Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_13.2462.533ON4191666741e-83
YMR070W (MOT3)2.533ON4901355631e-66
Smik_13.2492.533ON4731355612e-66
Skud_13.2262.533ON4751355421e-63
KNAG0C058102.533ON554683263e-32
KAFR0A018602.533ON490633066e-30
TDEL0A030702.533ON239652813e-28
ZYRO0B02002g2.533ON294612757e-27
NDAI0H014002.533ON541612831e-26
TBLA0I014802.533ON513722696e-25
TBLA0G022302.533ON216682559e-25
NCAS0F009002.533ON525622681e-24
CAGL0K03003g2.533ON647602691e-24
TPHA0G035102.533ON387652561e-23
SAKL0A09482g2.533ON388612524e-23
Kpol_1018.332.533ON589652565e-23
AGL071C2.533ON396612517e-23
Ecym_72552.533ON544612547e-23
NDAI0K018602.533ON730622558e-23
NCAS0A048002.533ON511672531e-22
KLLA0E18547g2.533ON431602464e-22
KLTH0D06842g2.533ON506672244e-19
Kwal_26.80212.533ON507602237e-19
KAFR0J003402.533ON218632058e-18
TPHA0C041902.533ON417531881e-14
KNAG0A070402.533ON352591781e-13
NCAS0A129102.598ON822561454e-09
NDAI0C005602.598ON972631356e-08
SAKL0B11330g2.598ON499671347e-08
YKL062W (MSN4)2.598ON630571331e-07
Smik_11.1862.598ON641571321e-07
Kpol_185.32.598ON647571322e-07
Kwal_26.83512.598ON698671312e-07
Skud_11.1672.598ON628571312e-07
TBLA0H028302.598ON746491312e-07
NDAI0B013402.598ON769551302e-07
ZYRO0F01012g2.598ON584571293e-07
KLTH0D08734g2.598ON677571284e-07
TBLA0G019202.598ON523571275e-07
Ecym_84038.144ON573701285e-07
Suva_11.1642.598ON639561277e-07
Suva_13.2062.598ON709481267e-07
ABR089C2.598ON571491268e-07
Ecym_23012.598ON767581268e-07
KNAG0G012808.144ON472531251e-06
CAGL0M13189g2.598ON541491251e-06
TPHA0N014602.598ON519571241e-06
TDEL0B069102.598ON437571241e-06
YMR037C (MSN2)2.598ON704481241e-06
NCAS0H030802.598ON730681241e-06
Skud_13.1932.598ON704481241e-06
KAFR0F020702.598ON370571222e-06
Smik_13.2072.598ON703481232e-06
KNAG0H005502.598ON620571232e-06
SAKL0H24816g8.144ON410661222e-06
KLLA0F26961g2.598ON694591213e-06
Kpol_1013.212.598ON494571213e-06
KNAG0M023102.598ON660481213e-06
ACL057W8.144ON520651213e-06
CAGL0L06072g8.144ON300601193e-06
KLTH0E06688g8.144ON397601204e-06
TPHA0C025802.598ON365491194e-06
KAFR0A023202.598ON443491194e-06
Kwal_26.80112.531ON190511154e-06
CAGL0F05995g2.598ON597481195e-06
Kwal_47.172418.144ON403651178e-06
TBLA0F003708.144ON687601161e-05
Kpol_1031.428.144ON359661141e-05
ZYRO0G19140g8.144ON557601152e-05
TDEL0B046708.144ON312601132e-05
ACR264W2.162ON769541152e-05
KLTH0H08800g8.117ON168631082e-05
KLLA0C17072g8.144ON474601132e-05
CAGL0M00594g4.351ON1020601143e-05
TPHA0D010508.144ON439601123e-05
KAFR0F012106.256ON311551114e-05
NCAS0B046008.144ON547481124e-05
TBLA0B061604.351ON1384591124e-05
TBLA0H006608.425ON1311501124e-05
Skud_5.2488.144ON442481105e-05
Suva_5.2518.144ON449481105e-05
Smik_5.2768.144ON442481106e-05
NDAI0C06260na 1ON582611106e-05
TPHA0B003804.351ON1310451116e-05
CAGL0K02145g8.144ON317481087e-05
KNAG0D021208.144ON402501098e-05
YER130C8.144ON443481099e-05
Ecym_1383na 2ON381641089e-05
SAKL0H04070g4.214ON899691091e-04
Ecym_62951.326ON663611081e-04
Ecym_54242.162ON775541081e-04
NDAI0B019308.144ON436481071e-04
KAFR0B025508.234ON890531081e-04
SAKL0F01980g3.518ON385751071e-04
YPL230W (USV1)6.256ON391471071e-04
Kpol_1052.83.298ON386671061e-04
Suva_16.766.256ON392521061e-04
NDAI0G034208.144ON484541072e-04
KNAG0H011803.281ON254671042e-04
KLLA0F13046g8.425ON1379601072e-04
NCAS0C040708.144ON289711052e-04
Kpol_1001.14.351ON1341451072e-04
KLLA0F20636gsingletonON285501042e-04
NCAS0F009202.531ON354611052e-04
TBLA0G032403.298ON511561052e-04
Smik_6.4356.256ON386471052e-04
TBLA0F038308.234ON967581053e-04
NCAS0F00910singletonON350521043e-04
Skud_16.486.256ON398471043e-04
TBLA0E047704.351ON1655471053e-04
Skud_13.3486.256ON216571013e-04
TDEL0F026904.80ON350611033e-04
Suva_13.3636.256ON211571013e-04
ZYRO0B07568g4.214ON616651043e-04
SAKL0G18062g4.351ON1238591053e-04
YMR182C (RGM1)6.256ON211571014e-04
CAGL0L11880g8.234ON980581044e-04
Kpol_1072.582.162ON794651044e-04
SAKL0E10714g2.162ON819531044e-04
Smik_13.3876.256ON212571014e-04
TPHA0A04530singletonON501551034e-04
ADR308Cna 3ON278501024e-04
CAGL0E04884g8.425ON1489451044e-04
SAKL0H12958g8.425ON1129631044e-04
NDAI0D037504.80ON493561034e-04
Ecym_8011na 3ON276501015e-04
NCAS0A062504.351ON1341601035e-04
KAFR0B021608.144ON453481025e-04
KNAG0G018708.234ON875531035e-04
TBLA0I027004.214ON737581035e-04
Kpol_541.398.116ON291501016e-04
AER159C4.351ON1191591036e-04
Ecym_1475na 4ON349771016e-04
ZYRO0B11770g8.234ON867581026e-04
Suva_13.704.351ON777571026e-04
KNAG0M003504.351ON1076581026e-04
KLLA0B04477g4.351ON1332591026e-04
TBLA0B060502.303ON762351027e-04
KLTH0D18062g4.351ON1128521027e-04
Kwal_47.166214.351ON1178521027e-04
CAGL0L05786g8.116ON348551017e-04
TPHA0A019408.234ON912581027e-04
ZYRO0A09416g8.425ON1346571027e-04
KAFR0E042704.351ON1255541027e-04
NCAS0G012706.256ON27451998e-04
KNAG0I020702.162ON572481018e-04
NCAS0B069602.162ON839611018e-04
AGR172W8.425ON1057631019e-04
CAGL0E06116g6.256ON613471019e-04
Kwal_47.178882.162ON786531010.001
CAGL0H04213g4.351ON1321471010.001
ZYRO0B14894g4.351ON1119451010.001
KLTH0E09724g2.162ON768531000.001
KAFR0B068104.351ON1155541010.001
NDAI0J028504.351ON1537541010.001
TBLA0I032803.518ON33060990.001
NDAI0D032404.351ON1362451010.001
TBLA0B012802.162ON823661000.001
CAGL0M01870g3.298ON31559980.001
TDEL0A013008.234ON837581000.001
Kpol_1032.528.234ON824581000.001
NDAI0C048608.425ON1350581000.001
NCAS0C042308.117ON33866980.001
KLTH0G14454g8.234ON832581000.001
Kpol_472.104.214ON830681000.001
Kwal_56.234538.234ON828581000.001
Smik_4.3378.234ON89458990.002
TDEL0D006704.351ON119947990.002
NCAS0B05750singletonON50556980.002
YDR096W (GIS1)8.234ON89458990.002
SAKL0H20416g8.116ON31761970.002
Kwal_23.54007.543ON42956980.002
KLTH0D06798g2.531ON11163910.002
TBLA0E04210singletonON45450980.002
Skud_4.3548.234ON91658980.002
TPHA0G002707.543ON47253980.002
NDAI0A075403.298ON37058970.002
Suva_2.2558.234ON89458980.002
ADL051Wna 5ON17366940.002
KAFR0C003403.298ON39461970.002
TPHA0C021608.425ON137550980.002
Smik_13.584.351ON125345980.002
KAFR0C029808.144ON22548950.002
Skud_13.614.351ON125345980.002
KNAG0C060305.586ON31465960.002
TPHA0G008202.303ON53251970.002
AEL174W1.326ON66160980.002
YML081W (TDA9)4.351ON125145980.002
Kpol_529.138.425ON141045980.002
YPR013C8.116ON31757960.002
AFR580C4.214ON83865970.002
CAGL0A01628g4.80ON42458960.003
AGR117C8.234ON79958970.003
KAFR0C031408.117ON37050960.003
TPHA0B029102.162ON71754970.003
SAKL0H17842g8.234ON81458970.003
NCAS0I014603.298ON33057960.003
SAKL0E07216g2.303ON54851970.003
Ecym_26543.281ON25763950.003
KLLA0F23782g2.162ON78252970.003
KAFR0C04550singletonON46753960.003
Kwal_14.22068.117ON25452940.003
CAGL0J01595g8.117ON34457950.003
Ecym_27604.214ON93865970.003
KLTH0G10802g2.303ON52655960.003
NCAS0B028408.425ON115250970.003
KAFR0B063608.425ON62760960.003
TDEL0F055008.425ON120745970.003
AEL077Wna 2ON33651950.003
SAKL0A10582gsingletonON28855950.003
TDEL0E015904.214ON77070960.003
KNAG0B067104.351ON105345960.003
Ecym_4128na 6ON31248950.003
KLLA0B07909g4.214ON92268960.003
KAFR0B045802.162ON72948960.003
TDEL0B052502.162ON71447960.003
SAKL0H20988g4.80ON54865960.004
TPHA0F018102.162ON42548950.004
TPHA0A039103.298ON35155950.004
YOR113W (AZF1)2.162ON91450960.004
TBLA0F013001.326ON98550960.004
Suva_2.2003.281ON23255930.004
Ecym_8379na 7ON30558940.004
SAKL0A09438g2.531ON44151950.004
TBLA0E042208.234ON51950950.004
KLLA0E08713g2.303ON59635950.004
KNAG0B005903.518ON43959950.004
Suva_7.2404.80ON51556950.004
TDEL0F011708.116ON16250910.004
ZYRO0B16148g2.162ON93050950.004
Skud_15.2762.162ON91750950.004
KNAG0G011408.117ON51954950.004
NDAI0B042902.162ON106451960.004
NDAI0I009906.256ON40947940.004
KNAG0H019302.303ON61851950.004
Skud_8.555.586ON53576950.004
Smik_15.2912.162ON90950950.005
Kwal_27.109253.281ON26456930.005
KNAG0H034802.162ON79646950.005
KAFR0F036004.80ON33556930.005
Kpol_495.20singletonON48659940.005
Smik_16.4507.543ON43252940.005
AGR186Cna 6ON28748930.005
CAGL0K12078g3.281ON46355940.005
NDAI0B060203.518ON42650940.005
ADL198W2.303ON54751940.005
YPR186C (PZF1)7.543ON42952940.005
YDR216W (ADR1)8.425ON132354950.005
KLLA0B03454g7.543ON47258940.005
TBLA0I020603.298ON83352940.005
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_13.246
         (419 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...   264   1e-83
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...   221   1e-66
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...   220   2e-66
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...   213   1e-63
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...   130   3e-32
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...   122   6e-30
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...   112   3e-28
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...   110   7e-27
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...   113   1e-26
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...   108   6e-25
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...   102   9e-25
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...   107   1e-24
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...   108   1e-24
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...   103   1e-23
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...   101   4e-23
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...   103   5e-23
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...   101   7e-23
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...   102   7e-23
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...   102   8e-23
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...   102   1e-22
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...    99   4e-22
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...    91   4e-19
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...    91   7e-19
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       84   8e-18
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    77   1e-14
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    73   1e-13
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    60   4e-09
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     57   6e-08
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    56   7e-08
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    56   1e-07
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    55   1e-07
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    55   2e-07
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    55   2e-07
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    55   2e-07
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    55   2e-07
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     55   2e-07
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    54   3e-07
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    54   4e-07
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    54   5e-07
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    54   5e-07
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    54   7e-07
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    53   7e-07
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    53   8e-07
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    53   8e-07
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    53   1e-06
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    53   1e-06
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    52   1e-06
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    52   1e-06
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    52   1e-06
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    52   1e-06
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    52   1e-06
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    52   2e-06
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    52   2e-06
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    52   2e-06
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    52   2e-06
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    51   3e-06
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    51   3e-06
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    51   3e-06
