Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_13.268.844ON1122112250910.0
Smik_13.178.844ON1131113441570.0
Skud_13.248.844ON1128113441040.0
YML117W (NAB6)8.844ON113460624220.0
TDEL0B005408.844ON111576217530.0
CAGL0B02365g8.844ON105090315970.0
TPHA0I002708.844ON103992615060.0
KNAG0G034408.844ON105378314770.0
KLTH0C03784g8.844ON99788613511e-168
SAKL0D01364g8.844ON108274213221e-163
KAFR0A028508.844ON104244111111e-133
ZYRO0G14256g8.844ON125939710971e-129
NDAI0E002708.844ON119829610421e-122
Kwal_27.102398.844ON91438110221e-121
Kpol_1068.58.844ON103232510291e-121
TBLA0B032808.844ON136230310361e-120
NCAS0B002808.844ON10812989821e-114
ABL122C8.844ON10433929091e-104
Ecym_46158.844ON10673998781e-100
KLLA0D01485g8.844ON11513498291e-92
AFL061C6.183ON5232184526e-47
TBLA0B052106.183ON7102144572e-46
TPHA0J022106.183ON5932184487e-46
Ecym_22336.183ON5762184442e-45
NCAS0H010406.183ON6292134462e-45
NDAI0F022606.183ON6802144473e-45
KAFR0B066906.183ON5332144384e-45
SAKL0A05280g6.183ON5822154398e-45
TDEL0G016206.183ON5842144398e-45
KLLA0E19031g6.183ON6522144382e-44
Kpol_1002.696.183ON5902144353e-44
KNAG0M004306.183ON4432134254e-44
ZYRO0G08140g6.183ON6322134302e-43
CAGL0C01419g6.183ON6392144302e-43
Kwal_27.111586.183ON5672134174e-42
Suva_16.1236.183ON5962144185e-42
YPL184C (MRN1)6.183ON6122144186e-42
Smik_6.3906.183ON6252144142e-41
KLTH0H04906g6.183ON5692154122e-41
Skud_16.946.183ON6142144098e-41
KLTH0D11088g8.670ON42263900.057
KNAG0C014101.247ON65385900.070
AGR390C2.306ON37875870.13
TPHA0C035202.306ON44275840.31
Skud_4.478.466ON34377810.50
ACR135C8.670ON376161800.77
Ecym_24038.670ON375162800.85
ZYRO0F07238g8.670ON389176781.5
YOR242C (SSP2)8.670ON37188771.6
KAFR0D016608.797ON212175752.0
Smik_15.4268.670ON37188762.5
NDAI0F01720singletonON474101762.8
Kwal_26.87638.670ON42655762.8
NCAS0B061402.306ON443172753.8
Suva_8.2928.670ON37088735.1
Suva_4.398.466ON34844735.5
Kpol_1031.638.466ON344122727.4
TPHA0G010808.797ON22083708.9
TBLA0D028108.466ON30680718.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_13.26
         (1122 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...  1965   0.0  
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...  1605   0.0  
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...  1585   0.0  
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...   937   0.0  
TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8....   679   0.0  
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...   619   0.0  
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...   584   0.0  
KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {...   573   0.0  
KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} simila...   525   e-168
SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} simil...   513   e-163
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...   432   e-133
ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa...   427   e-129
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844     405   e-122
Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...   398   e-121
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...   400   e-121
TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...   403   e-120
NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844     382   e-114
ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON} ...   354   e-104
Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {...   342   e-100
KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...   323   1e-92
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...   178   6e-47
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...   180   2e-46
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....   177   7e-46
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...   175   2e-45
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...   176   2e-45
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183    176   3e-45
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...   173   4e-45
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...   173   8e-45
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...   173   8e-45
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...   173   2e-44
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...   172   3e-44
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...   168   4e-44
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...   170   2e-43
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...   170   2e-43
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...   165   4e-42
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...   165   5e-42
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...   165   6e-42
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...   164   2e-41
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...   163   2e-41
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...   162   8e-41
KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {...    39   0.057
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    39   0.070
AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}...    38   0.13 
TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.3...    37   0.31 
Skud_4.47 Chr4 complement(83397..84428) [1032 bp, 343 aa] {ON} Y...    36   0.50 
ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON} S...    35   0.77 
Ecym_2403 Chr2 (785307..786434) [1128 bp, 375 aa] {ON} similar t...    35   0.85 
ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {...    35   1.5  
YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON} ...    34   1.6  
KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.79...    33   2.0  
Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {...    34   2.5  
NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {O...    34   2.8  
Kwal_26.8763 s26 complement(934672..935952) [1281 bp, 426 aa] {O...    34   2.8  
NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa] ...    33   3.8  
Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON...    33   5.1  
Suva_4.39 Chr4 complement(74438..75484) [1047 bp, 348 aa] {ON} Y...    33   5.5  
Kpol_1031.63 s1031 (159123..160157) [1035 bp, 344 aa] {ON} (1591...    32   7.4  
TPHA0G01080 Chr7 complement(217639..218301) [663 bp, 220 aa] {ON...    32   8.9  
TBLA0D02810 Chr4 complement(688830..689750) [921 bp, 306 aa] {ON...    32   8.9  

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
            (REAL)
          Length = 1122

 Score = 1965 bits (5091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 983/1122 (87%), Positives = 983/1122 (87%)

Query: 1    MSNSNSRKPSANHAYRKQHDHNGMNAMVGNPMLYHPVDFMNGAGQYGPSQHPAYYTNSPL 60
            MSNSNSRKPSANHAYRKQHDHNGMNAMVGNPMLYHPVDFMNGAGQYGPSQHPAYYTNSPL
Sbjct: 1    MSNSNSRKPSANHAYRKQHDHNGMNAMVGNPMLYHPVDFMNGAGQYGPSQHPAYYTNSPL 60

Query: 61   PNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYNLGRSSKFNRKAYSRPIXXXXXX 120
            PNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYNLGRSSKFNRKAYSRPI      
Sbjct: 61   PNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYNLGRSSKFNRKAYSRPISSQNSY 120

Query: 121  XXXXXXXXXXXXXXXGMMTPSSYYRNGRTLFSRKDNNAVNVTHNIHKGYEXXXXXXXXXX 180
                           GMMTPSSYYRNGRTLFSRKDNNAVNVTHNIHKGYE          
Sbjct: 121  NANHNNNNNNSNSNNGMMTPSSYYRNGRTLFSRKDNNAVNVTHNIHKGYETRNSSGRRTS 180

Query: 181  XXXXXFDEIDPETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSN 240
                 FDEIDPETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSN
Sbjct: 181  SRINIFDEIDPETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSN 240

Query: 241  ALESAYIVGSKETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLN 300
            ALESAYIVGSKETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLN
Sbjct: 241  ALESAYIVGSKETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLN 300

Query: 301  LKFVCLNYDSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEFK 360
            LKFVCLNYDSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEFK
Sbjct: 301  LKFVCLNYDSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEFK 360

Query: 361  SPLEKAELFKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVL 420
            SPLEKAELFKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVL
Sbjct: 361  SPLEKAELFKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVL 420

Query: 421  DYLKKYSKKLGISKCFYVSLTPLMVSSARSSVASIYESKSSSHRLSTPSVPAXXXXXXXX 480
            DYLKKYSKKLGISKCFYVSLTPLMVSSARSSVASIYESKSSSHRLSTPSVPA        
Sbjct: 421  DYLKKYSKKLGISKCFYVSLTPLMVSSARSSVASIYESKSSSHRLSTPSVPAGNNNDINN 480

Query: 481  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTKLQGIDLDGTILEVTCHDYP 540
                                                  TTKLQGIDLDGTILEVTCHDYP
Sbjct: 481  INNNNNNGSIGSSIYGNSNISLTSLSSSVSLNEEIEVLTTKLQGIDLDGTILEVTCHDYP 540

Query: 541  TPVINEHSAHLSNIKISKTVDNSRQFTQDIPSPLPLNEHMFMTDSNQSNGTIVSQQLITA 600
            TPVINEHSAHLSNIKISKTVDNSRQFTQDIPSPLPLNEHMFMTDSNQSNGTIVSQQLITA
Sbjct: 541  TPVINEHSAHLSNIKISKTVDNSRQFTQDIPSPLPLNEHMFMTDSNQSNGTIVSQQLITA 600

Query: 601  XXXXXXXXXXXXRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDI 660
                        RVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDI
Sbjct: 601  PSPQSPNPQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDI 660

Query: 661  CNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGP 720
            CNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGP
Sbjct: 661  CNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGP 720

Query: 721  LPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGD 780
            LPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGD
Sbjct: 721  LPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGD 780

Query: 781  IEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTATEEKFDGRYKGL 840
            IEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTATEEKFDGRYKGL
Sbjct: 781  IEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTATEEKFDGRYKGL 840

Query: 841  LINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKESFDKVLN 900
            LINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKESFDKVLN
Sbjct: 841  LINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKESFDKVLN 900

Query: 901  LESLGISLDPHKGTDIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSDVKRAL 960
            LESLGISLDPHKGTDID                                   NSDVKRAL
Sbjct: 901  LESLGISLDPHKGTDIDEAEAEGTTGAEVENEVEAENGNETVGLGGLGLGVVNSDVKRAL 960

Query: 961  SDETDYDEFFNKXXXXXXXXXXIEVIMHSPSDPEYALKSQTLRSSSQTVLNSKRPAKVEN 1020
            SDETDYDEFFNK          IEVIMHSPSDPEYALKSQTLRSSSQTVLNSKRPAKVEN
Sbjct: 961  SDETDYDEFFNKSSRSSDSSSDIEVIMHSPSDPEYALKSQTLRSSSQTVLNSKRPAKVEN 1020

Query: 1021 EDGLVGLSQFNHRSSLKQAPPRAPSTLSHNHSKKNQMPIQDAGINAEVTDNKTKKRGSFP 1080
            EDGLVGLSQFNHRSSLKQAPPRAPSTLSHNHSKKNQMPIQDAGINAEVTDNKTKKRGSFP
Sbjct: 1021 EDGLVGLSQFNHRSSLKQAPPRAPSTLSHNHSKKNQMPIQDAGINAEVTDNKTKKRGSFP 1080

Query: 1081 RHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSDE 1122
            RHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSDE
Sbjct: 1081 RHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSDE 1122

>Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W
            (REAL)
          Length = 1131

 Score = 1605 bits (4157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 801/1134 (70%), Positives = 883/1134 (77%), Gaps = 15/1134 (1%)

Query: 1    MSNSNSRKPSANHAYRKQHDHNGMNAMVGNPMLYHPVDFMNGAGQYGPSQHPAYYTNSPL 60
            MSN N RKP AN+AYR+Q D+NGMNAMVGNP++YHPVDF+NGAGQYGPSQHPAYY+NSPL
Sbjct: 1    MSNQNQRKPVANYAYRQQQDYNGMNAMVGNPIIYHPVDFINGAGQYGPSQHPAYYSNSPL 60

Query: 61   PNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYNLGRSSKFNRKAYSRPIXXXXXX 120
            PN+PPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGY+  RSS F RKAYSRP+      
Sbjct: 61   PNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNFKRKAYSRPVSNHNNY 120

Query: 121  XXXXXXXXXXXXXXXGMMTPSSYYRNGRTLFSRKDNNAVNVTHNIHKGYEXXXXXXXXXX 180
                           GM+TPS+YYR  R  FSR +N+  N THN +KG +          
Sbjct: 121  NGNNNSNQNNNNN--GMVTPSNYYRIERNSFSRNNNSTRNSTHN-NKGCDNRNSSGRRTS 177

Query: 181  XXXXXFDEIDPETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSN 240
                 FD+I  E LLQ+PFRINYKILP GDDAYRTRSLLIENVD S DLHS+VKNFVKSN
Sbjct: 178  TRNNIFDDISSELLLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSN 237

Query: 241  ALESAYIVGSKETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLN 300
             LES YI+G++++D+L+ E+T NLSILISFLTR DCLNFYNNILQRLSEFKTFLKS+SLN
Sbjct: 238  TLESTYIIGNEKSDDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLN 297

Query: 301  LKFVCLNYDSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEFK 360
            LKFVCLNYD K L T +ED+ L+ + EQ    + S+MISASLHHD+ENKDATRSII+EFK
Sbjct: 298  LKFVCLNYDFKCLSTFIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEFK 357

Query: 361  SPLEKAELFKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVL 420
            SPL+  ELF +KLQFLDRS NKRYILESIDIV+TDVPSNQFPENY VLTFLNIFMAIEVL
Sbjct: 358  SPLKSTELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVL 417

Query: 421  DYLKKYSKKLGISKCFYVSLTPLMVSSARSSVASIYESKSSSHRLSTPSVPAXXXXXXXX 480
            DYLKKYSKKLGISKCFYVSL PL++SS RSSVA+IYE K+S+HRLS PSVP         
Sbjct: 418  DYLKKYSKKLGISKCFYVSLAPLVISSTRSSVANIYEIKTSTHRLSVPSVPVENNNDNNN 477

Query: 481  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTT----------KLQGIDLDGT 530
                                                   +          KLQGI LDGT
Sbjct: 478  SNNHKSNISDANTHNSNNSTRASLYGNSNVSLASLPSSVSLNEEIDILTTKLQGIQLDGT 537

Query: 531  ILEVTCHDYPTPVINEHSAHLSNIKISKTVDNSRQFTQDIPSPLPLNEHMFMTDSNQSNG 590
             LE+  HDY TP ++EHS HLSN+KISKTV+NSRQF  DIPSPLPLNE MFM DSN SNG
Sbjct: 538  DLEINYHDYQTPTVHEHSTHLSNVKISKTVENSRQFPHDIPSPLPLNERMFMNDSNHSNG 597

Query: 591  TIVSQQLITAXXXXXXXXXXXXRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGN 650
            +IV QQL+              RVLPNPITQSLEQNFNVSAKVASSMGSD+GNRTIYIGN
Sbjct: 598  SIVPQQLMATPSPVSSTIQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGN 657

Query: 651  INPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPIVLHGNML 710
            INPRSRAEDICNVVRGGILQ+IKY+ EKRICFVTFIEA SAVQFYANSFIDPIVLHGNML
Sbjct: 658  INPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNML 717

Query: 711  RVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQ 770
            RVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYK+LHETL+LPDAEQ
Sbjct: 718  RVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQ 777

Query: 771  LREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTATE 830
            LREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMN+E T H++ GE+  KTATE
Sbjct: 778  LREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTATE 837

Query: 831  EKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNEND 890
            +KF GRY+GLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNEND
Sbjct: 838  KKFGGRYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNEND 897

Query: 891  KKE-SFDKVLNLESLGISLDPHKGTDI-DXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 948
            KKE +FDK LNLESLGISLD HK   I +                               
Sbjct: 898  KKERAFDKALNLESLGISLDSHKDIGIGEIENKNCIGREIENEAEAVNRSNETVGIGGLG 957

Query: 949  XXXXNSDVKRALSDETDYDEFFNKXXXXXXXXXXIEVIMHSPSDPEYALKSQTLRSSSQT 1008
                +S+V RA SDETDY++ FNK          IEVIMHSPSDPEYALKSQTLRSSSQT
Sbjct: 958  LGVASSEVNRAASDETDYEDLFNKSSGSSDSSSDIEVIMHSPSDPEYALKSQTLRSSSQT 1017

Query: 1009 VLNSKRPAKVENEDGLVGLSQFNHRSSLKQAPPRAPSTLSHNHSKKNQMPIQDAGINAEV 1068
            V+NSKRP K E+E+  V +SQFNH+SSL+ APPRAPSTLS+N SKKN+ PI+D   N E 
Sbjct: 1018 VINSKRPVKAEDEEDAVEISQFNHKSSLRHAPPRAPSTLSYNRSKKNETPIRDIVPNGET 1077

Query: 1069 TDNKTKKRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSDE 1122
            T N+ K RGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDN +++E
Sbjct: 1078 TSNRKKNRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHTEE 1131

>Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W
            (REAL)
          Length = 1128

 Score = 1585 bits (4104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 815/1134 (71%), Positives = 877/1134 (77%), Gaps = 18/1134 (1%)

Query: 1    MSNSNSRKPSANHAYRKQHDHNGMNAMVGNPMLYHPVDFMNGAGQYGPSQHPAYYTNSPL 60
            M NSN RKP AN+AYR+QHD+NGMNAMVGN M+YHPVDF+NG GQYG SQHPAYYTNSPL
Sbjct: 1    MPNSNPRKPGANYAYRQQHDYNGMNAMVGNQMMYHPVDFINGVGQYGSSQHPAYYTNSPL 60

Query: 61   PNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYNLGRSSKFNRKAYSRPIXXXXXX 120
            PNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGY+  RSS   RKAYSRP+      
Sbjct: 61   PNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNLKRKAYSRPVSNQNGY 120

Query: 121  XXXXXXXXXXXXXXXGMMTPSSYYRNGRTLFSRKDNNAVNVTHNIHKGYEXXXXXXXXXX 180
                           GMMTPS+YYRNGR   SR +N+  NV+HN +KG +          
Sbjct: 121  NGNSSNHNHSGN---GMMTPSNYYRNGRNSSSRNNNSTRNVSHNNNKGCDTRNSSGRRAS 177

Query: 181  XXXXXFDEIDPETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSN 240
                 FDEI+PE LLQ+PFRINYKILP GDDAYRTRSLLIENVD S DLHSLVKNFVK N
Sbjct: 178  SRSNIFDEINPEILLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFN 237

Query: 241  ALESAYIVGSKETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLN 300
             LESAY V + + D+LE  ET+NLS+LISFLTR DCLNFYNNILQRLSEFK FLKSKSLN
Sbjct: 238  TLESAYFVDNDKNDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLN 297

Query: 301  LKFVCLNYDSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEFK 360
            LKFVCLNY+S+ L T VE E+    +EQ    + S MISASLHHDVENKDATRSIIIEFK
Sbjct: 298  LKFVCLNYESECLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFK 357

Query: 361  SPLEKAELFKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVL 420
            S LEK ELF+++LQFLD SKNKRYILESID+V+TDVPSNQFPENY VLTFLNIFMA+EVL
Sbjct: 358  SALEKTELFRKRLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVL 417

Query: 421  DYLKKYSKKLGISKCFYVSLTPLMVSSARSSVASIYESKSSSHRLSTPSVPAXXXXXXXX 480
            DYLKK+SK L ISKCFYVSLTPLMVSS RSSVA+IYESK+++ RLS PSVPA        
Sbjct: 418  DYLKKFSKSLEISKCFYVSLTPLMVSSTRSSVANIYESKTTTRRLSVPSVPAGIKNDNNN 477

Query: 481  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTKLQGIDLDGTILE------- 533
                                                  +   + IDL  T L+       
Sbjct: 478  NSNKGNISSINAQNNNSSIGSSIYGNSNISLTSLSSSVSLN-EEIDLLTTKLQGIELDGT 536

Query: 534  ---VTCHDYPTPVINEHSAHLSNIKISKTVDNSRQFTQDIPSPLPLNEHMFMTDSNQSNG 590
               +T HDY TP INEHS HLSNIKISKTV+NSR F QDIPSPLPLNE MFM DSNQSNG
Sbjct: 537  SLEITSHDYSTPTINEHSTHLSNIKISKTVENSRHFPQDIPSPLPLNEQMFMNDSNQSNG 596

Query: 591  TIVSQQLITAXXXXXXXXXXXXRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGN 650
             ++ QQLI A            RVLPN ITQSLEQNFNVSAKVASSMGSD+GNRTIYIGN
Sbjct: 597  AVIPQQLIAAPSPLSSNLQINQRVLPNAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGN 656

Query: 651  INPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPIVLHGNML 710
            INPRSRAEDICNVVRGGILQ+IKYI EKRI FVTFIEA SAVQFYANSFIDPIVLHGNML
Sbjct: 657  INPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNML 716

Query: 711  RVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQ 770
            RVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQ
Sbjct: 717  RVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQ 776

Query: 771  LREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTATE 830
            LREDFSTYGDIEQINYLSDSHCCWINFMNISSAI LVEEMN+E   H D GE+I KTA E
Sbjct: 777  LREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGE 836

Query: 831  EKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNEND 890
            EKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNEND
Sbjct: 837  EKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNEND 896

Query: 891  KKESFDKVLNLESLGISLDPHK--GTDIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 948
            KKESFDKVLNLESLGISLDPHK  G  +                                
Sbjct: 897  KKESFDKVLNLESLGISLDPHKDAGIGVIETENITGDEIESEIEAENVNDNETTGLGGLG 956

