +  +G  M PI A +    AGLI  MN N
Sbjct: 233 LQVVGASAAISLGTGTVADISPPKHRGKSVALFMLGPNMGPIIAPI---IAGLI-LMNSN 288

Query: 240 QWPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFSMDW 278
           QW W F    I   + L++ I  +P  +   V      W
Sbjct: 289 QWRWLFGFSAICTGVALMIVIVILPETLRCIVGNNDPKW 327

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,971,926
Number of extensions: 2195994
Number of successful extensions: 7949
Number of sequences better than 10.0: 221
Number of HSP's gapped: 8086
Number of HSP's successfully gapped: 231
Length of query: 553
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 438
Effective length of database: 40,294,809
Effective search space: 17649126342
Effective search space used: 17649126342
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)