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    51   3e-06
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    50   3e-06
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    51   4e-06
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    50   4e-06
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    50   4e-06
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    49   4e-06
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    50   5e-06
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    50   8e-06
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    49   1e-05
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    49   1e-05
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    49   2e-05
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    48   2e-05
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    49   2e-05
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    46   2e-05
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    48   2e-05
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    49   3e-05
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    48   3e-05
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    47   4e-05
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    48   4e-05
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    48   4e-05
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    48   4e-05
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    47   5e-05
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    47   5e-05
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    47   6e-05
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}             47   6e-05
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    47   6e-05
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    46   7e-05
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    47   8e-05
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    47   9e-05
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    46   9e-05
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    47   1e-04
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    46   1e-04
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    46   1e-04
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     46   1e-04
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    46   1e-04
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    46   1e-04
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    46   1e-04
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    45   1e-04
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    45   1e-04
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    46   2e-04
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    45   2e-04
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    46   2e-04
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      45   2e-04
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    46   2e-04
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    45   2e-04
NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531     45   2e-04
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     45   2e-04
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    45   2e-04
TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.2...    45   3e-04
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}               45   3e-04
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    45   3e-04
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    45   3e-04
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    44   3e-04
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    44   3e-04
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    44   3e-04
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    45   3e-04
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    45   3e-04
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    44   4e-04
CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} som...    45   4e-04
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    45   4e-04
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    45   4e-04
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    44   4e-04
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             44   4e-04
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    44   4e-04
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    45   4e-04
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    45   4e-04
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      44   4e-04
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    44   5e-04
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    44   5e-04
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    44   5e-04
KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.2...    44   5e-04
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    44   5e-04
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    44   6e-04
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    44   6e-04
Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar t...    44   6e-04
ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} simila...    44   6e-04
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    44   6e-04
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    44   6e-04
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    44   6e-04
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    44   7e-04
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    44   7e-04
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    44   7e-04
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    44   7e-04
TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {O...    44   7e-04
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    44   7e-04
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    44   7e-04
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      43   8e-04
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    44   8e-04
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    44   8e-04
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    44   9e-04
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    44   9e-04
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    44   0.001
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    44   0.001
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    44   0.001
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    43   0.001
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    44   0.001
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    44   0.001
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    43   0.001
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    44   0.001
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    43   0.001
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    42   0.001
TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {O...    43   0.001
Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON} (1181...    43   0.001
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    43   0.001
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               42   0.001
KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some...    43   0.001
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    43   0.001
Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {...    43   0.001
Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W ...    43   0.002
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    43   0.002
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    42   0.002
YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC d...    43   0.002
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    42   0.002
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    42   0.002
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    40   0.002
TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON}             42   0.002
Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W ...    42   0.002
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    42   0.002
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    42   0.002
Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W ...    42   0.002
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    41   0.002
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    42   0.002
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    42   0.002
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    42   0.002
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    41   0.002
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    42   0.002
KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5....    42   0.002
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    42   0.002
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    42   0.002
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    42   0.002
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    42   0.002
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    42   0.002
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    42   0.002
CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} simila...    42   0.003
AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON} S...    42   0.003
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               42   0.003
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    42   0.003
SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]...    42   0.003
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    42   0.003
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    42   0.003
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    41   0.003
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    42   0.003
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               42   0.003
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    41   0.003
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    41   0.003
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    42   0.003
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    42   0.003
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    42   0.003
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    42   0.003
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    42   0.003
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    41   0.003
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    41   0.003
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    42   0.003
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    42   0.003
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    41   0.003
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    42   0.003
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    42   0.003
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    42   0.003
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    42   0.004
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    41   0.004
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    41   0.004
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    42   0.004
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    42   0.004
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    40   0.004
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    41   0.004
SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...    41   0.004
TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON} Anc_8...    41   0.004
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    41   0.004
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    41   0.004
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    41   0.004
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    40   0.004
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    41   0.004
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    41   0.004
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    41   0.004