Query: 949  XXXXNSDVKRALSDETDYDEFFNKXXXXXXXXXXIEVIMHSPSDPEYALKSQTLRSSSQT 1008
                N DVKRA SDETDY+E FNK          IEVIMHSPSDPEYALKSQTLRSSSQT
Sbjct: 957  LGVANCDVKRATSDETDYEELFNKSSGSSDSSSDIEVIMHSPSDPEYALKSQTLRSSSQT 1016

Query: 1009 VLNSKRPAKVENEDGLVGLSQFNHRSSLKQAPPRAPSTLSHNHSKKNQMPIQDAGINAEV 1068
            V+NSKRP KVE+ED  VG+SQ NHRSSL+QAPPRAPSTLS++H KK++   QD+  NAE 
Sbjct: 1017 VINSKRPVKVEDEDD-VGISQLNHRSSLRQAPPRAPSTLSYDHLKKSETSFQDSR-NAET 1074

Query: 1069 TDNKTKKRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSDE 1122
             +N+ +KRGS PRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYS+E
Sbjct: 1075 ANNRERKRGSLPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSEE 1128

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
            RNA-binding protein that associates with mRNAs encoding
            cell wall proteins in high-throughput studies; deletion
            mutants display increased sensitivity to some cell wall
            disrupting agents; expression negatively regulated by
            cAMP
          Length = 1134

 Score =  937 bits (2422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/606 (75%), Positives = 497/606 (82%), Gaps = 3/606 (0%)

Query: 520  TKLQGIDLDGTILEVTCHDYPTPVINEHSAHLSNIKISKTVDNSRQFTQDIPSPLPLNEH 579
            TKLQG++LDGT LE+   DY TP I EHS HLSN+KISKT +NSRQF+QDIPSPLPLNEH
Sbjct: 529  TKLQGVELDGTYLEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQFSQDIPSPLPLNEH 588

Query: 580  MFMTDSNQSNGTIVSQQLITAXXXXXXXXXXXXRVLPNPITQSLEQNFNVSAKVASSMGS 639
            MFM DSNQSNG I+ QQLI              RVLPNPITQSLEQNFNVSAKVASSMGS
Sbjct: 589  MFMNDSNQSNGAIIPQQLIATPSPVSPNLQMNQRVLPNPITQSLEQNFNVSAKVASSMGS 648

Query: 640  DIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSF 699
            DIGNRTIYIGNINPRS+AEDICNVVRGGILQ+IKYI EK+ICFVTFIEA SAVQFYANSF
Sbjct: 649  DIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSF 708

Query: 700  IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQL 759
            IDPIVLHGNMLRVGWGHYSGPLPK ISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYK+L
Sbjct: 709  IDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 768

Query: 760  HETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDD 819
            HETL+LPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMN+E T  ++
Sbjct: 769  HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNE 828

Query: 820  SGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSK 879
            SGE+  K ATEEKF GRYKGLLINYGKDRCGNINKNL+AGKNSRFYKKVKRPSYNIRLSK
Sbjct: 829  SGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRLSK 888

Query: 880  LEERRRQNENDKKE-SFDKVLNLESLGISLDPHK--GTDIDXXXXXXXXXXXXXXXXXXX 936
            LEE+RRQNE D+KE +FDK LNLESLGISLD HK  G                       
Sbjct: 889  LEEKRRQNEIDEKEKAFDKPLNLESLGISLDAHKDNGGGETGTANNTGHENESELEAENE 948

Query: 937  XXXXXXXXXXXXXXXXNSDVKRALSDETDYDEFFNKXXXXXXXXXXIEVIMHSPSDPEYA 996
                            +SDVKRA SDETDY++ FNK          +EVIMHSPSDPEYA
Sbjct: 949  NGNETGSFGGLGLAVASSDVKRATSDETDYEDIFNKSSGSSDSSSDVEVIMHSPSDPEYA 1008

Query: 997  LKSQTLRSSSQTVLNSKRPAKVENEDGLVGLSQFNHRSSLKQAPPRAPSTLSHNHSKKNQ 1056
            LKSQTLRSSSQTV+NSKRP K+E+E+  VG+SQ N+RSSL+QAPPRAPSTLS+NHSK N+
Sbjct: 1009 LKSQTLRSSSQTVINSKRPVKIEDEEEAVGMSQLNYRSSLRQAPPRAPSTLSYNHSKNNE 1068

Query: 1057 MPIQDAGINAEVTDNKTKKRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAED 1116
             P+QD   N E  +N+ KKRGSF RHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAED
Sbjct: 1069 TPMQDIFTNGETANNRKKKRGSFARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAED 1128

Query: 1117 NAYSDE 1122
            N + DE
Sbjct: 1129 NTHPDE 1134

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/472 (72%), Positives = 386/472 (81%), Gaps = 2/472 (0%)

Query: 1   MSNSNSRKPSANHAYRKQHDHNGMNAMVGNPMLYHPVDFMNGAGQYGPSQHPAYYTNSPL 60
           MSNSNS+KP AN+AYR+Q D+NGMNAMVGNPM+YHPVDF+NGAGQYGPSQHPAYYTNSPL
Sbjct: 1   MSNSNSKKPVANYAYRQQQDYNGMNAMVGNPMMYHPVDFVNGAGQYGPSQHPAYYTNSPL 60

Query: 61  PNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYNLGRSSKFNRKAYSRPIXXXXXX 120
           PN+PPTPFDTAYGASL PSHLLMGSPFVSSPNMQ GYN  RSS   RKAYSRP+      
Sbjct: 61  PNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSGYNSARSSNLKRKAYSRPVSNHNGY 120

Query: 121 XXXXXXXXXXXXXXXGMMTPSSYYRNGRTLFSRKDNNAVNVTHNIHKGYEXXXXXXXXXX 180
                           M+TPS+YYR GR  FSR +N+  NVTHN +KG +          
Sbjct: 121 NGNSNSNQNNTNNG--MVTPSNYYRMGRNSFSRNNNSTRNVTHNNNKGCDTRNNSGRRTF 178

Query: 181 XXXXXFDEIDPETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSN 240
                FD+I PE LLQ+PF INYK+LP GDDAYRTRSLLIENVD S DLHS+VKNFVKSN
Sbjct: 179 ARNNIFDDILPEMLLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSN 238

Query: 241 ALESAYIVGSKETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLN 300
            LESAY++   ++D+ +  ETKNLSILISFLT+GDCLNFYNNILQRLSEFKTFLKS++LN
Sbjct: 239 TLESAYLIEGGKSDDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALN 298

Query: 301 LKFVCLNYDSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEFK 360
           LKFVCLNYD K LPT +E E L+ + E+A   + STMISASLHH++ NKDATRSIIIEFK
Sbjct: 299 LKFVCLNYDPKCLPTFIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEFK 358

Query: 361 SPLEKAELFKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVL 420
           SP+EK++LFK+KLQFLDRSKNKRYILESID+V+TDVPSNQFPENY VLTFLNI MAIEVL
Sbjct: 359 SPVEKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVL 418

Query: 421 DYLKKYSKKLGISKCFYVSLTPLMVSSARSSVASIYESKSSSHRLSTPSVPA 472
           DYLKKYSK LGISKCFYVSL PL+VSSARSSVA+IYE K+S+HRLS PSV A
Sbjct: 419 DYLKKYSKNLGISKCFYVSLAPLVVSSARSSVANIYEGKTSTHRLSVPSVTA 470

>TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8.844
           YML117W
          Length = 1115

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/762 (47%), Positives = 474/762 (62%), Gaps = 88/762 (11%)

Query: 190 DPETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSNALESAYIVG 249
           D     + PF + Y++LP G+D +RTRSLL ENVD S DLHS V NF     +ES Y+  
Sbjct: 157 DASKRFKDPFILTYRVLPKGNDEFRTRSLLFENVDGSIDLHSFVTNFTNYGPVESVYLF- 215

Query: 250 SKETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLNLKFVCLNYD 309
                   K E  ++SIL+SF ++  CL+FYN++LQRLSE+K+ L SK+L L FV L Y 
Sbjct: 216 --------KSEGDHVSILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEY- 266

Query: 310 SKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEFKSPLEKAELF 369
            K   T  ED +    E+ +  D  +   + SL +DV N+ ATRSI+I FK+P  K EL 
Sbjct: 267 -KVSDTSEEDID---KEDDSKPDAFNITAAGSLRYDVINRGATRSIMITFKTPCSKDELI 322

Query: 370 KEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVLDYLKKYSKK 429
            +KL+FL +  N RY+LESID+V  D PS  FP+NY VLTFLNIFMA+E+LDY++ +S+K
Sbjct: 323 DKKLEFLKKENNTRYVLESIDLVTADEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQK 382

Query: 430 LGISKCFYVSLTPLMVSSARSSVASI-----YESKSSSHRLSTPSVPAXXXXXXXXXXXX 484
           L ISKCF++S+ P +    R SV+S       ES S ++R    SV +            
Sbjct: 383 LDISKCFFISIQPQIPDGKRLSVSSASNGRSMESISGNYRSKNASVTSLESSGSIISLDQ 442

Query: 485 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTKLQGIDLDGTILEVTCHDYPTPVI 544
                                             T KLQ ++    ILEVT ++Y  P  
Sbjct: 443 EIDEM-----------------------------TYKLQSVNSKKNILEVTTNNYKDPSF 473

Query: 545 NEHSAHLSNIKISKTVDNSRQFT----------------QDIPSPLPLNEHMFMTDSNQS 588
             H+ HL+N+ +S+      Q T                QD+P P  +N    + D +  
Sbjct: 474 EGHTDHLTNVTVSEAASLDSQLTMPSPQEVTVNEYVLPNQDMPLPNDMNYAPSVQDVDAV 533

Query: 589 NGTIVSQQLITAXXXXXXXXXXXXRV---LPNPITQSLEQNFNVSAKVASSMGSDIGNRT 645
             ++V    +              R    +  PITQSL++ +  SA+VASSMG  IGNRT
Sbjct: 534 PPSMVPMSTMPNTPYGCYMPPPNVRQNGNMTKPITQSLQRQYATSAEVASSMGGGIGNRT 593

Query: 646 IYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPIVL 705
           +YIGNI+PRSR EDICNVVRGGILQN+K++AEKRICFVTF+EA++AVQFY N+FIDPIVL
Sbjct: 594 VYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVL 653

Query: 706 HGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLAL 765
           HGNML+VGWGH+SGPLPKSI+LAVT+GASRNVYVSLPEFAFK+K+I+DPQY++ ++   L
Sbjct: 654 HGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRL 713

Query: 766 PDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGELIP 825
           PD EQLR+DFS YGDIEQINYL+D HCCW+NF NIS+AI LVEE+  E  G+        
Sbjct: 714 PDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGN-------- 765

Query: 826 KTATEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRR 885
                +   GRY GL+I YGKDRCGN+NKN +AGKNSRFYKKVK+PS+NIRLSK+EE RR
Sbjct: 766 ---FYKMLGGRYDGLVIGYGKDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSKMEEERR 822

Query: 886 QNEN----DKKESFDKVLNLESLGISL------DPHKGTDID 917
           Q+E      ++ + +K L   SLGI++      DP K  D+D
Sbjct: 823 QHEETLRRQQENNSEKFLQFGSLGITIDSNGKEDPEKVDDVD 864

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%)

Query: 51 HPAYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNM 93
           P YY   P+ N PPTPFDTAYG +LLPSHLLMGSPFVSSPN+
Sbjct: 44 QPMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNL 86

 Score = 73.2 bits (178), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 60/173 (34%), Positives = 92/173 (53%), Gaps = 40/173 (23%)

Query: 983  IEVIMHSPSDPEYALKSQTLRSSSQTVLNSKRPAKVEN-EDGLVGLSQFNHRSS------ 1035
            +E+I++SP + E   KS++ R   +   N +R  K+ N  +G     +F   ++      
Sbjct: 946  VELIINSPEEEESNFKSKSNRGFRK---NDRR--KLANCAEGASSKERFKSTTNDVSSAL 1000

Query: 1036 ----LKQAPPRAPSTLSHNHS-----KKNQMPIQDAGINAEVTDNKTKKRGSF------- 1079
                L+  PP AP+T+S N+S     + N   ++D     E  D+++++  +F       
Sbjct: 1001 SSSSLEANPPMAPATISRNYSLMFKQQYNHEKLRD--FEGESFDDESQQESNFDFESTQQ 1058

Query: 1080 ---------PRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAE-DNAYSDE 1122
                        ++IPGSDVMAQYLAQ+QHSTF+YAANILGAS + DN Y DE
Sbjct: 1059 TRRRRYPNRRHGKSIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDNNYLDE 1111

>CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa]
           {ON} some similarities with uniprot|Q03735 Saccharomyces
           cerevisiae YML117w
          Length = 1050

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/903 (41%), Positives = 498/903 (55%), Gaps = 137/903 (15%)

Query: 57  NSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNM---------QGGYNLG-RSSKFN 106
           NSP  NVPPTPFDTAYGASLLPSHLLMGSP +S+ N+          GGYN   RS +F 
Sbjct: 43  NSPYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYNRNNRSFQFR 102

Query: 107 RKAYSRPIXXXXXXXXXXXXXXXXXXXXXGMMTPSSYYRNGRTLFSRKDNNAVNVTHNIH 166
           R +                          G +  S    NG T +     ++++      
Sbjct: 103 RNS--------------------------GFVLQS----NGNTPYMSSKRSSLSQAPMSQ 132

Query: 167 KGYEXXXXXXXXXXXXXXXFDE-----IDPETLLQKPFRINYKILPAGDDAYRTRSLLIE 221
           K  E                       ID    L  P  INY++LP+GDD Y+TRSLL E
Sbjct: 133 KRAEKNSTDSSVGSHGKKKLQHKKRTPIDVTKKLISPISINYRVLPSGDDTYKTRSLLFE 192

Query: 222 NVDDSADLHSL-VKNFVKSNALESAYIVGSKETDNLEKEETKNLSIL-ISFLTRGDCLNF 279
           NV  + ++ S+ ++  +  + +ES Y+    +T + +KE  K+   L +SFL+R   L+F
Sbjct: 193 NVQKNDEMLSVFMRLIINYSQVESVYVFQQTDTPSKDKESDKDTCCLQLSFLSRQAALDF 252

Query: 280 YNNILQRLSEFKTFLKSKSLNLKFVCLNYDSKSLPTP---------VEDEELSRSEEQAA 330
           YNN LQRL +FK  L S  L++ FV  +Y +                E   + RS+E   
Sbjct: 253 YNNFLQRLPDFKKKLSSPKLSVSFVSFSYVTDEDKDKDKDKDKDINTEKRNIKRSQE--- 309

Query: 331 TDDASTMISASLHHDVENKDATRSIIIEFKSPLEKAELFKEKLQFLDRSKNKRYILESID 390
                 +   +L  ++ + DATRSI IEF S +E+  LF EKL FLD   NKRYILE++D
Sbjct: 310 -----LLKEPALGEEIFSHDATRSIAIEFYSQVEQDALF-EKLPFLDDKDNKRYILEAVD 363

Query: 391 IVDTDVPSNQFPENYVVLTFLNIFMAIEVLDYLKKYSKKLGISKCFYVSLTPLMVSSARS 450
           I+  +  ++ FP NYV+LTF+NI MAIEVLDYLK       +++CF+VSL P   S   S
Sbjct: 364 IISAEDAADDFPANYVILTFINIKMAIEVLDYLKANLMTYSVNECFFVSL-PGCKSQRES 422

Query: 451 SVASIYESKSSSHRLSTPSVPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 510
           S   +    S+    S   V                                        
Sbjct: 423 STTPVLGHISTEGSKSVSEV------------------------------NLANGGNTVM 452

Query: 511 XXXXXXXXTTKLQGIDLDGTILEVTCHDYPTPVINEHSAHLSNIKISKTVDNSRQFTQDI 570
                   + +L  + L+   L++   DYP P I  H  H     I  + + S     D 
Sbjct: 453 IDRELESLSDELASLKLEEKCLKIIRSDYPKPEIRSHDDH-----IPGSTNFSMYIFDDG 507

Query: 571 PSPLPLNEHMFMTDSNQSNGTIVSQQLITAXXXXXXXXXXXXRVLP------------NP 618
            +P   N  M++ D+   + +I+                     LP             P
Sbjct: 508 MNP-EGNSGMYLHDNLTDHSSIIGSPFSNYIDPSISHVMLPNNGLPVGGFDAPGKFPIEP 566

Query: 619 IT------------QSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRG 666
           I+            QS+E   N SA++A++MG D  NRT+YIGNINPRS+ EDICNVVRG
Sbjct: 567 ISGPPFNHTNKVITQSIEDRLNTSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRG 626

Query: 667 GILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSIS 726
           GILQN+K+I +KRICFVTFIEA++A QF ANSFIDPIVLHGN LRVGWG+ SGPLPKSI+
Sbjct: 627 GILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIA 686

Query: 727 LAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINY 786
           LAVT+GA+RNVYVSLPE+AFK+KFI+DP+YK+ HE   LP  EQLR+DF+TYG+IEQINY
Sbjct: 687 LAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINY 746

Query: 787 LSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYGK 846
           L DSHCCW+NF+NI+SAI LVE++N     H++  E        +KF+ RY+GL+INYGK
Sbjct: 747 LKDSHCCWVNFINIASAIRLVEDIN-----HNNGEEF------HKKFNNRYEGLIINYGK 795

Query: 847 DRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKESFDKVLNLESLGI 906
           DRCGNINKNL+AGK S+FYKKVK+PSY+IR+ K+EE+R+  E++        + L+SLGI
Sbjct: 796 DRCGNINKNLIAGKGSKFYKKVKKPSYDIRIKKMEEKRKMQEDNLLSQKKNSIQLDSLGI 855

Query: 907 SLD 909
           S+D
Sbjct: 856 SVD 858

 Score =  470 bits (1210), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 251/504 (49%), Positives = 324/504 (64%), Gaps = 47/504 (9%)

Query: 619  ITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEK 678
            ITQS+E   N SA++A++MG D  NRT+YIGNINPRS+ EDICNVVRGGILQN+K+I +K
Sbjct: 579  ITQSIEDRLNTSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDK 638

Query: 679  RICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVY 738
            RICFVTFIEA++A QF ANSFIDPIVLHGN LRVGWG+ SGPLPKSI+LAVT+GA+RNVY
Sbjct: 639  RICFVTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVY 698

Query: 739  VSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFM 798
            VSLPE+AFK+KFI+DP+YK+ HE   LP  EQLR+DF+TYG+IEQINYL DSHCCW+NF+
Sbjct: 699  VSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFI 758

Query: 799  NISSAISLVEEMNEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNLVA 858
            NI+SAI LVE++N     H++  E        +KF+ RY+GL+INYGKDRCGNINKNL+A
Sbjct: 759  NIASAIRLVEDIN-----HNNGEEF------HKKFNNRYEGLIINYGKDRCGNINKNLIA 807

Query: 859  GKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKESFDKVLNLESLGISLDPHKGTDIDX 918
            GK S+FYKKVK+PSY+IR+ K+EE+R+  E       D +L+ +   I LD   G  +D 
Sbjct: 808  GKGSKFYKKVKKPSYDIRIKKMEEKRKMQE-------DNLLSQKKNSIQLD-SLGISVDR 859

Query: 919  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSDVKRALSD---ETDYDEFFNKXXX 975
                                              N  VK+ L     ++D+ +  +    
Sbjct: 860  TFSNESKLSGGHTTTEE-----------------NGGVKQDLESNDYKSDHPQISSNGPI 902

Query: 976  XXXXXXXIEVIMHSPSDPEYALKSQTLRSSSQTVLNSKRPAKVENEDGLVGLSQFNHRSS 1035
                      I    S  + ++ S    S+S+   +S R  +  N  G      F  +++
Sbjct: 903  GIGLSSKKSPIFDDISGSDESVISDFENSASKETSSSDRKYQTTNSRG----DTFVPKTN 958

Query: 1036 LKQAPPRAPSTLSHNHSKKNQMP-IQDAGINAEVTDNKTKKRGSFPRH---RTIPGSDVM 1091
            L  APPRAPST++  + K + +P +       +      +   +FP     R IPGSDVM
Sbjct: 959  LSHAPPRAPSTINMTYKKISYVPPLNGQAPKMDYPKKYKRTHNNFPNQQPTRPIPGSDVM 1018

Query: 1092 AQYLAQVQHSTFMYAANILGASAE 1115
            AQYLAQ+QHSTFMYAANILGAS E
Sbjct: 1019 AQYLAQLQHSTFMYAANILGASVE 1042

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
            Anc_8.844 YML117W
          Length = 1039

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/926 (38%), Positives = 510/926 (55%), Gaps = 106/926 (11%)

Query: 199  FRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSNALESAYIVGSKETDNLEK 258
            ++I+Y+ILP GDD Y TRSLL EN+++S DLH+ ++ FV    +ES Y+V S ET     
Sbjct: 210  YKISYQILPKGDDTYHTRSLLFENINESIDLHTFIEKFVNYGLIESVYVVPSYET----- 264