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    42   0.004
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    41   0.004
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    41   0.004
Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W (...    41   0.004
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    41   0.005
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    40   0.005
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    41   0.005
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    40   0.005
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    41   0.005
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    41   0.005
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    40   0.005
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    41   0.005
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    41   0.005
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    41   0.005
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    41   0.005
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    41   0.005
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    41   0.005
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     41   0.005
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    41   0.006
Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa] ...    41   0.006
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    40   0.006
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    41   0.006
YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC d...    41   0.006
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    40   0.006
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    40   0.006
Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W ...    41   0.006
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    41   0.006
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    40   0.006
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    41   0.006
Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa...    41   0.006
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    40   0.006
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    40   0.006
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    41   0.007
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    40   0.007
Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W ...    41   0.007
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    40   0.007
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    40   0.007
AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if...    40   0.007
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    39   0.007
KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some ...    40   0.007
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    40   0.007
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    41   0.007
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    41   0.007
KAFR0A02380 Chr1 complement(493691..496393) [2703 bp, 900 aa] {O...    40   0.007
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    40   0.007
TPHA0J00670 Chr10 complement(148901..150883) [1983 bp, 660 aa] {...    40   0.007
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    40   0.007
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    40   0.008
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    40   0.008
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    40   0.008
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    40   0.008
CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some ...    40   0.008
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    40   0.008
Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W (...    40   0.008
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    39   0.008
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    40   0.008
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    40   0.008
YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}...    40   0.008
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    39   0.008
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    40   0.008
KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} simi...    40   0.008
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    40   0.009
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    40   0.009
KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {O...    40   0.009
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    40   0.009
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    40   0.009
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    40   0.009
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    40   0.009
Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {O...    39   0.010
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    40   0.010
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    40   0.010
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    40   0.010
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    40   0.010
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      40   0.011
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    39   0.011
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    40   0.011
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    40   0.012
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    39   0.012
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     40   0.012
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    38   0.012
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    39   0.012
TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON...    40   0.013
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    40   0.013
NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8....    40   0.013
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    40   0.013
ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} simi...    40   0.014
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    39   0.014
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                39   0.014
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    40   0.014
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    39   0.015
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    40   0.015
TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON} Anc_2...    39   0.015
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    40   0.015
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    39   0.016
Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}...    39   0.016
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    39   0.016
KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5....    39   0.016
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               39   0.017
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    39   0.017
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    39   0.018
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    39   0.019
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    39   0.019
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    39   0.019
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    39   0.019
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    39   0.019
CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some s...    39   0.020
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    39   0.020
TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON...    39   0.021
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    39   0.021
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    39   0.022
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    39   0.022
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    38   0.022
YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}  STP1Tran...    39   0.023
KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {...    39   0.023
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                38   0.023
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    38   0.023
KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some ...    39   0.024
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    39   0.024
Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)    39   0.025
KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...    39   0.025
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    37   0.026
TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.5...    39   0.026
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    38   0.027
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    39   0.027
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    38   0.028
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    39   0.029
KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON} Anc_5...    39   0.029
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    38   0.030
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    38   0.030
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               39   0.030
NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {O...    39   0.031
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    37   0.031
ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {O...    38   0.031
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    38   0.031
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    38   0.032
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    38   0.032
KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {...    39   0.032
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    38   0.033
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    38   0.034
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    38   0.036
NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234     39   0.036
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    38   0.037
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    38   0.039
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    38   0.040
KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakl...    38   0.041
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    38   0.042
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    38   0.042
KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.2...    38   0.047
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    38   0.047
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    38   0.048
YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}  STP2Transc...    38   0.048
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}       35   0.050
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    38   0.050
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    38   0.051
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    37   0.059
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    37   0.060
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    37   0.062
Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463...    37   0.062
SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON} unipro...    37   0.064
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    37   0.065
Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463...    37   0.067
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                37   0.068
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    37   0.068
Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463...    37   0.070
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    37   0.071
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    37   0.076
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    37   0.078
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    37   0.078
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    37   0.081
NCAS0D03910 Chr4 (729305..730255) [951 bp, 316 aa] {ON} Anc_6.256      37   0.084
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    37   0.084
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    37   0.084