Query: 259  EETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLNLKFVCLNYDSKSLPTPVE 318
             +    SIL+SF +R  CL+FYN++LQ+LSE+KT L S++L L FV L Y   ++     
Sbjct: 265  HQNSVKSILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYLQNNINKG-- 322

Query: 319  DEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEFKSPLEKAELFKEK-LQFLD 377
            + ++S   ++  TD   T +   + + V N  ATRS+ IEF   ++K + F E  L FL 
Sbjct: 323  NGKISVESQKNETDFELTSL---IQYQVANFGATRSLCIEFDKRVDKIDDFIETYLPFLS 379

Query: 378  RSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVLDYLKKYSKKLGISKCFY 437
             + NKRYI+ES+ IV+ +   N+FP +YV+L+FLNI M IEVL Y++  +    I  C Y
Sbjct: 380  SNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIEVLHYIRSKNLSKTIKNCLY 439

Query: 438  VSLTPLMVSSARSSVASIYESKSSSHRLSTPSVPAXXXXXXXXXXXXXXXXXXXXXXXXX 497
            VS      + + S+  S+   K +S  L+T ++ +                         
Sbjct: 440  VSFDRTKHAVSNSNRQSL-SKKGTSDTLNTYTLES----------------------PIN 476

Query: 498  XXXXXXXXXXXXXXXXXXXXXTTKLQGIDLDGTILEVTCHDYPTPVINEHSAHLSNIKIS 557
                                   KL  +++      +   +Y  P I   + HL N+ IS
Sbjct: 477  HNTEVDMNDIPSIYDENEIEIANKLSELEIQTHTFNLDISNYSNPHIEIRAEHLPNVSIS 536

Query: 558  KT-VDNSRQFTQDIPSPLPLNEHMFMTDSNQSNGTIVSQQLITAXXXXXXXXXXXXRVLP 616
            +  +  +    Q  PS     E+M+ T    S+  +  +                   +P
Sbjct: 537  RDPMIYANPIYQSPPSGYM--ENMWTTTPFLSSHIVHEEYANDRVDYNMKHYNNQLYNVP 594

Query: 617  NPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIA 676
             P  Q+L+  F  SA++AS MG  +GNRTI+IGNINPRS+ EDICNV RGGI+Q +KYI 
Sbjct: 595  LP--QTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIR 652

Query: 677  EKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRN 736
            EK ICFV FI+  +A QFYANSFIDPI+LH N L++GWG + GPLPK+I LAVT GASRN
Sbjct: 653  EKNICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRN 712

Query: 737  VYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWIN 796
            VYVSLPEFAFK+K+I+DP YK+ H    LP  +QLREDFS +G++EQIN+L D HCCWIN
Sbjct: 713  VYVSLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWIN 772

Query: 797  FMNISSAISLVEEMNEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNL 856
            F NI SAI LVE +  E   +             E++  RYKGL+I YGKDRCGN+NK+L
Sbjct: 773  FTNIRSAIKLVELVKNEDNNN-----------FHERYKNRYKGLIIGYGKDRCGNVNKSL 821

Query: 857  VAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKESFDKVLNLESLGISLDPHKGTDI 916
            V+ KNSR+++KVK+PSYNIRL +LEE R++N+ + K+  +K +NL+SLGI+  P++    
Sbjct: 822  VSNKNSRYFRKVKKPSYNIRLQQLEEERKRND-EIKQIDNKRINLDSLGITTSPNQNIQE 880

Query: 917  DXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSDVKRALSDETDYDEFFNKXXXX 976
            D                                   ++  K +  +E+D D+        
Sbjct: 881  D-----------------------ETLSLAKLKLTSDTGFKNS-ENESDIDD------SA 910

Query: 977  XXXXXXIEVIMHSPSDPEYALKSQTLRSSSQTVLNSKRPAKVENEDGLVGLSQFNHRSSL 1036
                  +E+I++SP +     KS   R      L+     KV   D +V           
Sbjct: 911  SNSSTDVELIINSPGN---GFKSHRNRKPKPNNLDLGERPKV---DAIV----------F 954

Query: 1037 KQAPPRAPSTLSHNHSKKNQMPIQDAGINAEVTDNKTKKRGSFPRHRTIPGSDVMAQYLA 1096
            K   P AP+ LSH++ + +   + +    +E T  +T K       + IPGSDVM+QYLA
Sbjct: 955  KADGPMAPNKLSHDYHRTHNTRVDNP--RSERTRKRTHK-------KIIPGSDVMSQYLA 1005

Query: 1097 QVQHSTFMYAANILGASAEDNAYSDE 1122
            QVQHSTFMYAAN+L AS E+  + DE
Sbjct: 1006 QVQHSTFMYAANVLNASIEEPEFYDE 1031

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 22/25 (88%)

Query: 68  FDTAYGASLLPSHLLMGSPFVSSPN 92
           FD AYG +LLPSH+LM SPFVS+PN
Sbjct: 112 FDYAYGTTLLPSHILMNSPFVSTPN 136

>KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {ON}
           Anc_8.844 YML117W
          Length = 1053

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/783 (44%), Positives = 444/783 (56%), Gaps = 117/783 (14%)

Query: 190 DPET---LLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSNALESAY 246
           DP+    L Q PF I+YKILP GDD YRTRSLL+ N+DD  DLH+ V  FV++N++ES Y
Sbjct: 148 DPQIINGLFQIPFEISYKILPKGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVY 207

Query: 247 IVGSKETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLNLKFVCL 306
           I         E ++ +    L+SFL+   CLNFYNN+LQRL EFK  LK+ SL L FV +
Sbjct: 208 ITK-------EGQQPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSM 260

Query: 307 NYDSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENK-DATRSIIIEFKSP--- 362
               +  PT VE +   R     A DD   M  A+LH D+  +  ATRSI IEF      
Sbjct: 261 ----RQRPTKVEGKIYRR----FAADDGDGM--ANLHFDMAAQTGATRSIAIEFVDKDVI 310

Query: 363 LEKAELFKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVLDY 422
           L + EL  +KL+FL    N RYILE I +  T   +  F +NY ++TFL+I MA+E++DY
Sbjct: 311 LTRDELLNKKLKFLSEGNN-RYILEHIAVFKTQHGTKVFGKNYAIITFLSIPMAMEIMDY 369

Query: 423 LKKYSKKLGISKCFYVSLTPLMVSSARSSVASIYESKSSSHRLSTPSVPAXXXXXXXXXX 482
           LK   K+L ++K FYV +T     S  +S    + + + S+R ++P              
Sbjct: 370 LKLNIKQLHLTKFFYVQVTHPPQQSPAASQKKPHANDTESNRDTSPP------------- 416

Query: 483 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTKLQGIDLDGTILEVTCHDYPTP 542
                                                 KL+ I+L  + L++   DYP P
Sbjct: 417 ---NSKKDQEFFPNNSMLSLVSSESSTSLADDVDGLVNKLKSIELQESTLKLRVEDYPEP 473

Query: 543 VINEHSAHLSNIKISKTVDNSR----------------QFTQDIPSP----LPLNEHMFM 582
           +  + S H + I  S  V  +R                 F  DI SP    LPL      
Sbjct: 474 LFEQFSEHSNGIVQSLPVPQTRPIGGPQSSISTPRAFGAFPNDIGSPPASFLPL------ 527

Query: 583 TDSNQSN---------------GTIVSQQLITAXXXXXXXXXXXXRVLPNPITQSLEQNF 627
            D N SN               G +  QQ                    +PIT SLE   
Sbjct: 528 -DLNHSNSVPNLPPGFIPATPSGPMSPQQQQLFLNSQRQQRDHAGGKFAHPITDSLESQM 586

Query: 628 NVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIE 687
             S +VA++MGSD  NRTIYIGNINPRSRAEDICNVVRGGILQNIK+I  K ICF+TFIE
Sbjct: 587 KTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIE 646

Query: 688 AASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFK 747
           A++AVQFYAN+FIDPIVLHGN L++GWG Y+GPLPK I+LAVTIGASRNVY+SLPE AFK
Sbjct: 647 ASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFK 706

Query: 748 EKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLV 807
           +K+I DP++K  HE+  LP  E LR+DF  YG IEQIN L+DSHCCW+NFMNISSAI LV
Sbjct: 707 DKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLV 766

Query: 808 EEMNEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKK 867
           E+ +   T  D   +L         FD RY+GL+INYGKDRCGNIN+NLVAGK S+++KK
Sbjct: 767 EDAS---TKQDHFNQL---------FDHRYEGLVINYGKDRCGNINRNLVAGKTSKYHKK 814

Query: 868 VKRPSYNIRLSKLEERRRQNENDKKE----------SFDKV------------LNLESLG 905
           VK+ + ++RLS+LEE+RR  + +++E           FD              L+L+SLG
Sbjct: 815 VKKHTRDVRLSQLEEKRRNQDAERREMVNGTIPEENPFDAFAINTGSAEKKDELSLDSLG 874

Query: 906 ISL 908
           IS+
Sbjct: 875 ISI 877

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 77/152 (50%), Gaps = 32/152 (21%)

Query: 983  IEVIMHSPSDPEYALKSQTLRSSSQTVLNSKRPAKVENEDGLVGLSQFNHRSSLKQAPPR 1042
            IE+I++ P+DP  ++       S+ +  + KR         LV L + +        PP 
Sbjct: 921  IELIINPPNDPNRSVGVLEGDPSTLSPPSDKR--------KLVALHEVS-----SPPPPL 967

Query: 1043 APSTLSHNHSKKNQMPIQDAGINAEVTDN-----------KTKKRGSFPRH-RTIPGSDV 1090
            AP T+S  +++ +         N  VT N             + R   PR+ RTIPGSDV
Sbjct: 968  APDTISRQYAEASYH-------NELVTGNDHPDTGYGKAENGRHRQQLPRNARTIPGSDV 1020

Query: 1091 MAQYLAQVQHSTFMYAANILGASAEDNAYSDE 1122
            MAQYLAQ+QHSTFMYAAN+LGAS E     D+
Sbjct: 1021 MAQYLAQLQHSTFMYAANVLGASNEGTEQYDD 1052

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (91%)

Query: 57  NSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNM 93
           NSP+ N  PTPFDTAYGA+LLPSHLLMGSPFVS+PN+
Sbjct: 83  NSPMTNGMPTPFDTAYGATLLPSHLLMGSPFVSTPNL 119

>KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 997

 Score =  525 bits (1351), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 341/886 (38%), Positives = 469/886 (52%), Gaps = 170/886 (19%)

Query: 47  GPSQHPAYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVS-------SPNMQGGYNL 99
           G  ++  YY  + +P  P TPFDT+YG SLLPSHLLM SPF++       SP+  G    
Sbjct: 32  GSREYSGYYHGNRVPPAPQTPFDTSYGVSLLPSHLLMSSPFLATPGMGSASPHRAG---- 87

Query: 100 GRSSKFNRKAYSRPIXXXXXXXXXXXXXXXXXXXXXGMMTPSSYYRNGRTLFSRKDNNAV 159
           G  S   + +Y  P                        M P +  RN +   S + N++V
Sbjct: 88  GSRSSHAQSSYHTPNFGSTQLR----------------MPPPTEKRNFKHGSSYRHNSSV 131

Query: 160 NVTHNIHKGYEXXXXXXXXXXXXXXXFDEIDPETLLQKPFRINYKILP----AGDDAYRT 215
                                               Q+ + + + ILP     G D Y T
Sbjct: 132 Q-----------------------------------QRAYEVVFHILPRSADGGGDEYMT 156

Query: 216 RSLLIENVDDSADLHSLVKNFVKSNALESAYIVGSKETDNLEKEETKNLSILISFLTRGD 275
           RSLL  N++    LH  +  F K + +ES Y+V S++            S+L+SFLT+  
Sbjct: 157 RSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLVDSQQQ-----------SVLVSFLTKET 205

Query: 276 CLNFYNNILQRLSEFKTFLKSKSLNLKFVCLNYDSKSLPTPVEDEELSRSEEQAATDDAS 335
           CL+FYN +LQ+LSEFK  LKSK L L F  L  D K+ PT  E                 
Sbjct: 206 CLDFYNGVLQKLSEFKKELKSKELTLNFASLR-DVKTGPTLQE----------------- 247

Query: 336 TMISASLHHDVENKDATRSIIIEFKSPLEKAELFKEKLQFLDRSKNKRYILESIDIVDTD 395
                 +  +V    ATRS+I+EF+  ++ A L  + L F+  ++  RY++E+I+IV+  
Sbjct: 248 ------IKIEVLRAGATRSLILEFQDKVDLA-LLSKSLGFI-VNEGPRYVVEAIEIVNAG 299

Query: 396 VPSNQFPENYVVLTFLNIFMAIEVLDYLKKYSKKL-GISKCFYVSLTPLMVSSARSSVAS 454
             S  F  +Y ++ F++I MA+E ++YLK  S KL G+ K  YV+ T    +S +S   +
Sbjct: 300 RSSKHFGPHYAIIHFISIAMALETVEYLKSQSNKLAGLIKFRYVNTTS---ASGKSEFQT 356

Query: 455 IYESKSSSHRLSTPSVPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 514
           +  S+ +   LS  S                                             
Sbjct: 357 LSSSQLNERALSNTS------------------------------------DSDISGGES 380

Query: 515 XXXXTTKLQGIDLDGTILEVTCHDYPTPVINEHSAHLSNIKISKTVDNSRQF---TQDIP 571
                +KLQ   L    L V    Y  P++ E S HL ++ ISK +++       T +  
Sbjct: 381 VASLGSKLQQTSLGEQTLVVDPTQYGRPLVEERSEHLPHVTISKALNSKSSLNDLTSNTT 440

Query: 572 SPLP----LNEHMFMTDSNQSNGTIVSQQLITAXXXXXXXXXXXXRVL--PNPITQSLEQ 625
           SP P    +N+H    + + S G++VS +   +              +    P+ Q+L+Q
Sbjct: 441 SPQPQEVLVNDH----EDSSSRGSMVSLKQANSHGPAYPPIPGYPFYMNMSKPLGQTLQQ 496

Query: 626 NFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTF 685
            +  +A+VA++MG  +GNRT+YIGNI+PRS+ EDICNVVRGGILQ++KYI  K ICFVTF
Sbjct: 497 QYTTTAQVATAMGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTF 556

Query: 686 IEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFA 745
           IEAASAVQF+ANS I+PIVLHGN+L+VGWGH+SG LP+SISLAVTIGASRNVYVSLPE A
Sbjct: 557 IEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHA 616

Query: 746 FKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIS 805
           FK+KFI DP+Y++  E   LP  EQL EDFS +GDIE +N+L D HCCWINFMNIS+AI 
Sbjct: 617 FKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIK 676

Query: 806 LVEEMNEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFY 865
           LVE+ N     ++DS          EKF  RYKGL I YGKDRCGN+NKNLVA KNS+++
Sbjct: 677 LVEDANNP---NNDS--------FHEKFGNRYKGLFIGYGKDRCGNVNKNLVANKNSKYF 725

Query: 866 KKVKRPSYNIRLSKLEERRRQNEN---DKKESFDKVLNLESLGISL 908
           KKVK+ SYNIRL K ++          D+ +  DK +  ++ GIS+
Sbjct: 726 KKVKKASYNIRLRKQQKGASDAPTEVKDEAKELDKPIKADAFGISV 771

 Score = 72.0 bits (175), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 46/101 (45%), Positives = 56/101 (55%), Gaps = 12/101 (11%)

Query: 1034 SSLKQAPPRAPSTLSHNH---SKKNQMPIQDAGINAEVT------DNKTKKRGSFPRHR- 1083
            +SL   PP APSTLS  +   SK N       G   + +       ++  K+   PR R 
Sbjct: 888  ASLDAVPPLAPSTLSRQYTATSKHNSRRGSRFGTTEKSSPRYNDIRSQDSKKPLHPRRRK 947

Query: 1084 --TIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSDE 1122
               IPGSDVMAQYLAQ+QHSTFMYAANILG    +  + DE
Sbjct: 948  SKAIPGSDVMAQYLAQLQHSTFMYAANILGVDDGETVFYDE 988

>SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1082

 Score =  513 bits (1322), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 306/742 (41%), Positives = 411/742 (55%), Gaps = 127/742 (17%)

Query: 197 KPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSNALESAYIV-------- 248
           +P+ IN+KILP GDD Y TRSLL+ NV+ S  LH  +  FVK   +ES Y+V        
Sbjct: 181 EPYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVPEEEEEEE 240

Query: 249 ------GSKETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLNLK 302
                   +E +  EK E K  SIL+SFLT+  CL+FYNN+LQ+LS+FK  L SKSL L 
Sbjct: 241 EEEEEEEEEEEEEEEKGEEKKQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLN 300

Query: 303 FVCLNYDSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEFKSP 362
           FV L                                S  +  DV  K ATRSI +EFK+ 
Sbjct: 301 FVSL-------------------------------TSEDIRDDVLRKGATRSIALEFKNS 329

Query: 363 LEKAELFKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVLDY 422
               +L  E ++ L  + N R+++E IDIV+T+ P+  F  +Y ++ F++I MA+E   Y
Sbjct: 330 FTTKQL--ESIEILSNASNSRFVVEKIDIVNTESPNKNFNTHYAIIHFISISMAVEASSY 387

Query: 423 LKKYSKKLGISKCFYVSLTPLMVSSARSSVASIYESKSSSHRLSTPSVPAXXXXXXXXXX 482
           L  + +KLGIS+          V+ +  + +  + S  +S   S  SV            
Sbjct: 388 LLNWDEKLGISRL-------FFVTDSIINKSDYFRSAPASQDASRSSV------------ 428

Query: 483 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTKLQGIDLDGTILEVTCHDYPTP 542
                                               T KLQG+ L    L +    YP  
Sbjct: 429 ---------------------------SIDQTLEFATKKLQGLVLKERTLSIKPKTYPQA 461

Query: 543 VINEHSAHLSNIKISK--------TVDNSRQFTQDIPSPLPLNEHMFMTDSNQSN--GTI 592
            I EH  HL++I ISK        +   S Q  Q++ S  P+ + M++ D++ S     +
Sbjct: 462 EIEEHQHHLTSISISKPLLSSNNNSSSVSLQGNQNLTSS-PVTQEMYLHDTSNSTREDVM 520

Query: 593 VSQQLITAXXXXXXXXXXXXRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNIN 652
           +   + +               +  PI Q+L+Q    +A+VAS+MG  +GNRT+Y+GNIN
Sbjct: 521 IQSSMASGTSNFVPPPPHYYMDVTKPIRQTLQQQLTTTAQVASNMGGGLGNRTVYLGNIN 580

Query: 653 PRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRV 712
           PRS+ EDICNVVRGGILQ+IK+   K +CFVTFIEAA+AVQF+AN+ I+PIVLHGN+L+V
Sbjct: 581 PRSKPEDICNVVRGGILQHIKFFEHKHVCFVTFIEAAAAVQFFANASIEPIVLHGNVLKV 640

Query: 713 GWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLR 772
           GWGH+ G L +SI+LAVTIGASRNVYVSLPE+AFK+KFI DP++++  E   LP  EQLR
Sbjct: 641 GWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLR 700

Query: 773 EDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTATEEK 832
           +DFS +G+IEQINYL D HCCW+NFMNI+SAI LVE+ N                A  +K
Sbjct: 701 QDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDAN---------------GADNKK 745

Query: 833 FDG----RYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNE 888
           F G    RYKGL+I YGKDRCGN+NKNLVA K SRF+KKVK+ SY IR+ K  +    N 
Sbjct: 746 FHGSYQDRYKGLIIGYGKDRCGNVNKNLVANKKSRFFKKVKKASYKIRMHKQNKAGGSNG 805

Query: 889 NDKKESFDKVLNLESLGISLDP 910
            +   SF       + GI + P
Sbjct: 806 QEPISSFQD----NAFGICISP 823

 Score = 84.3 bits (207), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 53/86 (61%), Gaps = 6/86 (6%)

Query: 11 ANHAYRKQHDHNGMNAMVGNPMLYHPVDFMNGAGQYG-----PSQHPAYYTNSPLPNVPP 65
          ++H Y      NG+       M YHP+  MNG  Q       PSQ   YY  SP+P+ P 
Sbjct: 10 SSHQYATMAPPNGIQPHYPQTMAYHPMGPMNGGVQPTMQMSLPSQQ-GYYAGSPMPSAPQ 68

Query: 66 TPFDTAYGASLLPSHLLMGSPFVSSP 91
          TPFDT+YGA+LLPSHLLMGSPF+S+P
Sbjct: 69 TPFDTSYGATLLPSHLLMGSPFISTP 94

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 63/123 (51%), Gaps = 8/123 (6%)

Query: 1003 RSSSQTVLNSKRPAKVENEDGLVGLSQFNHRSSLKQAPPRAPSTLSHNHSKKNQMPIQDA 1062
            +  S+T L  +  + + +   L G       +SL   PP APST+S ++S  +       
Sbjct: 944  KEKSRTKLKRRPTSGLTDLYSLNGFPSMVSSTSLDAVPPLAPSTVSRHYSVASSHSNNSY 1003

Query: 1063 GINAEVTDNKTKKRGS-----FPRHR---TIPGSDVMAQYLAQVQHSTFMYAANILGASA 1114
              N     +K +  G        RHR    IPGS VMAQYLAQ+QHSTFMYAANILG + 
Sbjct: 1004 HNNGRHDASKKRHGGGKGNTHHGRHRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVTN 1063

Query: 1115 EDN 1117
             DN
Sbjct: 1064 GDN 1066

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
           Anc_8.844 YML117W
          Length = 1042

 Score =  432 bits (1111), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 236/441 (53%), Positives = 280/441 (63%), Gaps = 72/441 (16%)

Query: 521 KLQGIDLDGTILEVTCHDYPTPVINEHSAHLSNIKISKTVDNSRQFTQDIPSPLPLNEHM 580
           KL+GI L    L++   DYP P  N  + HL N+ IS       Q  Q IP   P  + +
Sbjct: 468 KLKGIKLKDISLDILPRDYPEPEFNFSTDHLPNVTISVPT----QLDQ-IPG-TPRTQEI 521

Query: 581 FMTDSNQS----------------NGTIVS--------QQLITAXXXXXXXXXXXXRVLP 616
           ++ D + S                NGT +S        Q                     
Sbjct: 522 YINDMSPSFEGIDMMNSSSTMLSGNGTFISNTPMLIPSQSFYMDQNTQIQEAPFRSNSFI 581

Query: 617 NPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIA 676
           +PIT SLE   + SAKVAS+MGSD GNRTIYIGNINPRS+AEDICNVVRGGILQ+IK+I 
Sbjct: 582 HPITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIE 641

Query: 677 EKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRN 736
            K ICFVTFIEAA+AVQFYAN+FIDPIVLHGN L++GWG+YSGPLPKSI+LAVTIGASRN
Sbjct: 642 SKHICFVTFIEAAAAVQFYANAFIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRN 701

Query: 737 VYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWIN 796
           VYVSLPEFAFK+K+I+DP++K+ HE   LPD EQLR DFS+YG  EQINYLSDSHCCW+N
Sbjct: 702 VYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVN 761

Query: 797 FMNISSAISLVEEMNEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNL 856
           FMNISSAI LVEE   +    +            EKFD RY GL+INYGKDRCGNINKNL
Sbjct: 762 FMNISSAIKLVEEATNDFDRFN------------EKFDERYNGLVINYGKDRCGNINKNL 809

Query: 857 VAGKNSRFYKKVKRPSYNIRLSKLEERRR----------------------------QNE 888
           +AGKNSRFYK   R ++N +LSKLEE+RR                            Q+ 
Sbjct: 810 IAGKNSRFYK--IRQNHNFKLSKLEEKRRDHDRRENGFKHVYNDEETIYNESMETDNQHN 867

Query: 889 NDKKESFDKVLNLESLGISLD 909
            + KE+  K L L+SLGISL+
Sbjct: 868 EESKENDGKFLQLDSLGISLE 888

 Score =  213 bits (541), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 127/283 (44%), Positives = 173/283 (61%), Gaps = 42/283 (14%)

Query: 192 ETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSNALESAYIVGSK 251
           E L  +P  I+Y ILP GDDAYRTRSLL ENVD++ +LHS + NFVK+N++ES Y+V +K
Sbjct: 174 EKLFTEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNK 233

Query: 252 ETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLNLKFVCLNYDSK 311
              N          I++SFL+R  CL+FYNN+LQRL EFK  L S+SLNL FV L Y+  
Sbjct: 234 NDSN-------TCDIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYN-- 284

Query: 312 SLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEFKSP------LEK 365
                    + +R  +             SL  ++  +DATRS+ IE  S       LEK
Sbjct: 285 ---------KTTRDNQ-----------GPSLEFNIVTRDATRSLAIELCSNENDSLILEK 324

Query: 366 AELFKEKL-QFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVLDYLK 424
            +LF++ L + L   +NKRY+LESID+V TD  + +F +NY +L+FLNI MAIE++DY++
Sbjct: 325 EQLFEKILNEILRTDENKRYVLESIDLVSTDKSNKEFGKNYAILSFLNITMAIEIMDYIQ 384

Query: 425 KYSKKLGISKCFYVSLTPLMV------SSARSSVASIYESKSS 461
             S KL I KC +V++ PL+       SSA SS  +I  S SS
Sbjct: 385 VISSKLNIGKCSFVTIQPLIENNVMNNSSALSSATNIQSSVSS 427

 Score = 86.3 bits (212), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 59/103 (57%), Gaps = 11/103 (10%)

Query: 1   MSNSNSRKPSANHAYRKQH---DHNGMNAMVGNPMLYHPVDFMNGAGQYGP-----SQH- 51
           M  S SRK S  H Y+ Q    D         NP++ +P  F    G   P     S H 
Sbjct: 2   MRPSYSRKNSGFHIYQSQQPAQDQYYSAFDTTNPLMSYP-QFEQPYGATFPPPLSSSTHF 60

Query: 52  -PAYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNM 93
              YY  SPLPN PPTPFDTAYGA+LLPSHLLMGSPF+SSPN+
Sbjct: 61  QQTYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNV 103

 Score = 69.7 bits (169), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 31/38 (81%), Positives = 34/38 (89%)

Query: 1084 TIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSD 1121
            TIPGSDVMAQYLAQ+QHSTFMYAANILGAS E+  Y +
Sbjct: 996  TIPGSDVMAQYLAQLQHSTFMYAANILGASGEEEYYDE 1033

>ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa]
           {ON} similar to uniprot|Q03735 Saccharomyces cerevisiae
           YML117W NAB6 Putative RNA-binding protein based on
           computational analysis of large-scale protein-protein
           interaction data
          Length = 1259

 Score =  427 bits (1097), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 214/397 (53%), Positives = 275/397 (69%), Gaps = 30/397 (7%)

Query: 532 LEVTCHDYPTPVINEHSAHLSNIKISKTVDNSRQFTQDIP---------SPL-----PLN 577
           + V   +YP P   E S HLSN  + +      Q +   P         SPL     PL+
Sbjct: 542 ITVAVDEYPKPFFAEFSDHLSNASVLEASALDTQISSPHPQEVIVPSQDSPLVGGAPPLD 601

Query: 578 E-HMFMTDSNQSNGTIVSQQLITAXXXXXXXXXXXXRVLPNPITQSLEQNFNVSAKVASS 636
             H   T +  S    +   +               + +  PITQSL++ F  SA+VA+S
Sbjct: 602 AVHPAATPALSSQVLPLQPHMAMNSGIYMEPFGRRNKTMIKPITQSLQKQFATSAEVANS 661

Query: 637 MGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYA 696
           MG  IGNRT+YIGNI+PRS+ EDICNVVRGGILQ+I+++ +K ICFVTFIEA++AVQFY 
Sbjct: 662 MGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYT 721

Query: 697 NSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQY 756
           N+FIDPIVLHGNML+VGWGH+SGPLPKS+SLAVT+GASRNVYVSLP+FAFK+K+I+DPQY
Sbjct: 722 NAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQY 781

Query: 757 KQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTG 816
           ++  +   LP  EQLR DF+ +GDIEQIN+LSD HCCW+NFMNISSAI LVEE+      
Sbjct: 782 QRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKY---- 837

Query: 817 HDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIR 876
             + GE   K+     FD RY+GL+I YGKDRCGN+NKNL++GKNSRFYKKVK+PSYNIR
Sbjct: 838 --NDGEAFHKS-----FDNRYRGLIIGYGKDRCGNVNKNLISGKNSRFYKKVKKPSYNIR 890

Query: 877 LSKLEERRRQNE----NDKKESFDKVLNLESLGISLD 909
           LS++EE R+++E    +  + + +K+L   SLGI L+
Sbjct: 891 LSRMEEERKKHEETLRSQNQNNDEKMLQFGSLGIHLE 927

 Score =  200 bits (509), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 113/285 (39%), Positives = 174/285 (61%), Gaps = 25/285 (8%)

Query: 192 ETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSNALESAYIVGSK 251
           + + ++PF + Y++LP GDD YRTRSLL ENV+ S DL+S V  + +   +ES Y+   +
Sbjct: 208 DKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMFKDR 267

Query: 252 ETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLNLKFVCLNY--- 308
                  ++TK+ S+L+SFL+R  CL+ YN++LQRL+EFKT LKSKSL + FV L Y   
Sbjct: 268 ------NDKTKH-SVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRKH 320

Query: 309 --------DSKSLPTPV-EDEELSRSEEQAAT----DDA-STMISASLHHDVENKDATRS 354
                   +  S  TP+ E ++   S+   AT    DDA +  + ASL +D+ N+ ATRS
Sbjct: 321 VDENEVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIVNRGATRS 380

Query: 355 IIIEFKSPLEKAELFKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIF 414
           + +E     +K +L  ++L FL  + N+RY+LESI +++   P   FP+NY +LTFLNI 
Sbjct: 381 VALELDGEYDKTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHFPKNYAILTFLNIS 440

Query: 415 MAIEVLDYLK-KYSKKLGISKCFYVSLTPLMVSSARSSVASIYES 458
           MA+EVLDY++   + +    KCF+VS++    +S+   + +   S
Sbjct: 441 MAVEVLDYVRNNETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNS 485

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 4/68 (5%)

Query: 1048 SHNHSKKNQMPIQDAGINAEVTDNKTKKRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAA 1107
            S +H+  ++M         +    + K+R +    + IPGSDVMAQYLAQ+QHSTFMYAA
Sbjct: 1184 SSSHNSGDRMSSHVGNSRGQQGKGRNKRRNA----KAIPGSDVMAQYLAQLQHSTFMYAA 1239

Query: 1108 NILGASAE 1115
            NILGA+AE
Sbjct: 1240 NILGATAE 1247

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 48/69 (69%), Gaps = 5/69 (7%)

Query: 27  MVGNPMLYHPVDFMNGAGQYGPSQHPAYYT--NSPLPNVPPTPFDTAYGASLLPSHLLMG 84
           M  +PM + PV  +    QY P Q PAYY     PL N PPTPFDTAYG +LLPSHLL+G
Sbjct: 47  MANSPMAFPPVGSLQA--QYAPPQ-PAYYAAAGPPLMNPPPTPFDTAYGITLLPSHLLIG 103

Query: 85  SPFVSSPNM 93
           SPFVSSP++
Sbjct: 104 SPFVSSPDL 112

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score =  405 bits (1042), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 189/296 (63%), Positives = 238/296 (80%), Gaps = 15/296 (5%)

Query: 618 PITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAE 677
           PI ++LE  FN SA+VASSMG ++GNRTIYIGN+NPRS+AED+CNVVRGGILQ+IK IA 
Sbjct: 702 PIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIAS 761

Query: 678 KRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNV 737
           KRICFVTFIEA++AVQFYANSFIDP++LHGN L++GWG+Y  PL KSI+LAVTIGASRNV
Sbjct: 762 KRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNV 821

Query: 738 YVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINF 797
           YVSLPEFAFK+KF++DP+YK+ HE   LP  +QLR DF+ YG IEQINYLSDSHCCW+NF
Sbjct: 822 YVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNF 881

Query: 798 MNISSAISLVEEMNEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNLV 857
           MNI+SAI LVE++N  P  +  S          +KF+ RY GL+INYGKDRCGN+N+NL+
Sbjct: 882 MNITSAIKLVEDVNNNPKDNTFS----------KKFNHRYDGLIINYGKDRCGNVNRNLI 931

Query: 858 AGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKE-----SFDKVLNLESLGISL 908
           + KNSR Y+KVK+ S N +L +L+E+RR  +   KE     + +K+ +L++LGI L
Sbjct: 932 SNKNSRHYRKVKKFSDNYKLRQLQEKRRVEQEKGKELNGGVNDNKLPSLDALGIGL 987

 Score =  194 bits (494), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 125/303 (41%), Positives = 171/303 (56%), Gaps = 50/303 (16%)

Query: 188 EIDPETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSNALESAYI 247
           E+DP  L QKPF I+YK+LP GDDAYRTRSLL  NV  S DLHS + +FV+ +++ES Y+
Sbjct: 174 EVDPNELFQKPFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYL 233

Query: 248 VGS--KETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLNLKFVC 305
           + +   E D   + +    SIL+SFL+R  CL+FYNN+LQRL+EFKT L+SKSL L FV 
Sbjct: 234 ISNTDDEKDQDNENDKNKRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVI 293

Query: 306 LNYDSKS---LPTPVEDEELSRSEEQA------ATDDASTMISA-SLHHDVENKDATRSI 355
           LNY  K+       + + +L++ +E          D  ++M +  +L  D+ N DATR I
Sbjct: 294 LNYLEKTDDGSTANISNNQLNQIQENENDVNTNEFDYRNSMNTVNALKFDLINPDATRFI 353

Query: 356 IIEFKSPLEKAELFKEKLQFL-DRSKNKRYILESIDIV---------------------- 392
           +IE K+  +K  L  + L FL D  KN RYILESID+                       
Sbjct: 354 MIELKTKCDKETLLNKHLSFLIDNKKNIRYILESIDLFNIIENENSSENKSIIEAKNENE 413

Query: 393 --------DTDVPSNQ-------FPENYVVLTFLNIFMAIEVLDYLKKYSKKLGISKCFY 437
                   DT V   +       FP +Y VL+F+NI+MA+E+ DYLK    K GI+   Y
Sbjct: 414 NSPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLNGLKHGITNASY 473

Query: 438 VSL 440
           V +
Sbjct: 474 VQI 476

 Score = 87.4 bits (215), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 57/87 (65%), Gaps = 12/87 (13%)

Query: 6   SRKPSANHAYRKQHDHNGMNAMVGNPMLYHPVDFMNGAGQYGPSQHPAYYTNSPLPNVPP 65
           SRKPS          +  +N  V NP + +  D  NG+ QY  +   AYY  SPLPN PP
Sbjct: 37  SRKPS----------YISLNHSVHNPNMVYQHD-PNGS-QYFATTQQAYYIPSPLPNAPP 84

Query: 66  TPFDTAYGASLLPSHLLMGSPFVSSPN 92
           TPFDTAYGA+LLPSHLLMGSP+VS+PN
Sbjct: 85  TPFDTAYGATLLPSHLLMGSPYVSTPN 111

 Score = 78.2 bits (191), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 46/72 (63%)

Query: 1051 HSKKNQMPIQDAGINAEVTDNKTKKRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANIL 1110
            H +KN+   +   +   + D       +  + R IPG+DVMAQYL Q+QHSTFMYAANIL
Sbjct: 1123 HDRKNKDKNRRKQVQGGIQDQDPHLSSTGKQQRVIPGADVMAQYLTQLQHSTFMYAANIL 1182

Query: 1111 GASAEDNAYSDE 1122
            G SAEDN Y DE
Sbjct: 1183 GVSAEDNTYYDE 1194

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
           Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score =  398 bits (1022), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 202/381 (53%), Positives = 265/381 (69%), Gaps = 26/381 (6%)

Query: 539 YPTPVINEHSAHLSNIKISKTVDN--SRQFTQD-IPSPLPLNEHMFMTDSNQSNGTIVSQ 595
           Y  PV+ EH+ H S+I ISK + +  SR  +   I SP P    +  +++  S  +IVS 
Sbjct: 329 YGPPVVEEHNQHCSHITISKALSSKVSRNGSSSSIASPQPQEVLVSNSEAPSSRNSIVS- 387

Query: 596 QLITAXXXXXXXXXXXXRV---LPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNIN 652
            L++A                 +  P+ Q+L+Q +  +A+VA++MG   GNRT+YIGNI+
Sbjct: 388 -LLSARSQGPTYPVPGYHYYMDMSKPLGQTLQQQYTATAQVATAMGGGAGNRTVYIGNIS 446

Query: 653 PRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRV 712
           PRS+ EDICNVVRGGILQ++KYI  K ICFVTFIEAASAVQF+ANS I+PIVLHG++L+V
Sbjct: 447 PRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIEPIVLHGSLLKV 506

Query: 713 GWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLR 772
           GWGH+SG LP+SISLAVTIGASRNVYVSLPE+AFK+KFI DP+Y+   E   LP  +QL 
Sbjct: 507 GWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLY 566

Query: 773 EDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTATEEK 832
           +DFST+GDIE IN+L D HCCWINFMNIS+AI LVE+ N                +  EK
Sbjct: 567 DDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNN-----------ESFHEK 615

Query: 833 FDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRL-----SKLEERRRQN 887
           F+ RY+GL I YGKDRCGN+NKNLV+ KNS+++KKVK+ SYNIRL     S +E + +  
Sbjct: 616 FENRYRGLFIGYGKDRCGNVNKNLVSNKNSKYFKKVKKASYNIRLRRQQKSDIEAQAKSG 675

Query: 888 ENDKKESFDKVLNLESLGISL 908
           + D  E+ +K L +++ GIS+
Sbjct: 676 KGD--ENSEKKLQVDAFGISV 694

 Score =  141 bits (356), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 94/255 (36%), Positives = 137/255 (53%), Gaps = 42/255 (16%)

Query: 192 ETLLQKPFRINYKILPA---GD-DAYRTRSLLIENVDDSADLHSLVKNFVKSNALESAYI 247
           E   Q P+++ + ILP    GD D +RTRSL   N++    LH  +  F K + +ES Y+
Sbjct: 56  EGTRQIPYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYV 115

Query: 248 VGSKETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLNLKFVCLN 307
           V        ++E+    S+L+SFLT+  CL+FYN ILQ+LSEFK  L+SK L+L F    
Sbjct: 116 V--------DREQQ---SVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFAS-- 162

Query: 308 YDSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEFKSPLEKAE 367
                 P  VE                S      +  +V    ATRS+ +EFK  ++ A 
Sbjct: 163 ------PQKVE----------------SGPTLQEIKFEVLRAGATRSLGLEFKDEIDFAS 200

Query: 368 LFKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVLDYLK-KY 426
           L K K  F D S   RY++ESI+ V+TD PS  F  NY ++ F++I MA+E ++YLK + 
Sbjct: 201 LLK-KFDFFDNS-GPRYVIESIETVNTDKPSKYFGSNYAIVHFISIAMAVETMEYLKVQT 258

Query: 427 SKKLGISKCFYVSLT 441
            +  G++K  YV+ T
Sbjct: 259 PESFGLTKVSYVNST 273

 Score = 65.1 bits (157), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 61/118 (51%), Gaps = 25/118 (21%)

Query: 1016 AKVENEDGLVGLSQFNH------RSSLKQAPPRAPSTLSHNHSKKNQMPIQDA------- 1062
             K E   G+  L  F+       ++SL   PP AP+ L+ ++   N  P + A       
Sbjct: 790  GKKERSSGVSKLHCFSEIAPRVSKASLDAVPPLAPAALNCHY---NSAPRRSARKNGHDH 846

Query: 1063 ------GINAEVTDNKTKKRGSFPRHR---TIPGSDVMAQYLAQVQHSTFMYAANILG 1111
                  G  +++    T+ + S  R R    IPGS+VMAQYLAQ+QHSTFMYAA+ILG
Sbjct: 847  DSNPVSGSKSDIGSKSTQGKSSKSRQRNAQAIPGSNVMAQYLAQLQHSTFMYAADILG 904

>Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,
           1032 aa] {ON} (7832..9475,9855..9863,10320..11765) [3099
           nt, 1033 aa]
          Length = 1032

 Score =  400 bits (1029), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 190/325 (58%), Positives = 239/325 (73%), Gaps = 12/325 (3%)

Query: 585 SNQSNGTIVSQQLITAXXXXXXXXXXXXRVLPNPITQSLEQNFNVSAKVASSMGSDIGNR 644
           SNQ N    + +LI                + + + ++ +  F  SA++A++MG   GNR
Sbjct: 522 SNQLNSEFENTRLIHLIWMETINCNLRXXXMLHQLLRASKHQFATSAEIANTMGGGAGNR 581

Query: 645 TIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPIV 704
           T+YIGNINPRS+AEDICNVVRGG LQ IK+  EK ICFVTFIEAASA QFYANSFIDPI+
Sbjct: 582 TVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPII 641