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    35   0.087
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    37   0.087
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    37   0.088
SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar...    36   0.089
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    36   0.090
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    37   0.090
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    37   0.093
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    37   0.094
TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4....    37   0.096
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    37   0.098
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    37   0.099
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    37   0.10 
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    37   0.11 
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    36   0.11 
NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa] ...    36   0.12 
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    36   0.12 
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      36   0.12 
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     36   0.13 
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    36   0.13 
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    36   0.13 
NDAI0I03330 Chr9 complement(781013..782065) [1053 bp, 350 aa] {O...    36   0.13 
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    36   0.13 
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    37   0.13 
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    37   0.13 
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    37   0.14 
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    36   0.14 
NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586     36   0.14 
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    36   0.15 
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     36   0.15 
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    36   0.16 
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    36   0.16 
TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.3...    36   0.16 
Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}...    35   0.18 
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    35   0.18 
Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}...    36   0.19 
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    36   0.19 
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    36   0.19 
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    35   0.20 
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    36   0.20 
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    35   0.20 
NCAS0B04020 Chr2 complement(726291..727118) [828 bp, 275 aa] {ON}      35   0.21 
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    36   0.22 
YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}  N...    35   0.23 
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    35   0.23 
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    36   0.25 
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    35   0.25 
Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {O...    35   0.26 
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    35   0.26 
TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}                35   0.26 
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...    35   0.26 
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    35   0.27 
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    35   0.29 
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    35   0.30 
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    35   0.31 
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    35   0.32 
SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some s...    35   0.34 
Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {O...    35   0.36 
CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly...    35   0.37 
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    35   0.37 
Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}...    34   0.37 
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    35   0.38 
YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON} P...    34   0.39 
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    35   0.39 
NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {O...    35   0.39 
KLLA0E13487g Chr5 complement(1190615..1191307) [693 bp, 230 aa] ...    34   0.39 
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    35   0.40 
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    35   0.41 
Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON} co...    35   0.48 
AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}...    35   0.50 
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    35   0.56 
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    34   0.58 
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    34   0.59 
TPHA0C01760 Chr3 (402424..402939) [516 bp, 171 aa] {ON} Anc_8.48...    33   0.60 
TBLA0D02300 Chr4 (581398..584553) [3156 bp, 1051 aa] {ON} Anc_8....    34   0.61 
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    34   0.65 
TDEL0B01500 Chr2 (265906..266292) [387 bp, 128 aa] {ON} Anc_8.48...    33   0.67 
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    34   0.67 
NDAI0J00160 Chr10 (19695..21068) [1374 bp, 457 aa] {ON} Anc_7.543      34   0.68 
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    34   0.69 
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                33   0.71 
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    34   0.71 
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    33   0.75 
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    33   0.87 
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    33   0.88 
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    34   0.91 
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    34   0.93 
NCAS0E00170 Chr5 (20556..21539) [984 bp, 327 aa] {ON}                  33   0.99 
CAGL0I02838g Chr9 complement(248704..250671) [1968 bp, 655 aa] {...    33   1.00 
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    34   1.0  
KNAG0I00130 Chr9 (10977..11972) [996 bp, 331 aa] {ON}                  33   1.1  
AFL136W Chr6 (178780..180009) [1230 bp, 409 aa] {ON} Syntenic ho...    33   1.1  
ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic hom...    33   1.1  
KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} simila...    33   1.2  
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    33   1.2  
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    33   1.2  
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    33   1.2  
NCAS0B04360 Chr2 (791449..792276) [828 bp, 275 aa] {ON}                33   1.2  
TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.3...    33   1.3  
CAGL0H07557g Chr8 (738086..739516) [1431 bp, 476 aa] {ON} some s...    33   1.4  
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    32   1.4  
TDEL0E01860 Chr5 (353978..354790) [813 bp, 270 aa] {ON} Anc_4.18...    33   1.4  
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    33   1.4  
Ecym_2536 Chr2 complement(1041642..1042364) [723 bp, 240 aa] {ON...    33   1.5  
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    33   1.6  
KNAG0A02260 Chr1 (205510..206118) [609 bp, 202 aa] {ON} Anc_8.48...    32   1.6  
CAGL0L12562g Chr12 complement(1353174..1353845) [672 bp, 223 aa]...    32   1.6  
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    33   1.6  
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    33   1.6  
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    33   1.7  
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    32   1.8  
NCAS0J02140 Chr10 complement(410960..415012) [4053 bp, 1350 aa] ...    33   1.8  
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    32   1.8  
TPHA0L01320 Chr12 complement(275431..275937) [507 bp, 168 aa] {O...    32   1.9  
CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some s...    33   1.9  
TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8....    33   1.9  
TDEL0H00280 Chr8 (38901..40175) [1275 bp, 424 aa] {ON} Anc_7.543...    33   2.0  
Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {...    33   2.0  
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    32   2.1  
YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}  ...    32   2.1  
NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326     33   2.1  
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    32   2.1  
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    33   2.2  
KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.3...    33   2.2  
CAGL0L00583g Chr12 (71544..72710) [1167 bp, 388 aa] {ON} similar...    32   2.3  
Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {...    33   2.3  
Kwal_27.10167 s27 (225940..226797) [858 bp, 285 aa] {ON} YGL254W...    32   2.4  
Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON...    32   2.4  
Kwal_27.11824 s27 complement(959535..960134) [600 bp, 199 aa] {O...    32   2.7  
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    32   2.8  
NDAI0E03120 Chr5 (662597..663316) [720 bp, 239 aa] {ON} Anc_8.48...    32   2.9  
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    32   2.9  
ZYRO0D00902g Chr4 (68162..69379) [1218 bp, 405 aa] {ON} similar ...    32   2.9  
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    32   3.1  
TBLA0A00350 Chr1 complement(66653..67588) [936 bp, 311 aa] {ON} ...    32   3.1  
NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {O...    32   3.2  
KLTH0G17336g Chr7 (1500141..1501598) [1458 bp, 485 aa] {ON} some...    32   3.2  
YDR253C Chr4 complement(963990..964565) [576 bp, 191 aa] {ON}  M...    31   3.3  
KLLA0D11902g Chr4 (1015273..1016142) [870 bp, 289 aa] {ON} some ...    32   3.6  
Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W...    31   3.8  
Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to...    31   4.1  
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    32   4.2  
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    31   4.5  
KNAG0D04020 Chr4 complement(726098..727558) [1461 bp, 486 aa] {O...    32   4.5  
Smik_4.500 Chr4 complement(908879..909460) [582 bp, 193 aa] {ON}...    31   5.1  
KAFR0F03940 Chr6 complement(769153..770511) [1359 bp, 452 aa] {O...    31   5.1  
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    30   5.1  
Kpol_489.4 s489 (17106..18125) [1020 bp, 339 aa] {ON} (17106..18...    31   5.4  
Suva_2.419 Chr2 complement(743569..744144) [576 bp, 191 aa] {ON}...    30   5.4  
AGL246W Chr7 (240857..241540) [684 bp, 227 aa] {ON} Syntenic hom...    31   5.8  
KLLA0F22319g Chr6 complement(2086613..2087224) [612 bp, 203 aa] ...    30   5.8  
KLLA0E00793g Chr5 (80516..82069) [1554 bp, 517 aa] {ON} weakly s...    31   6.0  
KAFR0J02980 Chr10 complement(567857..568816) [960 bp, 319 aa] {O...    31   6.1  
YPR022C Chr16 complement(603911..607312) [3402 bp, 1133 aa] {ON}...    31   6.4  
Suva_16.349 Chr16 complement(610937..612562) [1626 bp, 541 aa] {...    31   6.8  
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    31   6.8  
Skud_4.515 Chr4 complement(918500..919063) [564 bp, 187 aa] {ON}...    30   6.9  
Kpol_543.29 s543 complement(59228..60583) [1356 bp, 451 aa] {ON}...    31   7.0  
NCAS0A02160 Chr1 complement(406753..407991) [1239 bp, 412 aa] {O...    31   7.2  
KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {O...    30   7.2  
ZYRO0A12936g Chr1 complement(1023335..1024135) [801 bp, 266 aa] ...    30   7.7  
NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326     31   8.1  
NCAS0C02430 Chr3 (453975..454574) [600 bp, 199 aa] {ON} Anc_8.486      30   8.3  
Ecym_6216 Chr6 (406161..407630) [1470 bp, 489 aa] {ON} similar t...    30   9.3  
Smik_16.263 Chr16 complement(479612..482980) [3369 bp, 1122 aa] ...    30   10.0 

>Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070W
           (REAL)
          Length = 419

 Score =  264 bits (674), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 130/166 (78%)

Query: 254 DQFQFQLQQNGSPNLNMSMNQAQPLHLPPGWKINTMPQPHPAXXXXXXXXXXXXXXXXXX 313
           DQFQFQLQQNGSPNLNMSMNQAQPLHLPPGWKINTMPQPHPA                  
Sbjct: 254 DQFQFQLQQNGSPNLNMSMNQAQPLHLPPGWKINTMPQPHPAAASNHPPLPPQPPNSVAP 313

Query: 314 XXMPAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 373
             MPAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH
Sbjct: 314 NAMPAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 373

Query: 374 MKLKHTNYLLDELKKXXXXXXXXXXXXXXXXGRREQLRSEHQDFDQ 419
           MKLKHTNYLLDELKK                GRREQLRSEHQDFDQ
Sbjct: 374 MKLKHTNYLLDELKKNNIIFNYNNSNTTSNSGRREQLRSEHQDFDQ 419

 Score =  172 bits (436), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 106/183 (57%), Positives = 106/183 (57%)

Query: 1   MNADHHLXXXXXXHTILQNAPNNISAGADPLTSRTFNASVASSSNKDDVIVNPNTRELPM 60
           MNADHHL      HTILQNAPNNISAGADPLTSRTFNASVASSSNKDDVIVNPNTRELPM
Sbjct: 1   MNADHHLQQQQQQHTILQNAPNNISAGADPLTSRTFNASVASSSNKDDVIVNPNTRELPM 60

Query: 61  PLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIIHSNSNAPATDFGGAGGPXXXXXXX 120
           PLH                              PIIHSNSNAPATDFGGAGGP       
Sbjct: 61  PLHQQQYIYPYYQYSNNNNNSSNVAAANNTSASPIIHSNSNAPATDFGGAGGPNNNNTTT 120

Query: 121 XXXXXXXXXXIHXXXXXXXXXXXXXXXXXXXXXXXXFPNSNIPIPQQDQPYMFNPASYIN 180
                     IH                        FPNSNIPIPQQDQPYMFNPASYIN
Sbjct: 121 TTTTNNNTNNIHTNQYAAATTANMNANAAAAAAYYAFPNSNIPIPQQDQPYMFNPASYIN 180

Query: 181 HYY 183
           HYY
Sbjct: 181 HYY 183

>YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}
           MOT3Transcriptional repressor and activator with two
           C2-H2 zinc fingers; involved in repression of a subset
           of hypoxic genes by Rox1p, repression of several DAN/TIR
           genes during aerobic growth, and repression of
           ergosterol biosynthetic genes in response to
           hyperosmotic stress; contributes to recruitment of the
           Tup1p-Cyc8p general repressor to promoters; involved in
           positive transcriptional regulation of CWP2 and other
           genes; can form the [MOT3+] prion
          Length = 490

 Score =  221 bits (563), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 106/135 (78%), Positives = 110/135 (81%)

Query: 254 DQFQFQLQQNGSPNLNMSMNQAQPLHLPPGWKINTMPQPHPAXXXXXXXXXXXXXXXXXX 313
           DQFQFQLQQN SPNLN+++N AQPLHLPPGWKINTMPQP P                   
Sbjct: 273 DQFQFQLQQNPSPNLNLNINPAQPLHLPPGWKINTMPQPRPTTAPNHPPAPVPSSNPVAS 332

Query: 314 XXMPAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 373
             +PAPSSD KYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH
Sbjct: 333 NLVPAPSSDHKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 392

Query: 374 MKLKHTNYLLDELKK 388
           MKLKHTNYLLDELKK
Sbjct: 393 MKLKHTNYLLDELKK 407

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 74/175 (42%), Gaps = 10/175 (5%)

Query: 15  TILQNAPNNISAGADPLTSRTFNASVASSSNKDDVIVNPNTRELPMPLHXXXXXXXXXXX 74
           TILQN  N  + G+D L S+ FN +  SS NKDDV+VN   RELPMPLH           
Sbjct: 37  TILQNVSNTNNIGSDSLASQPFNTTTVSS-NKDDVMVNSGARELPMPLHQQQYIYPYYQY 95

Query: 75  XXXXXXXXXXXXXXXXXXXPIIH------SNSNAPATDFGGAGGPXXXXXXXXXXXXXXX 128
                              PI+H      +NSN  A+D+  A                  
Sbjct: 96  TSNNSNNNNVTAGNNMSASPIVHNNSNNSNNSNISASDYTVANNSTSNNNNNNNNNNNNN 155

Query: 129 XXIHXXXXXXXXXXXXXXXXXXXXXXXXFPNSNIPIPQQDQPYMFNPASYINHYY 183
             IH                        FP +N+PIPQQDQ YMFNPASYI+HYY
Sbjct: 156 NNIH---PNQFTAAANMNSNAAAAAYYSFPTANMPIPQQDQQYMFNPASYISHYY 207

>Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 aa]
           {ON} YMR070W (REAL)
          Length = 473

 Score =  220 bits (561), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 105/135 (77%), Positives = 109/135 (80%)

Query: 254 DQFQFQLQQNGSPNLNMSMNQAQPLHLPPGWKINTMPQPHPAXXXXXXXXXXXXXXXXXX 313
           DQFQFQLQQN   NLN+++N AQPLHLPPGWKINTMPQPHPA                  
Sbjct: 265 DQFQFQLQQNHPSNLNLNINPAQPLHLPPGWKINTMPQPHPATTPNHPPAPVPPSNSVAL 324