Query: 705 LHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLA 764
           LH N LRVGWG +SGPLPKSISLAVT+GASRNVYVSLPE+AFK+KFI+DP+YK+ H    
Sbjct: 642 LHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYV 701

Query: 765 LPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGELI 824
           LP  E+LR+DFS +G++EQ+N+L+D HCCWINFMNI SAI LVE +N    G        
Sbjct: 702 LPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGG-------- 753

Query: 825 PKTATEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERR 884
                 E++  RYKGL+I YGKDRCGN+NK+L++GKNS+FY+KVK+PSYNIRL +LEE R
Sbjct: 754 --KTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNIRLQQLEEER 811

Query: 885 RQNENDKKESFDKVLNLESLGISLD 909
           +Q E +K    +K +NL S GI ++
Sbjct: 812 KQEEKNKIS--NKSINLNSFGIQVE 834

 Score =  189 bits (479), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 109/262 (41%), Positives = 147/262 (56%), Gaps = 33/262 (12%)

Query: 199 FRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSNALESAYIVGSK------- 251
           F I+YK+LP G+D Y+TRSLL ENVD S DLH  +K FV    +ES Y++ S        
Sbjct: 251 FTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYDNNK 310

Query: 252 ------------ETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSL 299
                         ++         SIL+SFL+R  CL+FYN++LQRLSEFKT L S  L
Sbjct: 311 NNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDL 370

Query: 300 NLKFVCLNYDSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEF 359
            L FV L Y ++  P   +DEE           D S  +  SL +D+  + ATRSI +EF
Sbjct: 371 TLSFVLLKYKNQDRP---DDEE----------SDFSPALPLSLEYDIIKRGATRSIAVEF 417

Query: 360 KSPLEKAELF-KEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIE 418
             P+   E F   KL FL   +NKRYI+ES+DI++        P+N V+LTFLNI M ++
Sbjct: 418 NQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVD 477

Query: 419 VLDYLKKYSKKLGISKCFYVSL 440
           V+D ++   K  GISKC +V+ 
Sbjct: 478 VMDRIRLERKDSGISKCVFVTF 499

 Score = 79.7 bits (195), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 4/60 (6%)

Query: 53  AYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYNLGRSSKFNRKAYSR 112
            YYTN  +PN PPTPFD+AYGASLLPSHLLMGSPFVS+P M   Y    S +F R + S+
Sbjct: 111 VYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSY----SQQFARPSPSK 166

 Score = 77.0 bits (188), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 64/106 (60%), Gaps = 19/106 (17%)

Query: 1033 RSSLKQAPPRAPSTLSHNHSK----------------KNQMPIQDAGINAEVTDNKTKKR 1076
            ++ L+ +PP AP+TLS +  K                +N M   D+  +++   N + KR
Sbjct: 922  KTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMDQNDMSENDSNTSSK---NASHKR 978

Query: 1077 GSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSDE 1122
             S    + +PGSDVM+QYLAQ+QHSTFMYAANILGAS+++  + DE
Sbjct: 979  SSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPEFYDE 1024

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score =  403 bits (1036), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 188/303 (62%), Positives = 238/303 (78%), Gaps = 21/303 (6%)

Query: 617  NPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIA 676
            N +TQ+LE +FN S ++++ +G   GNRT+YIGNINPRS+ ED+CNVVRGGILQ I ++ 
Sbjct: 799  NNLTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLR 858

Query: 677  EKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRN 736
            +K ICFVTFIEA +A QF+AN++IDPIVLHGN+L+VGWG++SGPLPKSISLAVTIGA+RN
Sbjct: 859  DKHICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRN 918

Query: 737  VYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWIN 796
            VYVSLPEFAFK+KFI++P Y++ HE   LP+  QLR+DFS YG+IEQINYL+D HCCWIN
Sbjct: 919  VYVSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWIN 978

Query: 797  FMNISSAISLVEEMNEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNL 856
            FMNI+SAI+LVEE+NE     DD            KFDGRY GL+I YGKDRCGN+NKNL
Sbjct: 979  FMNINSAITLVEEVNE-----DDGIRF------HNKFDGRYNGLIIGYGKDRCGNVNKNL 1027

Query: 857  VAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKESFDKV----------LNLESLGI 906
            VA KNS+F+KKVK+P+Y I+L K+EE RR  E +   + +K+          +NLESLGI
Sbjct: 1028 VATKNSKFFKKVKKPAYQIKLKKIEEERRLQEENNLRNNNKLSNNSQIRKPAVNLESLGI 1087

Query: 907  SLD 909
            + +
Sbjct: 1088 TFE 1090

 Score =  163 bits (413), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 110/313 (35%), Positives = 157/313 (50%), Gaps = 71/313 (22%)

Query: 189 IDPETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSNALESAYIV 248
           ID   LL+ P  ++YKILP G D +RTRSLL+EN++ S D  +LVKNF+    +ES Y++
Sbjct: 251 IDINKLLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLI 310

Query: 249 ----GSKETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLNLKFV 304
               GSK             SIL+SF++R  CL+FYNN+LQRL EFKT L SKSL L FV
Sbjct: 311 KLNPGSKYN-----------SILLSFVSREICLDFYNNVLQRLMEFKTELSSKSLTLSFV 359

Query: 305 CLNYDSKSLPTPVEDEELSRSEEQAAT--------------------------------- 331
            L Y+      P+ +      +E +++                                 
Sbjct: 360 ILKYEFTDYNHPINEHASDNGDESSSSNKNLKIDTIKEEEEDEEETDGEEIVIEDIRNDL 419

Query: 332 --DDASTMISASLHHDVENKDATRSIIIEFKSPLEKAELFKEK-LQFLDRSKNKRYILES 388
             ++     +++L  D+  + ATRS++++F   + K +L  EK   F++ + N RYILES
Sbjct: 420 NKENFPLTFASALQSDLVKRGATRSLLLKFNGVVSKDQLINEKLNLFINNNLNNRYILES 479

Query: 389 IDIVDT--------------------DVPSNQFPENYVVLTFLNIFMAIEVLDYLKKYSK 428
           I +V+                     D P ++F  NY +LTF NI MAIE  DY K    
Sbjct: 480 ISLVNIENNTKNNKNTIGDDNEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLN 539

Query: 429 KLGISKCFYVSLT 441
           +L I  CF+VS T
Sbjct: 540 ELNIFDCFFVSKT 552

 Score = 80.9 bits (198), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/118 (44%), Positives = 62/118 (52%), Gaps = 26/118 (22%)

Query: 1029 QFNHRSSLKQAPPRAPSTLSHNHSKKNQMPIQD--------------AGINAEVTDNKTK 1074
            Q N    L Q PP A STL+  + K    P  D              + +  EV D K  
Sbjct: 1242 QSNQVPVLNQYPPMASSTLTRTYRKTKLKPKNDNPKFITSDTEDEILSQLPDEVLDEKNP 1301

Query: 1075 KRGSFPRHR--------TIPGSDVMAQYLAQVQHSTFMYAANILGASAEDN--AYSDE 1122
             RG  PR++        TIPGSDVM+QYL Q+QHSTFMYAANILG SAEDN   Y D+
Sbjct: 1302 FRG--PRNKNKNRNTRKTIPGSDVMSQYLTQLQHSTFMYAANILGVSAEDNNITYGDD 1357

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 4/64 (6%)

Query: 51  HPAYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQG-GYNLGR-SSKFNRK 108
           +P YY  SP+P+ PPTPFD +YGA+LLPSHLLMGSPFVS+PN+    Y+    SS   RK
Sbjct: 94  NPTYY--SPIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNIHSFPYSATSISSTPTRK 151

Query: 109 AYSR 112
           ++SR
Sbjct: 152 SFSR 155

>NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844
          Length = 1081

 Score =  382 bits (982), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 180/298 (60%), Positives = 232/298 (77%), Gaps = 17/298 (5%)

Query: 618 PITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAE 677
           PI+++LEQ+   +++V +S+G+D GNRTIYIGNIN RS+ EDICNVVRGGILQN+KYI  
Sbjct: 595 PISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEH 654

Query: 678 KRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNV 737
           K ICF+TFIEA++A+ FYANSFIDPIVLH + L++GWG+Y  PLPK+++LAVT+GASRNV
Sbjct: 655 KHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNV 714

Query: 738 YVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINF 797
           YVSLPEFAFK+KFI+DP+Y++ H+   LP A+QLR DFS YG IEQINYL DSHCCW+NF
Sbjct: 715 YVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNF 774

Query: 798 MNISSAISLVEEMNEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNLV 857
           +NIS+AI LVE+       H+       ++   EKF+ RY GL+INYGKDRCGN+NK+L+
Sbjct: 775 LNISAAIRLVED------AHNPV-----ESKFSEKFNNRYDGLIINYGKDRCGNVNKSLM 823

Query: 858 AGKNSRFYKKVKRPSYNIRLSKLEERR-----RQNENDKKESFDKVLN-LESLGISLD 909
           + KNSRFYKKVK  S N++L +LEE+R     R N   K  S D  L+ L++ GI +D
Sbjct: 824 SNKNSRFYKKVKSISNNVKLKELEEKRKADTERLNSLRKTSSSDGQLSKLDAFGIGID 881

 Score =  250 bits (638), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 128/268 (47%), Positives = 180/268 (67%), Gaps = 12/268 (4%)

Query: 188 EIDPETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSNALESAYI 247
           E DP+TL  +PFR++YKILP+GDDAYRTRSLL ENV +S +LH+ +  FV+ + +ES Y+
Sbjct: 166 ETDPKTLFLQPFRMSYKILPSGDDAYRTRSLLFENVVNSIELHTFMTEFVRFSPIESVYL 225

Query: 248 VGSKETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLNLKFVCLN 307
           +   ++D  + ++T+  SIL+SFLTR  CL FYNN+LQRL EFK  LKS++L L FV + 
Sbjct: 226 INHHDSDKPD-DDTECRSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSIK 284

Query: 308 YDSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEFKSPLEKAE 367
           Y         E+EE    EE    D+ S     S++ ++ N  ATRSI+I+FK+P  + E
Sbjct: 285 YQD-------ENEE----EETNIVDEPSFYTKESVYFELSNPQATRSILIQFKNPCSEQE 333

Query: 368 LFKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVLDYLKKYS 427
           LF +KL+FL++  N RYILESID+V+     N+FP++Y +LTF+NI MA+E+ DYLK + 
Sbjct: 334 LFDKKLKFLNQENNSRYILESIDLVNVTQTENEFPKHYAILTFINILMAMEICDYLKIHG 393

Query: 428 KKLGISKCFYVSLTPLMVSSARSSVASI 455
            + GI  C +V + P  VS   S  ASI
Sbjct: 394 PRYGIQDCMFVQVIPKAVSCVSSKRASI 421

 Score = 87.0 bits (214), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 3/62 (4%)

Query: 30  NPMLYHPVDFMNGAGQYGPSQHPAYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVS 89
           N ML++  +      QY P+Q P YY  SPLPNVPPTPFDTAYGA+LLPSHLLMGSPFV+
Sbjct: 48  NSMLFYQGE--QARSQYFPTQQP-YYQTSPLPNVPPTPFDTAYGATLLPSHLLMGSPFVA 104

Query: 90  SP 91
           +P
Sbjct: 105 TP 106

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/40 (87%), Positives = 37/40 (92%)

Query: 1083 RTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSDE 1122
            R IPGSDVMAQYLAQ+QHSTFMYAANILGASAED +Y DE
Sbjct: 1039 RVIPGSDVMAQYLAQLQHSTFMYAANILGASAEDGSYYDE 1078

>ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML117W
          Length = 1043

 Score =  354 bits (909), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/392 (48%), Positives = 245/392 (62%), Gaps = 61/392 (15%)

Query: 533 EVTCHDYPTPVINEHSAHLSNIKIS---KTVDNSRQFTQ-DIPSPLPLNEH--------- 579
           +V   +YPTP+I +HS HL++I IS   KT+  S    + D  +    N H         
Sbjct: 408 QVVPSEYPTPLIEQHSEHLTSITISRPSKTLGPSASLIEMDSNATNAGNHHGVSSSLSGV 467

Query: 580 MFMTDSNQSNGT--IVSQQLITAXXXXXXXXXXXXRVLPNP------------------- 618
           +FM D + S  T  IV  +L               +++P P                   
Sbjct: 468 LFMNDPSSSGSTPMIVPSEL--NLNTPVMGGPMQGQLMPGPPQPMSLHNPSDGNGGSPSY 525

Query: 619 ---------ITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGIL 669
                    I Q+L++ +   A    S  + I NRT+YIGNI+PRS+ EDICNVVRGGIL
Sbjct: 526 FMDPMVGAPIGQTLQRQYLAGA----SQANGINNRTVYIGNIHPRSKPEDICNVVRGGIL 581

Query: 670 QNIKYIAEKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAV 729
           Q IK+I+ KRICFVTFIE A+AVQFYAN+ ++PIVLHGN+LRVGWG  SG LPK+I+LAV
Sbjct: 582 QTIKWISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAV 641

Query: 730 TIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSD 789
           TIGASRNVYVSLPE++FKEK+I++P++K  H    LP  EQLR+DF+ YG +EQINYL D
Sbjct: 642 TIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLED 701

Query: 790 SHCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTATE--EKFDGRYKGLLINYGKD 847
            HCCW+NFMNI+ AI LVE          DS   I K   +   +FDGRYK L+I YGKD
Sbjct: 702 GHCCWVNFMNIAHAIRLVE----------DSNSPIEKNLEKFHAQFDGRYKNLIIGYGKD 751

Query: 848 RCGNINKNLVAGKNSRFYKKVKRPSYNIRLSK 879
           RCGN+NKNL A KNSRFYKK+K+ SY+++  K
Sbjct: 752 RCGNVNKNLAANKNSRFYKKIKKQSYSMKQGK 783

 Score =  140 bits (354), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 86/248 (34%), Positives = 138/248 (55%), Gaps = 43/248 (17%)

Query: 197 KPFRINYKILPAGDDAYRTRSLLIENVD--DSADLHSLVKNFVKSNALESAYIVGSKETD 254
           +P+ IN+KILP G D Y TRSLL+ N++     D+H+ + +FVK   +ES Y++      
Sbjct: 142 EPYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLM------ 195

Query: 255 NLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLNLKFVCLNYDSKSLP 314
                   N SIL+SFLT+  CL+FYNN+LQR SEFKT L S  L++ FVC         
Sbjct: 196 ------DDNHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFVC--------- 240

Query: 315 TPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEFKSPLEKAELFKEKLQ 374
                            D++S      L  +V  + ATRS+ +EF+  +++      +L+
Sbjct: 241 ----------------QDESSWF--KYLQMNVVTRGATRSLTVEFEDSVKELNEDFVRLK 282

Query: 375 FLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVLDYLKKYSKK--LGI 432
           F     ++R++LE ID+++    +  F   Y++L F++I MA+EV D+L++ S+K  L I
Sbjct: 283 FPWLFCSQRFVLERIDLINATTVNQHFGTRYMILHFISISMALEVDDFLQQPSQKRQLNI 342

Query: 433 SKCFYVSL 440
           S+  +V++
Sbjct: 343 SRIQFVNV 350

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (87%)

Query: 60 LPNVPPTPFDTAYGASLLPSHLLMGSPFVSSP 91
          +P VP TPFD  YGASLLPSH+LMGSPF+S+P
Sbjct: 56 MPPVPQTPFDPTYGASLLPSHMLMGSPFLSTP 87

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 54/113 (47%), Gaps = 10/113 (8%)

Query: 1011 NSKRPAKVENEDGLVGLSQFNHRSSLKQAPPRAPSTLSHN-------HSKKNQMPIQDAG 1063
            N+   A    +  L  L   +   SL   PP APS++  +       H+         + 
Sbjct: 913  NAASSASYNQQYSLGSLDHTSSAGSLDAPPPLAPSSMQQHLADRRPRHTPGRSTDSSASQ 972

Query: 1064 INAEVTDN---KTKKRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGAS 1113
             N++   N   K+++R      + I G DVM+QYL Q+ HSTF+YA NILGA+
Sbjct: 973  YNSQTPTNANYKSRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYATNILGAT 1025

>Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {ON}
           similar to Ashbya gossypii ABL122C
          Length = 1067

 Score =  342 bits (878), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 185/399 (46%), Positives = 247/399 (61%), Gaps = 64/399 (16%)

Query: 532 LEVTCHDYPTPVINEHSAHLSNIKIS---KTVDNSRQFTQ-------------------- 568
           L+V   +YP P+I  H  HL ++ IS   KT+ +S    +                    
Sbjct: 423 LQVIPSEYPVPLIESHDDHLHSVTISRPSKTLTSSTSLVEMDGGPNGGTPNGSNAMQGVL 482

Query: 569 ---------DIPSPLPLNEHMFMTDSNQSNGTIVSQQLITAXXXXXXXXXXXXRVLPN-- 617
                    + PS LP NE     +++   G +  Q L T+               P+  
Sbjct: 483 LLSDPSSDGNTPSMLP-NE--LNINTSLMPGPMGGQVLGTSQSLSLHNPNDNGGAGPSYF 539

Query: 618 -------PITQSLEQNF-NVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGIL 669
                  PI Q+L++ +   + +V  S      NRT+YIGNI+PRS+ EDICNVVRGGIL
Sbjct: 540 MDPMSGAPINQALQRQYLTGTGQVGGS-----NNRTVYIGNIHPRSKPEDICNVVRGGIL 594

Query: 670 QNIKYIAEKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAV 729
           QNIK+I  KRICFVTFIEAA+A+QFYAN+ ++PIVLHGN+LRVGWG  SG LPK+I+LAV
Sbjct: 595 QNIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAV 654

Query: 730 TIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSD 789
           TIGASRNVYVSLPE++FKEK+I++P++K+ H    LP  EQLR+DF+ YG +EQINYL D
Sbjct: 655 TIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDD 714

Query: 790 SHCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTATEE---KFDGRYKGLLINYGK 846
            HCCW+NFMNI+ AI LVE+ N            + +   E+   +FDGRYK L+I YGK
Sbjct: 715 GHCCWVNFMNIAHAIRLVEDCNS-----------LSQRNLEKFHAQFDGRYKNLIIGYGK 763

Query: 847 DRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRR 885
           DRCGN+NKNL A KNSRF+KK+K+ +   + +K ++ +R
Sbjct: 764 DRCGNVNKNLTANKNSRFFKKIKKLNCTTKPNKRQQSKR 802

 Score =  142 bits (357), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 92/251 (36%), Positives = 141/251 (56%), Gaps = 48/251 (19%)

Query: 197 KPFRINYKILPAGDDAYRTRSLLIENVD--DSADLHSLVKNFVKSNALESAYIVGSKETD 254
           +P+++N+KILP G D Y TRSLL  N++  ++ D+H+ + NF+K   +ES Y++      
Sbjct: 157 EPYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLLDDSH-- 214

Query: 255 NLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLNLKFVCLNYDSKSLP 314
                     SIL+SFLT+  CL+FYNN+LQR SEFK+ L S  L++ FVC         
Sbjct: 215 ----------SILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVC--------- 255

Query: 315 TPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEF--KSPLEKAELFKEK 372
              +DE               T     L  +V  +  TRS+ IEF  +S    ++L  EK
Sbjct: 256 ---QDE---------------TNWFRLLQMNVVTRGVTRSLCIEFEDQSMELTSDLIHEK 297

Query: 373 LQFLDRSKNKRYILESIDIVDTDVPSNQ-FPENYVVLTFLNIFMAIEVLDYLKKYS--KK 429
           + +L  S   R+++E ID+V+   P NQ F   Y+++ F+ I MA+EV +YL++ S  K+
Sbjct: 298 IPWLFFS--HRFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQ 355

Query: 430 LGISKCFYVSL 440
           LGISK  +V++
Sbjct: 356 LGISKIQFVNV 366

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 35/48 (72%), Gaps = 1/48 (2%)

Query: 60  LPNVPPTPFDTAYGASLLPSHLLMGSPFVSSP-NMQGGYNLGRSSKFN 106
           +P VP TPFD  YGASLLPSH+LMGSPFVS+P   QG ++   SS  N
Sbjct: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTPMRPQGHFHPSASSHSN 126

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%)

Query: 1083 RTIPGSDVMAQYLAQVQHSTFMYAANILGASA 1114
            + I G DVM+QYL Q+ HSTF+Y+ NILGA+ 
Sbjct: 1021 KPIAGQDVMSQYLEQLHHSTFLYSTNILGATT 1052

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1151

 Score =  323 bits (829), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 169/349 (48%), Positives = 226/349 (64%), Gaps = 42/349 (12%)