Query: 314 XXMPAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 373
             + APSSD KYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH
Sbjct: 325 NSVTAPSSDHKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 384

Query: 374 MKLKHTNYLLDELKK 388
           MKLKHTNYLLDELKK
Sbjct: 385 MKLKHTNYLLDELKK 399

 Score = 81.3 bits (199), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 69/168 (41%), Gaps = 4/168 (2%)

Query: 16  ILQNAPNNISAGADPLTSRTFNASVASSSNKDDVIVNPNTRELPMPLHXXXXXXXXXXXX 75
           ILQN PN  + G +P  S+ FN + ++SSNKDDV VN   RELPMPLH            
Sbjct: 38  ILQNVPNTTNVGNEPQASQPFNPT-STSSNKDDVTVNSGARELPMPLHQQQYIYPYYQYT 96

Query: 76  XXXXXXXXXXXXXXXXXXPIIHSNSNAPATDFGGAGGPXXXXXXXXXXXXXXXXXIHXXX 135
                             PI+H+NSN        A                    IH   
Sbjct: 97  GNASGNNNAAAGNNTSASPIVHNNSNNSNNSNIAAAPDYTAVNSNTSNNSNNNNNIH--- 153

Query: 136 XXXXXXXXXXXXXXXXXXXXXFPNSNIPIPQQDQPYMFNPASYINHYY 183
                                FP +N+PIPQQDQ YMFNPASYI HYY
Sbjct: 154 TNQFAAAANINTSAAAAAYYTFPTANMPIPQQDQQYMFNPASYIGHYY 201

>Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)
           [1428 bp, 475 aa] {ON} YMR070W (REAL)
          Length = 475

 Score =  213 bits (542), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 107/135 (79%)

Query: 254 DQFQFQLQQNGSPNLNMSMNQAQPLHLPPGWKINTMPQPHPAXXXXXXXXXXXXXXXXXX 313
           DQFQFQLQQN   +LN+++N AQPLHLPPGWK+NTMPQPHPA                  
Sbjct: 255 DQFQFQLQQNAPSSLNLNINPAQPLHLPPGWKVNTMPQPHPAAPSNHPSVAAPPSNSVAL 314

Query: 314 XXMPAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 373
             +P  SS  +YIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH
Sbjct: 315 HALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 374

Query: 374 MKLKHTNYLLDELKK 388
           MKLKHTNYLLDELKK
Sbjct: 375 MKLKHTNYLLDELKK 389

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 38/49 (77%), Gaps = 1/49 (2%)

Query: 15 TILQNAPNNISAGADPLTSRTFNASVASSSNKDDVIVNPNTRELPMPLH 63
          TILQN PN  + GAD L S+ FNA+ A SSNK+DV+VNP  RELPMPLH
Sbjct: 32 TILQNVPNTNNVGADLLASQHFNAT-AVSSNKEDVMVNPGGRELPMPLH 79

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (88%)

Query: 157 FPNSNIPIPQQDQPYMFNPASYINHYY 183
           FP SN+PIPQQ+Q YMFNPASYI HYY
Sbjct: 164 FPPSNMPIPQQEQQYMFNPASYIGHYY 190

>KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa]
           {ON} Anc_2.533 YMR070W
          Length = 554

 Score =  130 bits (326), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 55/68 (80%), Positives = 61/68 (89%)

Query: 320 SSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHT 379
           SS   +IH+C  CEKSFKR+SWLKRHLLSHS +RH+LCPWCLSR KRKDNLLQHMKLKH+
Sbjct: 429 SSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHS 488

Query: 380 NYLLDELK 387
           NYLLDELK
Sbjct: 489 NYLLDELK 496

>KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.533
           YMR070W
          Length = 490

 Score =  122 bits (306), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 52/63 (82%), Positives = 56/63 (88%)

Query: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 385
           IH C  CEKSF+RKSWLKRHLLSHS +R FLCPWCLSR KRKDNLLQHMKLKH+NYL+ E
Sbjct: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIE 411

Query: 386 LKK 388
           LKK
Sbjct: 412 LKK 414

>TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.533
           YMR070W
          Length = 239

 Score =  112 bits (281), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 56/65 (86%)

Query: 323 QKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYL 382
           Q Y+H+C  C KSFKRKSWL+RHLLSHS  RHF CPWCLS+ KRKDNLLQHMKLKHT+Y+
Sbjct: 130 QGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYV 189

Query: 383 LDELK 387
           L EL+
Sbjct: 190 LQELR 194

>ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 294

 Score =  110 bits (275), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 54/61 (88%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 386
           H C  C+KSFKRKSWL+RHLLSHS +RHF CPWCLS+ KRKDNLLQHMKLKHT Y+L++L
Sbjct: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL 251

Query: 387 K 387
           +
Sbjct: 252 R 252

>NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {ON}
           Anc_2.533
          Length = 541

 Score =  113 bits (283), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 55/61 (90%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 386
           ++C+ CEK FKR+SWLKRHLLSHS +RH+LCPWCLSR KR+DNLLQHMKLKH N L++EL
Sbjct: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459

Query: 387 K 387
           K
Sbjct: 460 K 460

>TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.533
           YMR070W
          Length = 513

 Score =  108 bits (269), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 58/72 (80%)

Query: 317 PAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           P  + +Q  I QC  CEKSFKRKSWLKRHLLSHS++R+F CP CLS+ KRKDNL+QH+KL
Sbjct: 330 PQSAINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389

Query: 377 KHTNYLLDELKK 388
           KH +Y+L +L K
Sbjct: 390 KHLDYILKKLNK 401

>TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.533
           YMR070W
          Length = 216

 Score =  102 bits (255), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 56/68 (82%)

Query: 320 SSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHT 379
           S ++   H+C  CEK FKRKSWLKRH+LSHS++R + CPWC+SR KRKDNLLQHMKLKHT
Sbjct: 106 SMNEMAYHKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPWCISRHKRKDNLLQHMKLKHT 165

Query: 380 NYLLDELK 387
           + +L +LK
Sbjct: 166 DEVLKKLK 173

>NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {ON}
           Anc_2.533
          Length = 525

 Score =  107 bits (268), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%)

Query: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 385
           ++ C  C K+FKR+SWLKRHLLSHS +RH+ CPWCLSR KR+DNLLQHMKLKH+  L++E
Sbjct: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINE 446

Query: 386 LK 387
           LK
Sbjct: 447 LK 448

>CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakly
           similar to uniprot|P54785 Saccharomyces cerevisiae
           YMR070w MOT3
          Length = 647

 Score =  108 bits (269), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 50/60 (83%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 386
           H+C  C K FKRKSWLKRHLLSHSQQRHFLCPWC SR KR+DNLLQHMKLKH   LL E+
Sbjct: 534 HRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPWCNSRHKRRDNLLQHMKLKHVPNLLQEI 593

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score =  103 bits (256), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 50/65 (76%)

Query: 324 KYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLL 383
           KYI +C  C K FKRKSWLKRHLLSHS  R + CPWCLS+ KRKDNLLQHMKLKH   +L
Sbjct: 251 KYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVL 310

Query: 384 DELKK 388
            E+ K
Sbjct: 311 QEMDK 315

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score =  101 bits (252), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 50/61 (81%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 386
           HQC  C+KSFKRKSWLKRHLLSHS  + F CPWC SR KRKDNLLQHMKLKHT  +L EL
Sbjct: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317

Query: 387 K 387
           +
Sbjct: 318 Q 318

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score =  103 bits (256), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 42/65 (64%), Positives = 52/65 (80%)

Query: 323 QKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYL 382
           + + H C  C K FKRKSWL+RHLLSHS +R+F CPWCLS+ KRKDNLLQHMKLKH   +
Sbjct: 473 KNFAHVCHICGKQFKRKSWLQRHLLSHSSERNFDCPWCLSKHKRKDNLLQHMKLKHAENV 532

Query: 383 LDELK 387
           L++L+
Sbjct: 533 LEQLR 537

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score =  101 bits (251), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%)

Query: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 385
           IH+C FCEK+FKRKSWLKRHLLSHS  + + CPWC SR KRKDNL QH+KLKH   LL+ 
Sbjct: 184 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 243

Query: 386 L 386
           L
Sbjct: 244 L 244

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score =  102 bits (254), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%)

Query: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 385
           IH+C FCEK+FKRKSWLKRHLLSHS  + + CPWC SR KRKDNL QH+KLKH   LL+ 
Sbjct: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 344

Query: 386 L 386
           L
Sbjct: 345 L 345

>NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {ON}
           Anc_2.533
          Length = 730

 Score =  102 bits (255), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 42/62 (67%), Positives = 52/62 (83%)

Query: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 385
           + QC +C KSFKR SWLKRHLL+HS +RH+ CPWCLS+ KRKDNLLQH+KLKHT  +L +
Sbjct: 559 VFQCSYCVKSFKRFSWLKRHLLAHSPERHYSCPWCLSKHKRKDNLLQHLKLKHTEMVLQQ 618

Query: 386 LK 387
           L+
Sbjct: 619 LR 620

>NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {ON}
           Anc_2.533
          Length = 511

 Score =  102 bits (253), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 55/67 (82%)

Query: 322 DQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNY 381
           D   ++QC  C KSF+R SWLKRHLL+HS QRH+ CP C+S+ KRKDNLLQH+KLKHT +
Sbjct: 382 DTPSVYQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCPKCVSKHKRKDNLLQHLKLKHTAF 441

Query: 382 LLDELKK 388
           +L++L++
Sbjct: 442 VLEQLRQ 448

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score = 99.4 bits (246), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 43/60 (71%), Positives = 47/60 (78%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 386
           +QC  CEK F+RKSWLKRHLLSHS  + F CPWC S  KRKDNLLQH+KLKHT YLL E 
Sbjct: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365

>KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 506

 Score = 90.9 bits (224), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 48/67 (71%)

Query: 320 SSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHT 379
            S    +++C  CEKSFKRKSW +RHLLSHS  + + CPWC SR KR+DNL QHMK KH 
Sbjct: 381 GSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHV 440

Query: 380 NYLLDEL 386
           + +L EL
Sbjct: 441 HQVLQEL 447

>Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W
           (MOT3) - 2 Cys2-His2 zinc fingers at c-terminus,
           glutamine and asparagine rich [contig 55] FULL
          Length = 507

 Score = 90.5 bits (223), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (76%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 386
           ++C  C+KSFKR+SW KRHLLSHS  + + CPWC SR KR+DNL QHMK KH  +++ EL
Sbjct: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 83.6 bits (205), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 48/63 (76%)

Query: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 385
           +++C  C K F+R++WL+RH LSH+  R+FLCPWC S+ KR+DNL +H+KLKH   L+  
Sbjct: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177

Query: 386 LKK 388
           +++
Sbjct: 178 IRE 180

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 40/53 (75%)

Query: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKH 378
            ++C+ C K+FKR SWLKRH  SHS+ ++F C WC  + KRKDNL+QH++ KH
Sbjct: 323 FYECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNWCSGKYKRKDNLVQHIRKKH 375

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (67%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELK 387
           C  C KSF+R +WLKRH ++H+    F C WC S  KR+DN+ +HMKLKH N L+  ++
Sbjct: 252 CPQCPKSFQRSAWLKRHSITHTNSHPFKCVWCKSEHKRRDNMFKHMKLKHMNLLMKVIR 310

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 321 SDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           SD+    +C+ C K+F+R   LKRH+ S HS +R F CP C  +  R DNL QH+K
Sbjct: 759 SDENKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQHIK 814

>NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598
          Length = 972

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 37/63 (58%), Gaps = 3/63 (4%)

Query: 322 DQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KH 378
           DQ    +C  CEK+F+R   LKRH  S HS +R F C +C  R  R DNL QH+K   KH
Sbjct: 910 DQNKPFKCSDCEKAFRRSEHLKRHFRSVHSAERPFGCMFCTKRFSRSDNLSQHLKTHKKH 969

Query: 379 TNY 381
            ++
Sbjct: 970 GDF 972

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 42/67 (62%), Gaps = 3/67 (4%)

Query: 318 APSSDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           +P+ +++   +CQ C K+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K 
Sbjct: 433 SPAEEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLKT 492

Query: 377 --KHTNY 381
             KH ++
Sbjct: 493 HKKHGDF 499

>YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}
           MSN4Transcriptional activator related to Msn2p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 630

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 3/57 (5%)

Query: 328 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 381
           +C+ CEK+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K   KH ++
Sbjct: 574 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 630

>Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062W
           (REAL)
          Length = 641

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 3/57 (5%)

Query: 328 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 381
           +C+ CEK+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K   KH ++
Sbjct: 585 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 641

>Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON}
           complement(4290..6233) [1944 nt, 648 aa]
          Length = 647

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 328 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 381
           +C  CEK+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K   KH ++
Sbjct: 591 KCTDCEKAFRRSEHLKRHIRSVHSSERPFACNYCEKKFSRSDNLSQHLKTHKKHGDF 647

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 3/67 (4%)

Query: 318 APSSDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           +P  +++   +CQ C K+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K 
Sbjct: 632 SPVEEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLKT 691

Query: 377 --KHTNY 381
             KH ++
Sbjct: 692 HKKHGDF 698

>Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062W
           (REAL)
          Length = 628

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 3/57 (5%)

Query: 328 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 381
           +C+ CEK+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K   KH ++
Sbjct: 572 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 628

>TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {ON}
           Anc_2.598 YMR037C
          Length = 746

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 328 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           +C  C K+F+R   LKRH+ S HS +R F C  CL +  R DNL QH+K
Sbjct: 690 KCDTCGKNFRRSEHLKRHIRSVHSMERPFSCDICLKKFSRSDNLSQHLK 738

>NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598
          Length = 769

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 322 DQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           D+    QC  C KSF+R   LKRH+ S HS++R F C  C  +  R DNL QH+K
Sbjct: 707 DENKPFQCDQCTKSFRRSEHLKRHVRSVHSKERPFACNLCEKKFSRSDNLSQHLK 761