Query: 526 DLDGTILEVTCHDYPTPVINEHSAHLSNIKISK-----------TVDNSRQFTQDIPSPL 574
           +L  + L V   +Y  P++NE   HL++  ISK           T  +S   + DI  PL
Sbjct: 537 NLTWSTLIVDVSEYKEPIVNEFDHHLNSWSISKPTTLYMHESGTTNFSSSNLSDDI-DPL 595

Query: 575 PLNEHMFMTDSNQSNGTIVSQQLITAXXXXXXXXXXXXRVLPNPITQSLEQNFNVSAKVA 634
            ++ H             V QQ++               ++P  ITQ+++  +   +K  
Sbjct: 596 SISSH-----------DPVPQQMLL-----NEYPYIMEPLMPPQITQTIQNQY---SKSI 636

Query: 635 SSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQF 694
            ++ + + +RT+YIGNINPRS+AEDICNVVRGGILQ+IK+++ KRICFVTFIE A+AVQF
Sbjct: 637 QAVNAGMEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQF 696

Query: 695 YANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDP 754
           YAN+ ++PI+LHGN+L+VGWG   GPLPK+I+LAVT+GASRNVYVSLP+ AFK+KFI+DP
Sbjct: 697 YANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDP 756

Query: 755 QYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEP 814
           Q+K+      +P+  QL+ DF  YG +EQ+N+ SD HCCWINFMNISSAI LVEE +   
Sbjct: 757 QFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYS--- 813

Query: 815 TGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSR 863
              D    L  K     K +GRY GL+I YGKDRCGNIN+NLV  KN +
Sbjct: 814 ---DTKDNLFHK-----KTEGRYVGLIIGYGKDRCGNINRNLVFNKNGK 854

 Score =  117 bits (293), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 127/476 (26%), Positives = 192/476 (40%), Gaps = 118/476 (24%)

Query: 28  VGNPMLYHPVDFMNGAGQYGPSQHPAYYTN--SPLP-----------NVPPTPFDTAYGA 74
           VG     + V   NG   + P Q+  YYT+    +P           ++P TPFD  YG 
Sbjct: 21  VGYEQQVYDVAGRNGGSNHHPPQY-IYYTHRGGSMPGSIPGSIPGTVSIPQTPFDPVYGI 79

Query: 75  SLLPSHLLMGSPFVSSPNMQGGYNLGRSSKFNRKAYSRPIXXXXXXXXXXXXXXXXXXXX 134
           +LLPSHLL+GSPFV++P   G  + G        A   P+                    
Sbjct: 80  TLLPSHLLVGSPFVNTPQTGGPMSAGTG------ANGVPVGSNNIMNLRNSSYKSFYPPA 133

Query: 135 XGMM-TPSSYYRNGRTLFSR--------KDNNAVNVTHNIHKGYEXXXXXXXXXXXXXXX 185
             +   PS   R  R   ++        +DNN V   +++ +GY                
Sbjct: 134 PKLRPAPSGRLRRARRKDNKPQQQREHSRDNNKVEAEYDVERGYSSRSASRSQSFSASTS 193

Query: 186 FDE------------IDPETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLV 233
                          ID E  +Q      Y ILP G+D YR+RSLL  NV+   D+   +
Sbjct: 194 GSMSGSSGPKSIRKTIDSELKIQ----FQYSILPKGNDTYRSRSLLFTNVNSELDIVEFL 249

Query: 234 KNFVKSNALESAYIV-------------------------------GSKETDNLEKEE-- 260
           +   K+  +ES Y++                                SK  D+ +KE   
Sbjct: 250 QKVAKNYPIESIYLIKDEDTGDDIENLNTSNNDDDPNQNYNADNNNNSKREDDKDKESAP 309

Query: 261 --TKNLSI----------LISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLNLKFVCLNY 308
             TK ++I          L+SF T+  CL+FYNN+LQR +E K  +KS  L + FV +  
Sbjct: 310 ALTKQIAISPSSCSQQSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQ- 368

Query: 309 DSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEFKSPLEKAEL 368
                    +DEE                  A+L  +V +  ATRS+ +EF      ++ 
Sbjct: 369 ---------DDEEW----------------MANLKMNVISLGATRSLYVEFADDSVTSDT 403

Query: 369 FKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVLDYLK 424
             + L FL  S   +Y++  +D+V TD     F  +Y +L FL++ MA+EV + L+
Sbjct: 404 IWDTLPFLKNS--GKYVVIDVDVVTTDERRKNFGLHYCLLHFLSVTMALEVKELLE 457

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 31/40 (77%), Gaps = 1/40 (2%)

Query: 1083 RTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSDE 1122
            + I GSDVM +YL Q+ H+TF+YAANILGA+ +D  + DE
Sbjct: 1110 KPIAGSDVMTRYLEQLHHNTFVYAANILGAT-QDPVFYDE 1148

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score =  178 bits (452), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 88/218 (40%), Positives = 133/218 (61%), Gaps = 32/218 (14%)

Query: 640 DIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSF 699
           ++GNRTIY+GN+    + E+ICN VRGG+LQ+IK ++++ +CFVTFI+  +A QFYA S 
Sbjct: 338 NLGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLSDRHVCFVTFIDPTAAAQFYAMSS 397

Query: 700 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQL 759
           +  + +H    ++GWG +SGPLP  ++LAV+ GASRN+Y+   +FA  +K  H P + + 
Sbjct: 398 LHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFAADKKSQH-PIFTE- 455

Query: 760 HETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDD 819
                      LR  F  +G++EQIN+L + +CC+INF NISSAI  ++++   PT    
Sbjct: 456 ---------AALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSIPT---- 502

Query: 820 SGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNLV 857
                            +K L IN+GKDRCGN+ +   
Sbjct: 503 -----------------FKDLKINFGKDRCGNVPRQFC 523

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 105/213 (49%), Gaps = 29/213 (13%)

Query: 644 RTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPI 703
           RT+Y+GN+ P    +++ + VR G+++ +K + EK   F++F+E  SA+ F++++ +  +
Sbjct: 103 RTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEKMCAFISFVEENSALLFHSDAILKRL 162

Query: 704 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSL--PEFAFKEKFIHDPQYKQLHE 761
            +    +++GWG  +   P   +     GA+RNVY+           ++  DP  + + E
Sbjct: 163 NIDDRDIKIGWGKPTQIDPIVAAGITNDGATRNVYIGKLNTNKDICAQWGVDPNEEVITE 222

Query: 762 TLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSG 821
                  E+LR D S +G++E +  + +    +++F +I +AI +V  +           
Sbjct: 223 -------EKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVVANL----------A 265

Query: 822 ELIPKTATEEKFDGRYKGLLINYGKDRCGNINK 854
            + P  A ++ F          YGKDRC  I K
Sbjct: 266 NINPYYAQKKIF----------YGKDRCAFITK 288

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa]
           {ON} Anc_6.183 YPL184C
          Length = 710

 Score =  180 bits (457), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 89/214 (41%), Positives = 129/214 (60%), Gaps = 31/214 (14%)

Query: 639 SDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANS 698
           +++GNRT+Y+GN+    + ++ICN VRGG+LQ+IK + ++ +CFVTFI+  +A QFYA S
Sbjct: 523 NNLGNRTVYLGNLPVDVKIDEICNAVRGGLLQHIKLLTDRHVCFVTFIDPTAAAQFYAMS 582

Query: 699 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 758
            +  + +     +VGWG +SGPLP  I+LAV+ GASRNVY+   +F    K  + P + +
Sbjct: 583 SLHGLSIQKKRCKVGWGKHSGPLPNLIALAVSNGASRNVYLGNIDFENDIKLHNPPIFTE 642

Query: 759 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHD 818
           L           LR  F  YGD+EQIN+L + +CC+INF NIS+AI  +E++   P    
Sbjct: 643 L----------SLRNIFQQYGDVEQINFLPEKNCCFINFTNISNAILAIEKIKNNPD--- 689

Query: 819 DSGELIPKTATEEKFDGRYKGLLINYGKDRCGNI 852
                             +K L IN+GKDRCGNI
Sbjct: 690 ------------------FKDLKINFGKDRCGNI 705

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 107/226 (47%), Gaps = 35/226 (15%)

Query: 644 RTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPI 703
           RT+Y+GNI      +D+ + VR G+++NIK + +K   F++F++ +SA+ F++++ +  +
Sbjct: 268 RTVYLGNIPSDLSVKDLLDHVRSGVVENIKILPDKMCAFISFVDESSALLFHSDAILKRL 327

Query: 704 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVS-----------LPEFAFKEKFIH 752
            + G  +++GWG  +   P   +  VT GA+RNVY+                +       
Sbjct: 328 NIGGRDIKIGWGKPTPIDPIVATSIVTDGATRNVYIGQLSNSSNNNTSSSSSSTSPSSPS 387

Query: 753 DPQYKQLHETLALPDA----EQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVE 808
           +     L +   + D+    E+LRED   YG+I+ +  + D    +++  +I SAI +V 
Sbjct: 388 NNTSDDLEKKKNIDDSPLTEEKLREDLKDYGEIDCVKIVQDKGFAFVHMSSILSAIKVVN 447

Query: 809 EMNEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINK 854
            + +                     +  Y+   I YGKDRC  I K
Sbjct: 448 NLAQT--------------------NPYYQNKRIFYGKDRCAFITK 473

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score =  177 bits (448), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 90/218 (41%), Positives = 129/218 (59%), Gaps = 40/218 (18%)

Query: 639 SDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANS 698
           +++GNRT+Y+GN+    R EDICN +R G+LQNIK ++++ +CFVTFI+  SA QFYA S
Sbjct: 410 NNLGNRTVYLGNLPNDIRIEDICNTIRCGLLQNIKLLSDRHVCFVTFIDPVSAAQFYAMS 469

Query: 699 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAF----KEKFIHDP 754
            I   VL     +VGWG +SGPL   ++LAV+ GASRNVY+   +F      +E++  D 
Sbjct: 470 SIYGFVLQKKRCKVGWGKHSGPLSNPLTLAVSNGASRNVYIGNIDFTADGTKRERYFTD- 528

Query: 755 QYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEP 814
                           LR  FS YG++EQIN+L   +CC++N+ NI++AIS ++++   P
Sbjct: 529 --------------SNLRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAIDKIKNNP 574

Query: 815 TGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNI 852
           T                     +K L IN+GKDRCGNI
Sbjct: 575 T---------------------FKNLKINFGKDRCGNI 591

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 107/215 (49%), Gaps = 26/215 (12%)

Query: 644 RTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPI 703
           RT+Y+GNI P   A D+ + VR G+++ +K + EK   F++F++  S++ F++++ +  +
Sbjct: 168 RTVYLGNIPPTLTASDLLDHVRSGVIEEVKILPEKMCAFISFLDENSSLLFHSDAILKRL 227

Query: 704 VLHGNMLRVGWGHYSGPLPKSISLAV-TIGASRNVYVSLPEFA--FKEKFIHDPQYKQLH 760
            + G  +++GWG  S PL   I+ +V T GA+RN+++         K+K      Y    
Sbjct: 228 NIDGKDIKIGWGKPS-PLSPIIATSVATDGATRNIFIGQLNTTDHNKQKDNDATIYHGSD 286

Query: 761 ETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEM-NEEPTGHDD 819
           +   +   E+LR+D   YGDI+ I    +    +++F +I SAI +V  + N  P     
Sbjct: 287 DFEDIMTEEKLRKDLEEYGDIDCIKIFKEKGFAFVHFTSILSAIKVVNNLSNSNP----- 341

Query: 820 SGELIPKTATEEKFDGRYKGLLINYGKDRCGNINK 854
                            Y    I YGKDRC  I K
Sbjct: 342 ----------------YYSKKKIYYGKDRCAFITK 360

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score =  175 bits (444), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 130/218 (59%), Gaps = 32/218 (14%)

Query: 640 DIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSF 699
           ++GNRTIY+GN+    + E+ICN VRGG+LQ+IK + ++ +CFVTFI+  +A QFYA S 
Sbjct: 391 NLGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLNDRHVCFVTFIDPTAAAQFYAMSS 450

Query: 700 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQL 759
           +  + +H    ++GWG +SGPLP  ++LAV+ GASRN+Y+   +F    K +  P + + 
Sbjct: 451 LHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFEDDRK-LEQPIFTE- 508

Query: 760 HETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDD 819
                      LR  F  +G++EQIN+L + +CC+INF NISSAI  ++++   PT    
Sbjct: 509 ---------TSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSIPT---- 555

Query: 820 SGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNLV 857
                            +K L IN+GKDRCGN+ +   
Sbjct: 556 -----------------FKDLKINFGKDRCGNVPRQFC 576

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 108/215 (50%), Gaps = 33/215 (15%)

Query: 644 RTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPI 703
           RT+Y+GN+ P     ++ + VR G+++++K + EK   F++F++  SA+ F++++ +  +
Sbjct: 156 RTVYLGNVPPYITTRELLDHVRSGVVEDVKILPEKMCAFISFVDENSALLFHSDAILKRL 215

Query: 704 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSL----PEFAFKEKFIHDPQYKQL 759
            +    +++GWG  +   P   +     GA+RNVY+      P+     ++  DP  + +
Sbjct: 216 NIDDRDIKIGWGKPTQIDPIVAAGINNDGATRNVYLGKLNTNPKMC--AQWGADPNEETI 273

Query: 760 HETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDD 819
            E       E+LR D + +G++E +  +++    +++F +I SAI +V  +         
Sbjct: 274 TE-------EKLRNDLADFGEVESVKIVTEKGIAFVHFSSIFSAIKVVANL--------- 317

Query: 820 SGELIPKTATEEKFDGRYKGLLINYGKDRCGNINK 854
              + P  A ++ F          YGKDRC  I K
Sbjct: 318 -ANVNPYYAQKKIF----------YGKDRCAFITK 341

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score =  176 bits (446), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 133/213 (62%), Gaps = 32/213 (15%)

Query: 640 DIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSF 699
           ++GNRT+Y+GN+    + E+ICNVVRGG+LQ++K ++++ +CFVTFI+  +A QFYA S 
Sbjct: 444 NLGNRTVYLGNLPKDIKIEEICNVVRGGLLQSVKLLSDRYVCFVTFIDPTAAAQFYAMSS 503

Query: 700 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQL 759
           +  + +     +VGWG +SGPLP +++LAV+ GASRNVY+      F++  + DP+    
Sbjct: 504 LHGLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYIG--NINFEKDAMRDPR---- 557

Query: 760 HETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDD 819
                +   + LR+ F  YG++EQIN+L + +CC+INF NIS+AI  ++++   P     
Sbjct: 558 -----IFTEDSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAILALDKIKSNP----- 607

Query: 820 SGELIPKTATEEKFDGRYKGLLINYGKDRCGNI 852
                            ++ L IN+GKDRCGN+
Sbjct: 608 ----------------HFEDLKINFGKDRCGNV 624

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 104/212 (49%), Gaps = 33/212 (15%)

Query: 644 RTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPI 703
           RT+Y+GNI      +++ + VR G+++++K I EK   F++F++ +SA+ F++++ +  +
Sbjct: 214 RTVYLGNIPSNLTVKELLDHVRSGVVEDVKIIPEKLCAFISFVDESSALLFHSDAILKRL 273

Query: 704 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETL 763
            + G  +++GWG  +   P   +  +   A+RNV++         K  +D   K+     
Sbjct: 274 NIGGKDIKIGWGKPTTVDPMISARIINDDATRNVFI-----GHLNKTDNDSCTKE----- 323

Query: 764 ALPDAE-QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGE 822
             P  E +LRED   +G+IE +  + +    +++F +I+SAI  V  +            
Sbjct: 324 --PITEAKLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNL------------ 369

Query: 823 LIPKTATEEKFDGRYKGLLINYGKDRCGNINK 854
                      +  Y+   I YGKDRC  I K
Sbjct: 370 --------RSMNPYYENKKIAYGKDRCAFITK 393

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score =  176 bits (447), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 87/214 (40%), Positives = 134/214 (62%), Gaps = 32/214 (14%)

Query: 639 SDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANS 698
           +++GNRTIY+GN+    R E+ICNVVRGG+LQ++K + ++ +CFVTFI+  +A QF+A S
Sbjct: 494 NNLGNRTIYLGNLPKDIRVEEICNVVRGGLLQSVKLLGDRYVCFVTFIDPTAAAQFFAMS 553

Query: 699 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 758
            +  + +     +VGWG +SGPL  +++LAV+ GASRN+Y+   +FA  +K   +P + +
Sbjct: 554 SLHGLTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFATDKKR-DNPIFTE 612

Query: 759 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHD 818
                     + LR+ FS YG++EQIN+L + +CC+INF NIS+AI  ++++   P    
Sbjct: 613 ----------DSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILALDKIKSNPV--- 659

Query: 819 DSGELIPKTATEEKFDGRYKGLLINYGKDRCGNI 852
                             +K L IN+GKDRCGNI
Sbjct: 660 ------------------FKDLKINFGKDRCGNI 675

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 122/264 (46%), Gaps = 61/264 (23%)

Query: 632 KVASSMGSDIGN---------RTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICF 682
           ++ S+MGS + +         RT+Y+GNI      +++ + VR G+++++K I EK   F
Sbjct: 201 RMQSTMGSRLNDPLDFTTAPSRTVYLGNIPSDLTVKELLDHVRSGVIEDVKIIPEKLCAF 260

Query: 683 VTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVS-L 741
           ++F++  SA+ F++++ +  + ++G  +++GWG  +   P   +  +  GA+RNV++  L
Sbjct: 261 ISFLDENSALLFHSDAILKRLNINGKDIKIGWGKSTAVDPMIATRIINDGATRNVFIGQL 320

Query: 742 PEFAF---KEKFIHDPQYKQ--LHETLALPDAE--------------------------Q 770
              +F   K K    P  +   ++ T++  + E                          +
Sbjct: 321 KTKSFDPNKAKVTKMPPSRNHDINATISNENDEKENGVDTAHVEGEVEVGEEEEPISDAK 380

Query: 771 LREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTATE 830
           LR+D + +GDI+ I  + D    +I+F +I+SAI  V  +N                   
Sbjct: 381 LRKDLADFGDIDCIKIVEDKGIAFIHFASITSAIKCVHNLNS------------------ 422

Query: 831 EKFDGRYKGLLINYGKDRCGNINK 854
              +  Y    I YGKDRC  I K
Sbjct: 423 --MNDYYSTKKIFYGKDRCAFITK 444

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score =  173 bits (438), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 83/214 (38%), Positives = 130/214 (60%), Gaps = 36/214 (16%)

Query: 639 SDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANS 698
           +++GNRTIY+GN+    + E+ICNVVRGG+LQNIK ++++  CF+TFI+  +A QFYA S
Sbjct: 351 NNLGNRTIYLGNLPKGVKIEEICNVVRGGLLQNIKLLSDRFACFITFIDPTAAAQFYAMS 410

Query: 699 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 758
            +  + +  N  +VGWG +SGPL  +++LA++ GASRN+Y+   +F  K ++ ++     
Sbjct: 411 SLHGLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNVDFEKKNEYFNE----- 465

Query: 759 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHD 818
                     E LRE F  +G++EQIN+L +  CC++NF NI+ AI  ++++   P    
Sbjct: 466 ----------EHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDKIKSLP---- 511

Query: 819 DSGELIPKTATEEKFDGRYKGLLINYGKDRCGNI 852
                             ++ L IN+GKDRCGNI
Sbjct: 512 -----------------EFEDLKINFGKDRCGNI 528

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 119/241 (49%), Gaps = 47/241 (19%)

Query: 616 PNPIT-QSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKY 674
           PNPIT Q    N  ++   A S       RT+Y+GNI      +++ + VR G+++++K 
Sbjct: 106 PNPITMQPFMANDPLNFTNAPS-------RTVYLGNIPQGLTIKELLDHVRSGVVESVKI 158

Query: 675 IAEKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVT-IGA 733
           +  K   F++FI+   A+ F++++ +  + + G  +++GWG  S  +   ++  +T  GA
Sbjct: 159 LPTKLCAFISFIDERGALLFHSDAILKRLNIRGKDIKIGWGK-SNHIDSIVAARITNDGA 217

Query: 734 SRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCC 793
           +RNVY+                  QL++   +   ++L +D   +G+I+ I +LS+    
Sbjct: 218 TRNVYIG-----------------QLNDDPTITTEQELEKDMQKFGEIDCIKFLSNKGIA 260

Query: 794 WINFMNISSAISLVEEMNEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNIN 853
           +++F +IS AI +V+ ++                    K + +YK   I YGKDRC  I 
Sbjct: 261 FVHFASISVAIYVVQNLS--------------------KLNEKYKNKRIFYGKDRCAFIT 300

Query: 854 K 854
           K
Sbjct: 301 K 301

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score =  173 bits (439), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 131/215 (60%), Gaps = 34/215 (15%)

Query: 639 SDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANS 698
           +++GNRT+Y+GN+    + E+ICN VRGG+LQ++K ++++ +CFVTFI+  +A QFYA S
Sbjct: 396 NNLGNRTVYLGNLPKDVKIEEICNAVRGGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMS 455

Query: 699 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 758
            +  + +H    ++GWG +SG LP +++LAV+ GASRN+YV   +F              
Sbjct: 456 SLHGLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDF------------NA 503

Query: 759 LHETLALPDAEQ-LREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGH 817
           + ET      EQ LRE F  +G++EQIN+L + +CC+INF NIS+AI  ++++   P   
Sbjct: 504 IDETGETIFTEQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAIDKIKCNP--- 560

Query: 818 DDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNI 852
                              +K L +N+GKDRCGN+
Sbjct: 561 ------------------YFKNLKVNFGKDRCGNV 577

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 63/218 (28%), Positives = 110/218 (50%), Gaps = 39/218 (17%)

Query: 644 RTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPI 703
           RT+Y+GNI P   A+ + + VR G+++ +K + ++   F++F++ +SA+ F++++ +  +
Sbjct: 161 RTVYLGNIPPFLPAKQLLDHVRSGVIEELKILPDRMCAFISFVDESSALLFHSDAILKRL 220

Query: 704 VLHGNMLRVGWGHYSGPLPKSISLAVTI---GASRNVYVSL----PEFAFKEKFIHDPQY 756
            + G  ++VGWG    P P    +A  I   GA+RNVY+      P+ A   +F  DP  
Sbjct: 221 NIEGRDIKVGWGK---PTPIDPIVAAGIASDGATRNVYIGRLNTDPQLA--PQFGTDPNE 275

Query: 757 KQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTG 816
           + + E       E+LR+D + +G+IE I  + D    +++F +I SAI +V  +      
Sbjct: 276 EIVSE-------EKLRKDLNDFGEIESIKIVRDKGIAFVHFSSIFSAIKVVSNL------ 322

Query: 817 HDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINK 854
                            +  Y    I YGKDRC  I K
Sbjct: 323 --------------ASVNPYYTNKKIFYGKDRCAFITK 346

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score =  173 bits (439), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 132/214 (61%), Gaps = 32/214 (14%)

Query: 639 SDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANS 698
           +++GNRT+Y+GN+    + E+ICNVVRGGILQ IK ++++ +CFVTFI+  +A QFYA S
Sbjct: 398 NNLGNRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAAAQFYAMS 457

Query: 699 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 758
            +  I +     RVGWG + GPLP +I+LAV+ GASRNVY+   +F +++    +P +  
Sbjct: 458 SLHGITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNIDF-YEDSKRQEPIFT- 515

Query: 759 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHD 818
                    A+ LR+ F  YG++EQ+N+L + +C ++N+ NIS+AIS ++++   P    
Sbjct: 516 ---------ADYLRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKIKSNPL--- 563

Query: 819 DSGELIPKTATEEKFDGRYKGLLINYGKDRCGNI 852
                             +K L IN+GKDRCG I
Sbjct: 564 ------------------FKNLKINFGKDRCGTI 579

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 106/213 (49%), Gaps = 29/213 (13%)

Query: 644 RTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPI 703
           +T+Y+GNI P     ++ + VR G+++ +K + EK   F+TF++ ++A+ F++++ +  +
Sbjct: 163 KTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDAILKRL 222

Query: 704 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSL--PEFAFKEKFIHDPQYKQLHE 761
            + G  +++GWG  +   P   +   + GA+RNVY+ L   +     +   DP  +++ E
Sbjct: 223 HIDGRDIKIGWGKATPVDPLVTTAIASDGATRNVYIGLLNTDSDIALQVGADPNDEKITE 282

Query: 762 TLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSG 821
                  E+LR D   +G+I+ +  + +    +I+F +I SA+ +V  +           
Sbjct: 283 -------EKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAVKVVANL----------- 324

Query: 822 ELIPKTATEEKFDGRYKGLLINYGKDRCGNINK 854
                       +  Y+   I YGKDRC  I K
Sbjct: 325 ---------AGINPYYENKKIYYGKDRCAFITK 348

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score =  173 bits (438), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 127/214 (59%), Gaps = 32/214 (14%)

Query: 639 SDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANS 698
           +++GNRT+Y+GN+    + E+ICN +RGG+LQNIK + ++ +CFVTFI+  +A QFYA S
Sbjct: 467 NNLGNRTVYLGNLPKNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMS 526

Query: 699 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 758
            +  + +H    ++GWG +SGPLP  I+LAV+ GASRN+Y  L    F+E        KQ
Sbjct: 527 SLHGLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIY--LGNINFEE------DAKQ 578

Query: 759 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHD 818
                A    + LR  F  +G +EQIN+L + +CC+INF NIS+AI  ++++   P    
Sbjct: 579 EESVFA---EDTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKIKSNP---- 631

Query: 819 DSGELIPKTATEEKFDGRYKGLLINYGKDRCGNI 852
                             +  L IN+GKDRCGN+
Sbjct: 632 -----------------HFNNLKINFGKDRCGNV 648

 Score = 85.5 bits (210), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 103/213 (48%), Gaps = 29/213 (13%)

Query: 644 RTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPI 703
           RT+Y+GNI      + + + VR G+++ +K ++EK   FV+F++   A+ F++++ +  +
Sbjct: 233 RTVYLGNIPATITYKALLDYVRTGVVEEVKILSEKMCAFVSFVDENDALLFHSDAILKRL 292

Query: 704 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFK--EKFIHDPQYKQLHE 761
            + G  +++GWG      P   +     GA+RNVY+          EK+  DP+      
Sbjct: 293 NIDGRDIKIGWGKPQPIDPIVRAGIANDGATRNVYIGKLNTNKDSCEKWGADPKE----- 347

Query: 762 TLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSG 821
              L   E+L +D S +G+IE I  + D    +++F +I +AI  V  +          G
Sbjct: 348 --ILVTKEKLYDDLSQFGEIESIKLVEDRGIAFVHFTSIFAAIKAVANI----------G 395

Query: 822 ELIPKTATEEKFDGRYKGLLINYGKDRCGNINK 854
            + P  + ++ F          YGKDRC  I K
Sbjct: 396 SIDPYYSNKKVF----------YGKDRCAFITK 418

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score =  172 bits (435), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 87/214 (40%), Positives = 130/214 (60%), Gaps = 32/214 (14%)

Query: 639 SDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANS 698
           +++GNRT+Y+GN+    + E+ICN VR G+LQ++K ++++ +CFVTFI+  +A QFYA S
Sbjct: 404 NNLGNRTVYLGNLPKGIKIEEICNTVRSGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMS 463

Query: 699 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 758
            +  ++L     +VGWG +SGPLP  I+LAV+ GASRNVY+   +F    K         
Sbjct: 464 SLHGLILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNVYIGNIDFEEDSK--------- 514

Query: 759 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHD 818
            +E +   D   LR+ F  YG++EQIN+L   +CC+IN+ NIS+AIS ++++   P    
Sbjct: 515 RNERVFTED--NLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAIDKIKSNP---- 568

Query: 819 DSGELIPKTATEEKFDGRYKGLLINYGKDRCGNI 852
                             +K L IN+GKDRCGNI
Sbjct: 569 -----------------YFKDLKINFGKDRCGNI 585

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 58/217 (26%), Positives = 108/217 (49%), Gaps = 37/217 (17%)

Query: 644 RTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPI 703
           RT+Y+GNI      +++ + VR G+++++K + EK   F++F++ +SA+ F++++ +  +
Sbjct: 169 RTVYLGNIPTTLTVKELLDHVRSGVVEDVKILPEKMCAFISFVDDSSALLFHSDAILKRL 228

Query: 704 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETL 763
            + G  +++GWG  +   P   +   T GA+RNVY+         +   D    ++ E+L
Sbjct: 229 NIEGRDIKIGWGKPTKIDPIVANGITTDGATRNVYIG--------QLYTD---AEVAESL 277

Query: 764 ALPD------AEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGH 817
            +P        E+L  D   YGDI+ +  + +    +I+F +I SAI +V  +       
Sbjct: 278 NIPKESEIVTEERLIADLEIYGDIDSVKIVKEKGIAFIHFASILSAIKVVNNL------- 330

Query: 818 DDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINK 854
                     A   ++   Y+   I YGKDRC  I K
Sbjct: 331 ----------AASNRY---YQNRKIFYGKDRCAFITK 354

>KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON}
           Anc_6.183 YPL184C
          Length = 443

 Score =  168 bits (425), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 126/213 (59%), Gaps = 34/213 (15%)

Query: 640 DIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSF 699
           ++GNRTIY+GN++ R R E++CNVVRGG+LQ++K++ ++ +CFVTF +  +A QFYA + 
Sbjct: 261 NLGNRTIYVGNLSARCRIEEVCNVVRGGLLQSVKFLPDRHVCFVTFADPTAAAQFYAMAS 320

Query: 700 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQL 759
           +  + +     ++GWG +SGPLP  ++ A++ GASRNVY       F      DP   + 
Sbjct: 321 LHGLTIQRRRCKIGWGKHSGPLPAHLADAISHGASRNVY-------FGNVNWQDPAVAEF 373

Query: 760 HETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDD 819
            E         LR+  S +G++EQ+N + +  C ++NF N+ SAI+ VE++ + P     
Sbjct: 374 FEE------RHLRQAMSHFGEMEQVNAVPERRCVFVNFTNLESAIAAVEQVKKWP----- 422

Query: 820 SGELIPKTATEEKFDGRYKGLLINYGKDRCGNI 852
                           +++ L +NYGKDRCGN+
Sbjct: 423 ----------------QFQQLKVNYGKDRCGNV 439

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/245 (21%), Positives = 109/245 (44%), Gaps = 51/245 (20%)

Query: 643 NRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDP 702
           +RT+Y+GNI P     ++ + V+ G++++ +    K   FV+F++  SA+ F++++ ++ 
Sbjct: 38  SRTVYLGNIAPEVTLRELLDHVQSGVVEDARLFPAKSCAFVSFVDENSALLFHSDAILNR 97

Query: 703 IVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHET 762
           + +    +++GW   +   P   +   + GA+RNVY+                       
Sbjct: 98  LRIGDRDVKIGWATATLMDPLVATRIQSEGATRNVYLG---------------------- 135

Query: 763 LALPDAE---QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDD 819
             LPD     +L +D S YG+I+ +  LS     +++  +I  AI  V  +  +   + D
Sbjct: 136 -NLPDGVSRYELTKDLSVYGEIDSVKLLSSKGVAFVHMASIGQAIHAVANLQRDNKIYSD 194

Query: 820 SGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYN-IRLS 878
                                 +++GKDRC  + K     + SR  + +  P  + +R+ 
Sbjct: 195 R--------------------RVSFGKDRCAYVTKL----QQSRAAQFLGLPEEDAVRME 230

Query: 879 KLEER 883
           +L +R
Sbjct: 231 QLRDR 235

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score =  170 bits (430), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 85/213 (39%), Positives = 126/213 (59%), Gaps = 32/213 (15%)

Query: 640 DIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSF 699
           ++GNRT+Y+GN+    + E+ICNVVRGG+LQN+K ++++ +CFVTFI+  +A QFYA S 
Sbjct: 447 NLGNRTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMSS 506

Query: 700 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQL 759
           +  I +     RVGWG + G L  +++LAV+ GASRNVYV    F    K   DP + + 
Sbjct: 507 LHGITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVGNINFDEDSKR-EDPIFTE- 564

Query: 760 HETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDD 819
                      LR  F  +G++EQINYL + +CC++N+ NIS+AI  ++++   P     
Sbjct: 565 ---------SSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAIDKIKGHPV---- 611

Query: 820 SGELIPKTATEEKFDGRYKGLLINYGKDRCGNI 852
                            +K L IN+GKDRCGN+
Sbjct: 612 -----------------FKDLKINFGKDRCGNV 627

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 102/214 (47%), Gaps = 30/214 (14%)

Query: 644 RTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPI 703
           +T+Y+GN       +++ + VR G++++++ + +K   FV+F++ ++A+ F++++ +  +
Sbjct: 210 KTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHSDAILKRL 269

Query: 704 VLHGNMLRVGWGHYSGPLPKSISLAVTIG---ASRNVYVSLPEFAFKEKFIHDPQYKQLH 760
            + G  +++GWG    P P    +A  +    A+RNVY+   +     K     Q   + 
Sbjct: 270 HIDGRDIKIGWGK---PTPIDPVVATAVANDNATRNVYIG--QLNTGPKL--SSQVSPVD 322

Query: 761 ETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDS 820
            T  +   ++LR D   +G+I+ I  + +    +++F +I +AI  V  +          
Sbjct: 323 VTEPVITEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVANL---------- 372

Query: 821 GELIPKTATEEKFDGRYKGLLINYGKDRCGNINK 854
                        +  Y+   I YGKDRC  I K
Sbjct: 373 ----------ANINPYYRNKKIFYGKDRCAFITK 396

>CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184c
          Length = 639

 Score =  170 bits (430), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 85/214 (39%), Positives = 127/214 (59%), Gaps = 32/214 (14%)

Query: 639 SDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANS 698
           +++GNRT+Y+GN+    + E+ICN VRGG+LQ+IK + ++ +CFVTFI+  +A QFYA S
Sbjct: 453 NNLGNRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQFYAMS 512

Query: 699 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 758
            +    +     +VGWG +SGPLP +++LAV+ GASRNVY+   +F    K     +   
Sbjct: 513 SLYGFTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVYLGNIDFEADSK----KEQPI 568

Query: 759 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHD 818
            +ET        LR  F  YG++EQIN+L +  CC+INF NI++AI  ++++   P    
Sbjct: 569 FNET-------ALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAIFAMDKIKSNP---- 617

Query: 819 DSGELIPKTATEEKFDGRYKGLLINYGKDRCGNI 852
                             +K L IN+GKDRCGN+
Sbjct: 618 -----------------HFKSLKINFGKDRCGNV 634

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 61/211 (28%), Positives = 106/211 (50%), Gaps = 31/211 (14%)

Query: 644 RTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPI 703
           RT+Y+GNI P    +++ + VR G+++  K + EK   F++F+E +SA+ F++++ +  +
Sbjct: 224 RTVYLGNIPPSLTIKELLDHVRSGVVEEAKILPEKMCAFISFVEESSALLFHSDAILKRL 283

Query: 704 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETL 763
            +    ++VGWG  +   P   S  +  GA+RNVY+            +D   K+  E L
Sbjct: 284 NIDNRDIKVGWGKPTVLDPSIASRIINDGATRNVYIGQGN--------NDRSSKENKEPL 335

Query: 764 ALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGEL 823
                E+LRED   YG+I+ I  + +    +++F +I++AI +V  +             
Sbjct: 336 T---EEKLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVVSTL------------- 379

Query: 824 IPKTATEEKFDGRYKGLLINYGKDRCGNINK 854
               A +  F   Y+   I YGKDRC  I K
Sbjct: 380 ----AQKNPF---YQEKKIFYGKDRCAFITK 403

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score =  165 bits (417), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 128/213 (60%), Gaps = 32/213 (15%)

Query: 640 DIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSF 699
           ++GNRTIY+GN+    + E+ICNVVRGG+LQ+IK + ++ +CFVTFI+  +A Q YA + 
Sbjct: 382 NLGNRTIYLGNLPKDVKIEEICNVVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMAS 441

Query: 700 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQL 759
           +  + +H    ++GWG +SG L  +++LAV+ GASRN+Y+   +F    +  H P + + 
Sbjct: 442 LHGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFKADSETEH-PIFTE- 499

Query: 760 HETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDD 819
                    + LR  F  +G++EQIN+L + +CC++NF NIS+AI  ++++   P     
Sbjct: 500 ---------QNLRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAIDKIKNNP----- 545

Query: 820 SGELIPKTATEEKFDGRYKGLLINYGKDRCGNI 852
                           ++  L IN+GKDRCGN+
Sbjct: 546 ----------------QFSDLKINFGKDRCGNV 562

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 112/213 (52%), Gaps = 29/213 (13%)

Query: 644 RTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPI 703
           RT+Y+GNI P   A  + + VR G++++I+ + EK   F++F++ +SA+ F++++ +  +
Sbjct: 146 RTVYLGNIPPNLEARQLLDHVRSGVVEDIRILREKMCAFISFLDESSALLFHSDAILKRL 205

Query: 704 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSL--PEFAFKEKFIHDPQYKQLHE 761
            + G  +++GWG  +   P   S     GA+RNVY+     + +F  +   DP+ + + E
Sbjct: 206 NIDGRDIKIGWGKPTPIDPVVTSAVANDGATRNVYIGRLNTDSSFAPQIGADPRDEVVTE 265

Query: 762 TLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSG 821
                  ++LR+D S YG+IE +  +++    +++F +I SAI +V  +           
Sbjct: 266 -------QKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSL----------A 308

Query: 822 ELIPKTATEEKFDGRYKGLLINYGKDRCGNINK 854
            + P  A ++ F          YGKDRC  I K
Sbjct: 309 AVNPYYANKKIF----------YGKDRCAFITK 331

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score =  165 bits (418), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 128/214 (59%), Gaps = 32/214 (14%)

Query: 639 SDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANS 698
           +++GNRT+Y+G++    + E+ICN VRGG+LQ+IK + ++ +CFVTFI+  +A QFYA S
Sbjct: 410 NNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMS 469

Query: 699 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 758
            +    +     +VGWG +SGPLP +++LAV+ GASRNVYV   +FA             
Sbjct: 470 SLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFA----------SDS 519

Query: 759 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHD 818
           L++     +   LR  F  YG++EQIN+L + +CC+IN+ NIS+AI  ++++   P    
Sbjct: 520 LNDERIFTE-NNLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKSNP---- 574

Query: 819 DSGELIPKTATEEKFDGRYKGLLINYGKDRCGNI 852
                             +K L IN+GKDRCGN+
Sbjct: 575 -----------------YFKDLKINFGKDRCGNV 591

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 102/211 (48%), Gaps = 35/211 (16%)

Query: 644 RTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPI 703
           RT+Y+GN+ P    +++ + VR G+++++K I EK   F++F++ ++A+ F++++ +  +
Sbjct: 185 RTVYLGNVPPHLTVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 244

Query: 704 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETL 763
            +    +++GWG  +   P   +   T GA+RNVY+       +E  + +          
Sbjct: 245 NIGDRDIKIGWGKPTRIDPIVAARITTDGATRNVYIGRMTVEGEESHLSE---------- 294

Query: 764 ALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGEL 823
                EQLR D   YG+I+ I  + +    +I+F +I +AI +V  +             
Sbjct: 295 -----EQLRADLQEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLPIR---------- 339

Query: 824 IPKTATEEKFDGRYKGLLINYGKDRCGNINK 854
                     +  Y+   I YGKDRC  I K
Sbjct: 340 ----------NPYYQNKRIFYGKDRCAFITK 360

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
           MRN1RNA-binding protein proposed to be involved in
           translational regulation; binds specific categories of
           mRNAs, including those that contain upstream open
           reading frames (uORFs) and internal ribosome entry sites
           (IRES)
          Length = 612

 Score =  165 bits (418), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 128/214 (59%), Gaps = 32/214 (14%)

Query: 639 SDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANS 698
           +++GNRT+Y+G++    + E+ICN VRGG+LQ+IK + ++ +CFVTFI+  +A QFYA S
Sbjct: 426 NNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMS 485

Query: 699 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 758
            +    +     +VGWG +SGPLP +++LAV+ GASRNVYV          F+ D     
Sbjct: 486 SLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVGD----S 535

Query: 759 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHD 818
           L +     ++  LR  F  YG++EQIN+L + +CC+IN+ NIS+AI  ++++   P    
Sbjct: 536 LRDERVFTES-NLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKSNPY--- 591

Query: 819 DSGELIPKTATEEKFDGRYKGLLINYGKDRCGNI 852
                             +K L IN+GKDRCGN+
Sbjct: 592 ------------------FKDLKINFGKDRCGNV 607

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 102/211 (48%), Gaps = 35/211 (16%)

Query: 644 RTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPI 703
           RT+Y+GN+ P    +++ + VR G+++++K I EK   FV+FI+ ++A+ F++++ +  +
Sbjct: 201 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFVSFIDESAALLFHSDAILKRL 260

Query: 704 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETL 763
            +    +++GWG  +   P   +   T GA+RNVY+       +E  + +          
Sbjct: 261 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHLSE---------- 310

Query: 764 ALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGEL 823
                EQLR D   YG+I+ I  + +    +I+F +I +AI +V  +             
Sbjct: 311 -----EQLRVDLEEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLPIR---------- 355

Query: 824 IPKTATEEKFDGRYKGLLINYGKDRCGNINK 854
                     +  Y+   I YGKDRC  I K
Sbjct: 356 ----------NPYYQNKRIFYGKDRCAFITK 376

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
           (REAL)
          Length = 625

 Score =  164 bits (414), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/214 (38%), Positives = 128/214 (59%), Gaps = 32/214 (14%)

Query: 639 SDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANS 698
           +++GNRT+Y+G++    + E+ICN VRGG+LQ+IK + ++ +CFVTFI+  +A QFYA S
Sbjct: 439 NNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMS 498

Query: 699 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 758
            +    +     +VGWG +SGPLP +++LAV+ GASRNVYV          F+ D     
Sbjct: 499 SLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVSD----S 548

Query: 759 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHD 818
           L +     ++  LR  F  YG++EQIN+L + +CC++N+ NIS+AI  ++++   P    
Sbjct: 549 LRDERIFTES-NLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAILALDKIKSNPY--- 604

Query: 819 DSGELIPKTATEEKFDGRYKGLLINYGKDRCGNI 852
                             +K L IN+GKDRCGN+
Sbjct: 605 ------------------FKDLKINFGKDRCGNV 620

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 104/211 (49%), Gaps = 35/211 (16%)

Query: 644 RTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPI 703
           RT+Y+GN+ P    +++ + VR G+++++K I+EK   F++F++ ++A+ F++++ +  +
Sbjct: 214 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIISEKMCAFISFVDESAALLFHSDAILKRL 273

Query: 704 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETL 763
            +    +++GWG  +   P   +   T GA+RNVY+         +   D +   L E  
Sbjct: 274 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIG--------RMTIDGEESHLSE-- 323

Query: 764 ALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGEL 823
                EQLR D   YG+I+ I  + +    +I+F +I +AI +V  +             
Sbjct: 324 -----EQLRIDLKEYGEIDCIKVIKEKGIAFIHFASILNAIKVVTNLPIR---------- 368

Query: 824 IPKTATEEKFDGRYKGLLINYGKDRCGNINK 854
                     +  Y+   I YGKDRC  I K
Sbjct: 369 ----------NPYYQNKRIFYGKDRCAFITK 389

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 569

 Score =  163 bits (412), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 81/215 (37%), Positives = 132/215 (61%), Gaps = 34/215 (15%)

Query: 639 SDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANS 698
           +++GNRTIY+GN+    + E+ICN VRGG+LQ+IK + ++ +CFVTFI+  +A Q YA +
Sbjct: 383 NNLGNRTIYLGNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMT 442

Query: 699 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEF-AFKEKFIHDPQYK 757
            +  + +H    ++GWG +SG L  +++LAV+ GASRN+Y+   +F A  E+ +  P + 
Sbjct: 443 SLHGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFKADSERDV--PVFT 500

Query: 758 QLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGH 817
           +          + LR+ F  YG++EQIN+L +  CC++NF NIS+AI  ++++       
Sbjct: 501 E----------QNLRKLFEEYGEVEQINFLPERSCCFVNFTNISNAILAIDKI------- 543

Query: 818 DDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNI 852
                         K + ++K L IN+GKDRCGN+
Sbjct: 544 --------------KSNEQFKDLKINFGKDRCGNV 564

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/214 (28%), Positives = 111/214 (51%), Gaps = 31/214 (14%)

Query: 644 RTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPI 703
           RT+Y+GNI P     ++ + VR G++++++ + EK   F++F++ +SA+ F++++ +  +
Sbjct: 148 RTVYLGNIPPNLEVRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAILKRL 207

Query: 704 VLHGNMLRVGWGHYSGPLPKSISLAVT-IGASRNVYVSL--PEFAFKEKFIHDPQYKQLH 760
            + G  ++VGWG  + P+   ++ AV+  GA+RNVY+     +     +F  DP  + L 
Sbjct: 208 NIGGRDIKVGWGKPT-PIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFGADP--RDLI 264

Query: 761 ETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDS 820
            T      E+LR D   YG+IE +  + +    +++F +I SAI +V  +          
Sbjct: 265 AT-----EEKLRADLDFYGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSL---------- 309

Query: 821 GELIPKTATEEKFDGRYKGLLINYGKDRCGNINK 854
                  AT   +   Y    I YGKDRC  + K
Sbjct: 310 -------ATVNPY---YSNKKIFYGKDRCAFVTK 333

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
           YPL184C (REAL)
          Length = 614

 Score =  162 bits (409), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 127/214 (59%), Gaps = 32/214 (14%)

Query: 639 SDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANS 698
           +++GNRT+Y+G++    + E+ICN VRGG+LQ+IK + ++ +CFVTFI+  +A QFYA S
Sbjct: 428 NNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMS 487

Query: 699 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 758
            +    +     +VGWG +SGPLP +++LAV+ GASRNVYV      +    + D +   
Sbjct: 488 SLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG--NIDYVSDSVRDER--- 542

Query: 759 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHD 818
                 +    +LR  F  YG++EQIN+L + +CC+IN+ NIS+AI  ++++   P    
Sbjct: 543 ------IFTEGKLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKSNPY--- 593

Query: 819 DSGELIPKTATEEKFDGRYKGLLINYGKDRCGNI 852
                             +K L IN+GKDRCGN+
Sbjct: 594 ------------------FKDLKINFGKDRCGNV 609

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 101/211 (47%), Gaps = 35/211 (16%)

Query: 644 RTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPI 703
           RT+Y+GN+ P    +++ + VR G+++++K I EK   F++F++ ++A+ F++++ +  +
Sbjct: 203 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 262

Query: 704 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETL 763
            +    +++GWG  +   P   +   T GA+RNVY+       +E  +            
Sbjct: 263 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL------------ 310

Query: 764 ALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGEL 823
                EQLR D   YG+I+ I  + +    +I+F +I +AI +V  +             
Sbjct: 311 ---SGEQLRADLEEYGEIDCIKIIKEKGVAFIHFASILNAIKVVTNLPIR---------- 357

Query: 824 IPKTATEEKFDGRYKGLLINYGKDRCGNINK 854
                     +  Y+   I YGKDRC  I K
Sbjct: 358 ----------NLYYQNKRIFYGKDRCAFITK 378

>KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {ON}
           some similarities with uniprot|Q96US5 Saccharomyces
           cerevisiae YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 422

 Score = 39.3 bits (90), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 754 PQYKQLH---ETLALPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVEE 809
           P+ +QLH   + L   D + LR+DF  +G+I +I+  +S   C  ++F ++ SAI+ +E 
Sbjct: 330 PRSRQLHSNRQNLCSFDYKDLRKDFEQFGEISEISPMISRKLCVSVSFYDVRSAINALES 389

Query: 810 MNE 812
             E
Sbjct: 390 FGE 392

>KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.247
           YKR036C
          Length = 653

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 4/85 (4%)

Query: 300 NLKFVCLNYDSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEF 359
           N K   L+Y S SLP  +  E ++RS      +DAS M+ A L H    K + +S I   
Sbjct: 128 NAKSSVLDYQSVSLPDELNIETINRSYSAKVLNDASKMVLAELEHIKLQKSSVKSEIANI 187

Query: 360 KSPLEK----AELFKEKLQFLDRSK 380
           +  L       +L  ++++ LDR++
Sbjct: 188 REKLASLHNMEKLMAQRIKMLDRAE 212

>AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL016W
           (PUB1)
          Length = 378

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 9/75 (12%)

Query: 645 TIYIGNINPRSRAEDICNVVRG-GILQNIKYIAEKRICFV---TFIEAASAVQFYANSFI 700
           T YIGNI   ++  D+  +++  G + + K+ AEK  CF+   T  +AA  +   AN   
Sbjct: 272 TAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYAEKGCCFIKYDTHDQAALCIVALAN--- 328

Query: 701 DPIVLHGNMLRVGWG 715
                 G  LR GWG
Sbjct: 329 --FPFQGRTLRTGWG 341

>TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.306
           YNL016W
          Length = 442

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 9/75 (12%)

Query: 645 TIYIGNINPRSRAEDICNVVRG-GILQNIKYIAEKRICFV---TFIEAASAVQFYANSFI 700
           T+YIGNI   +   D+  +++  G + + KY  EK  CF+   T  +AA  +   AN   
Sbjct: 326 TVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLAN--- 382

Query: 701 DPIVLHGNMLRVGWG 715
                 G  L+ GWG
Sbjct: 383 --YPFQGRNLKTGWG 395

>Skud_4.47 Chr4 complement(83397..84428) [1032 bp, 343 aa] {ON}
           YDL209C (REAL)
          Length = 343

 Score = 35.8 bits (81), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 12/77 (15%)

Query: 770 QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTAT 829
           ++R  FS  GDI++I Y+ D +C ++ F   ++A    E M+ +         L+P   +
Sbjct: 159 RIRFVFSRLGDIDRIRYVEDKNCAFVKFKYQANAEFAKESMSNQTL-------LLP---S 208

Query: 830 EEKFDGRYK--GLLINY 844
           ++++DGR +  GLL+ +
Sbjct: 209 DKEWDGRREGTGLLVKW 225

>ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR242C
           (SSP2)
          Length = 376

 Score = 35.4 bits (80), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 69/161 (42%), Gaps = 12/161 (7%)

Query: 660 ICNVVRGGILQNI-----KYIAEKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGW 714
           + N V+GG L++I     K   + +   + F+    A  F          ++G  LR  W
Sbjct: 183 VLNQVQGGALKHITPQYKKETNQLKSVELEFLCPEDAQHFMEYGRHAVFQINGVHLRPRW 242

Query: 715 GHYSGPLPKSISLAVTIGASRNVYV-SLPEFAFKEKFIHDPQYKQLH-----ETLALPDA 768
           G  S       SL        N+Y  S      K++   +P++   H       +   + 
Sbjct: 243 GIQSLSENFEASLNANQRDRLNLYAPSSRCLLLKKQGSKNPKHSTCHYPSPRSHICDLNV 302

Query: 769 EQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVE 808
           ++L++DFS +G+I  I+  +S   C  INF +I SA+  ++
Sbjct: 303 QELKKDFSQFGNILDISPMISRKLCVQINFYDIKSAMDALQ 343

>Ecym_2403 Chr2 (785307..786434) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ACR135C
          Length = 375

 Score = 35.4 bits (80), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 72/162 (44%), Gaps = 15/162 (9%)

Query: 660 ICNVVRGGILQNI--KYIAEK---RICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGW 714
           + N V+GG L++I  +Y  E    +   + F+    A  F          ++G  LR  W
Sbjct: 183 VLNQVQGGPLKHIAPQYRKESNQLKSVELEFLSPEDAQHFMEYGRHAVFQINGVHLRPKW 242

Query: 715 GHYSGPLPKSISLAV-TIGASRNVYV-SLPEFAFKEKFIHDPQYKQLH-----ETLALPD 767
           G  S  L ++   ++ T   S NVY  S      K++   +P++   H       +   +
Sbjct: 243 GIQS--LSENFEASLNTHKDSLNVYTPSSRCLLLKKQGSRNPKHSTCHYPSPRSHICDLN 300

Query: 768 AEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVE 808
            + L+ DF  +GDI  I+  +S   C  INF +I +A+  ++
Sbjct: 301 IQDLKNDFGQFGDILDISPMISRKLCVQINFFDIKTAVDALQ 342

>ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {ON}
           similar to uniprot|Q96US5 Saccharomyces cerevisiae
           YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 389

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 72/176 (40%), Gaps = 11/176 (6%)

Query: 644 RTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICF----VTFIEAASAVQFYANSF 699
           + I +GNI  R+    I   +  G L+NI    +         + F+   +A  F     
Sbjct: 183 KAIVLGNIPKRTGIASILAQIHAGPLENIIVHTDDEQALKKIELDFLTHEAAYSFMKYGR 242

Query: 700 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQL 759
            +   ++G  L   WG  S    K  +      +S +          K K+I+  +  + 
Sbjct: 243 TNMFKINGQHLTPEWGKSSEHKTKKGNEWDDQQSSSDDQDFCRSLIMK-KYINCTKRTKY 301

Query: 760 HET-----LALPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVEE 809
            E      L   +  ++++DF T+G+I +I   +S   C  INF N+ SA+  ++E
Sbjct: 302 SEAYKESPLEPLNLSEIKQDFGTFGEILEITPVVSRKLCISINFFNMESAMKAMKE 357

>YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON}
           SSP2Sporulation specific protein that localizes to the
           spore wall; required for sporulation at a point after
           meiosis II and during spore wall formation; SSP2
           expression is induced midway in meiosis
          Length = 371

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 16/88 (18%)

Query: 761 ETLALPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVEEMNEEPTGHDD 819
           +TL   D ++L +DF  +G++ +I   +S   C  I F +ISSA+  +EE       ++ 
Sbjct: 290 QTLENIDIQELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEE-------YEQ 342

Query: 820 SGELIPKTATEEKFDGRYKGLLINYGKD 847
            G  +        ++  +K   I YGKD
Sbjct: 343 KGSYL--------YNKYFKTWTIWYGKD 362

>KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.797
           YOR319W
          Length = 212

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 82/175 (46%), Gaps = 15/175 (8%)

Query: 644 RTIYIGNINPRSRAEDICNV-VRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDP 702
           RT+Y+GNI+PR   ED+  + V+ G ++ I Y  +K    +   +  + ++F  +S +D 
Sbjct: 7   RTVYVGNIDPRVNKEDLYELFVQFGRIKKINYPRDK---VLDTHQGYAFIEFLNDSTVDY 63

Query: 703 IV-LHGNMLRVGWGHYSGPLPKSIS--LAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQL 759
           ++ L GN   V     S  + KS +   A   G ++N+ V +   A   K I     K +
Sbjct: 64  VLKLFGNTNLVSLYERSLKIRKSENGKEANANGTNKNIDVDMLPIA---KII----VKNV 116

Query: 760 HETLALPDAEQLREDFSTYGDIEQINYLSDS-HCCWINFMNISSAISLVEEMNEE 813
            E++ +    ++   F        I  +S+   C +++F +   +   ++++N E
Sbjct: 117 DESVDIMKLNKICSKFGKLARDSDIVTMSNGMRCGFVHFRDYKDSDLAIDKLNNE 171

>Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {ON}
           YOR242C (REAL)
          Length = 371

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 16/88 (18%)

Query: 761 ETLALPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVEEMNEEPTGHDD 819
           + L   +  +L +DF  +G+I +I   +S   C  I F +ISSA+  +EE  ++ +G ++
Sbjct: 290 QNLETINVRELEKDFQNFGEILEITPIVSRKLCVSIFFYDISSAMRAMEEYEQKGSGLNN 349

Query: 820 SGELIPKTATEEKFDGRYKGLLINYGKD 847
                            +K   I YGKD
Sbjct: 350 K---------------YFKTWTIWYGKD 362

>NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {ON} 
          Length = 474

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 51/101 (50%), Gaps = 13/101 (12%)

Query: 619 ITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRG-GILQNIKYIAE 677
           +T +L  N N+       +GS+  N TI++G ++     +++  + R  G + ++K    
Sbjct: 287 VTGNLRSNGNIR----QGLGSNSKNSTIFVGGLSTDVSEQELNELFRPFGEIMDVKIPLG 342

Query: 678 KRICFVTF---IEAASAVQFYANSFIDPIVLHGNMLRVGWG 715
           K+  FVTF   I+A +A++      +   ++ G  +R+ WG
Sbjct: 343 KKCGFVTFKRRIDAKAAIK-----GLHGFLVRGCPIRLSWG 378

>Kwal_26.8763 s26 complement(934672..935952) [1281 bp, 426 aa] {ON}
           YOR242C (SSP2) - involved in sporulation [contig 67]
           FULL
          Length = 426

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 761 ETLALPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVEEMNEEP 814
           + L   D + LR+DF  +G+I +I+  +S   C  + F ++SS+I  +E   E+P
Sbjct: 343 QNLCPLDIKDLRQDFENFGNIVEISPMISRKLCLCVTFYDVSSSIGALESF-EKP 396

>NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa]
           {ON} Anc_2.306
          Length = 443

 Score = 33.5 bits (75), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 74/172 (43%), Gaps = 15/172 (8%)

Query: 621 QSLE-QNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICN--VVRGGILQNIKYIAE 677
           QS E Q  +V    A+  G +  +R +Y+GN++ +S  ED+       GG + ++K + +
Sbjct: 59  QSAENQESSVVPASATQGGRETSDRVLYVGNLD-KSINEDLLKQYFQVGGQITDVKIMVD 117

Query: 678 KR-----ICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKS-ISLAVTI 731
           K+       F+ ++++  A    A   ++ I + G  +R+ W   S     S  +  + +
Sbjct: 118 KKNNNVNYAFIEYLKSHDAN--VALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFV 175

Query: 732 GASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQ 783
           G   ++ V + +      F   P Y Q H    +         F ++ D EQ
Sbjct: 176 G---DLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQ 224

>Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON}
           YOR242C (REAL)
          Length = 370

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 16/88 (18%)

Query: 761 ETLALPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVEEMNEEPTGHDD 819
           ++L   D ++L +DF  +G++ +I   +S   C  I F +ISSA+  +EE       ++ 
Sbjct: 289 QSLENIDIQELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEE-------YEQ 341

Query: 820 SGELIPKTATEEKFDGRYKGLLINYGKD 847
            G  +        ++  +K   I YGKD
Sbjct: 342 KGSYL--------YNKYFKTWTIWYGKD 361

>Suva_4.39 Chr4 complement(74438..75484) [1047 bp, 348 aa] {ON}
           YDL209C (REAL)
          Length = 348

 Score = 32.7 bits (73), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%)

Query: 770 QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEE 813
           ++R  FS  GDI++I Y+ D  C ++ F + +SA    E M+ +
Sbjct: 159 RVRFVFSRLGDIDRIRYVEDKSCAFVKFKHQASAEFAKEAMSNQ 202

>Kpol_1031.63 s1031 (159123..160157) [1035 bp, 344 aa] {ON}
           (159123..160157) [1035 nt, 345 aa]
          Length = 344

 Score = 32.3 bits (72), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 62/122 (50%), Gaps = 20/122 (16%)

Query: 770 QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTAT 829
           +LR  F   G+IE+I Y+   +C +++F    +A    E M+ +         LIP   +
Sbjct: 164 RLRFMFGRLGEIERIRYVESKNCAFVSFRFQCNAEFAKEAMSNQTL-------LIP---S 213

Query: 830 EEKFDGRYK--GLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQN 887
           ++++D R +  GLL+ +  D     + +  A K  R  ++ ++ + N+ + KL E+  QN
Sbjct: 214 DKEWDARKEGTGLLVKWAND-----DPDPKAKK--RMQQESEKEAVNV-MKKLLEKHDQN 265

Query: 888 EN 889
           +N
Sbjct: 266 QN 267

>TPHA0G01080 Chr7 complement(217639..218301) [663 bp, 220 aa] {ON}
           Anc_8.797 YOR319W
          Length = 220

 Score = 31.6 bits (70), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 43/83 (51%), Gaps = 8/83 (9%)

Query: 643 NRTIYIGNINPRSRAEDICNV-VRGGILQNIKYIAEKRI------CFVTFIEAASAVQFY 695
           N+T+Y+GNI+P+   + +  + V+   + +IKY  +K +       F+ F      VQ+ 
Sbjct: 11  NKTVYVGNIDPQVTLDILYELFVQVAPISSIKYPKDKVLQAYQGYAFIDFF-TEDDVQYV 69

Query: 696 ANSFIDPIVLHGNMLRVGWGHYS 718
                + + L+G +L+V   +Y+
Sbjct: 70  IKVMNNTVRLYGKLLKVRLSNYA 92

>TBLA0D02810 Chr4 complement(688830..689750) [921 bp, 306 aa] {ON}
           Anc_8.466 YDL209C
          Length = 306

 Score = 32.0 bits (71), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 12/80 (15%)

Query: 770 QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTAT 829
           +LR  FS  G ++++ YL + +C +I F N  +A    E M+ +         LIP   +
Sbjct: 163 RLRYMFSRLGLLDRLRYLENKNCAFIKFKNQCNAEFAKEVMSNQTL-------LIP---S 212

Query: 830 EEKFDGRYK--GLLINYGKD 847
           ++++D R +  GLL+ +  D
Sbjct: 213 DKEWDERNEGTGLLVKWAND 232

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 110,750,648
Number of extensions: 4843143
Number of successful extensions: 13990
Number of sequences better than 10.0: 104
Number of HSP's gapped: 14303
Number of HSP's successfully gapped: 184
Length of query: 1122
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 1002
Effective length of database: 39,721,479
Effective search space: 39800921958
Effective search space used: 39800921958
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 71 (32.0 bits)