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 328 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 381
           +C+ C K+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K   KH ++
Sbjct: 528 KCKECSKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 584

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 328 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 381
           +CQ C K+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K   KH ++
Sbjct: 621 KCQECTKAFRRSEHLKRHIRSVHSTERPFHCSYCDKKFSRSDNLSQHLKTHKKHGDF 677

>TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {ON}
           Anc_2.598 YMR037C
          Length = 523

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 328 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 381
           +C  CEK+F+R   LKRH+ S HS +R F C +C  R  R DNL QH+K   KH ++
Sbjct: 467 KCGQCEKAFRRSEHLKRHVRSVHSSERPFPCTFCDKRFSRSDNLSQHLKTHKKHGDF 523

>Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii ACL057W
          Length = 573

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (58%), Gaps = 2/70 (2%)

Query: 317 PAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           P+P+ D      C+FCE+ FKR+  LKRH+ S H  ++ + C  C  +  R DNL QH+K
Sbjct: 504 PSPALDATKPFGCEFCERRFKRQEHLKRHVRSLHMGEKPYGCDICGKKFSRSDNLNQHIK 563

Query: 376 LKHTNYLLDE 385
             HTN   D+
Sbjct: 564 -THTNGNFDD 572

>Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062W
           (REAL)
          Length = 639

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 329 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 381
           C+ C+K+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K   KH ++
Sbjct: 584 CKDCDKAFRRSEHLKRHIRSVHSAERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 639

>Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {ON}
           YMR037C (REAL)
          Length = 709

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 329 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           C  C KSFKR   LKRH+ S HS +R F C  C  +  R DNL QH+K
Sbjct: 654 CHICSKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 701

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 328 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           +CQ C K+F+R   LKRH+ S HS  R F C +C  +  R DNL QH+K
Sbjct: 505 KCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHLK 553

>Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii ABR089C
          Length = 767

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 319 PSSDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           P  +++   +CQ C K+F+R   LKRH+ S HS  R F C +C  +  R DNL QH+K
Sbjct: 690 PLDEEEKPFKCQECTKAFRRSEHLKRHIRSVHSTDRPFPCTYCDKKFSRSDNLSQHLK 747

>KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {ON}
           Anc_8.144 YER130C
          Length = 472

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 329 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 380
           C++C + FKR+  LKRH+LS H  ++ F CP C     R DNL QH+K  H+N
Sbjct: 402 CKYCPRKFKRQEHLKRHILSLHVGEKRFGCPICGKNFSRSDNLNQHIK-THSN 453

>CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa]
           {ON} weakly similar to uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 541

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 32/49 (65%), Gaps = 1/49 (2%)

Query: 328 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           QC  C+K+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K
Sbjct: 485 QCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHLK 533

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHF 355
           C FCEK F R   L +HL +H +   F
Sbjct: 515 CMFCEKKFSRSDNLSQHLKTHKRHGDF 541

>TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {ON}
           Anc_2.598 YMR037C
          Length = 519

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 328 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 381
           +C  CEK+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K   KH ++
Sbjct: 463 KCNNCEKAFRRSEHLKRHIRSVHSSERPFPCNYCEKKFSRSDNLSQHLKTHKKHGDF 519

>TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa]
           {ON} Anc_2.598 YMR037C
          Length = 437

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 328 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 381
           +C+ C K+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K   KH ++
Sbjct: 381 KCKECAKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 437

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 329 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           C  C KSFKR   LKRH+ S HS +R F C  C  +  R DNL QH+K
Sbjct: 649 CHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696

>NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {ON}
           Anc_2.598
          Length = 730

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 3/68 (4%)

Query: 317 PAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           P    D+    +C  C K+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K
Sbjct: 663 PGSLDDKNKPFKCSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLK 722

Query: 376 L--KHTNY 381
              KH ++
Sbjct: 723 THKKHGDF 730

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 329 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           C  C KSFKR   LKRH+ S HS +R F C  C  +  R DNL QH+K
Sbjct: 649 CHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696

>KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.598
           YMR037C
          Length = 370

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 328 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 381
           +C  CEK FKR   LKRH  S HS +R F C  C  +  R DNL QH+K   KH ++
Sbjct: 314 KCSECEKGFKRSEHLKRHFRSVHSNERPFPCMLCEKKFSRSDNLSQHLKTHKKHGDF 370

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 329 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           C  C KSFKR   LKRH+ S HS +R F C  C  +  R DNL QH+K
Sbjct: 648 CHICPKSFKRSEHLKRHVRSVHSNERPFACHICEKKFSRSDNLSQHIK 695

>KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598
           YMR037C
          Length = 620

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 328 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 381
           +C  C K+FKR   LKRH+ S HS  R F C  C  +  R DNL QH+K   KH ++
Sbjct: 564 KCGQCVKAFKRSEHLKRHVRSVHSNDRPFACTLCEKKFSRSDNLSQHLKTHKKHGDF 620

>SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 410

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 37/66 (56%), Gaps = 1/66 (1%)

Query: 317 PAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           P+P  D      C+FC++ FKR+  LKRH+ S H  ++ + C  C  +  R DNL QH+K
Sbjct: 344 PSPILDASKQFGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHIK 403

Query: 376 LKHTNY 381
               +Y
Sbjct: 404 THGGDY 409

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 318 APSSDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           +P  +++   +C  C K+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K
Sbjct: 612 SPMDEEEKPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHLK 670

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 14/21 (66%)

Query: 329 CQFCEKSFKRKSWLKRHLLSH 349
           CQFC+K F R   L +HL +H
Sbjct: 652 CQFCDKKFSRSDNLSQHLKTH 672

>Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {ON}
           complement(39687..41171) [1485 nt, 495 aa]
          Length = 494

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 328 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 381
           +C  C K F+R   LKRH+ S HS++R F C +C  +  R DNL QH+K   KH ++
Sbjct: 438 KCGDCTKQFRRSEHLKRHIRSVHSKERPFPCKYCDKKFSRSDNLSQHLKTHKKHGDF 494

>KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {ON}
           Anc_2.598 YMR037C
          Length = 660

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 329 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           C+ C K+FKR   LKRH+ S HSQ+R + C  C  +  R DNL QH+K
Sbjct: 605 CEQCLKAFKRSEHLKRHVRSVHSQERPYGCNICDKKFSRSDNLSQHLK 652

>ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER130C
          Length = 520

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 2/65 (3%)

Query: 317 PAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           P+P+ D      C++CE+ FKR+  LKRH+ S H  ++ + C  C  +  R DNL QH+K
Sbjct: 450 PSPALDATKPFGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHIK 509

Query: 376 LKHTN 380
             H+N
Sbjct: 510 -THSN 513

>CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {ON}
           some similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c or uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 300

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 322 DQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 380
           D   I +C  CE+ FKR+  LKRH+ S H  +R + C  CL    R DNL QH K  H N
Sbjct: 213 DDAKIFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQH-KRTHNN 271

>KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 397

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 317 PAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           P+P  D      C FC++ FKR+  LKRH+ S H  ++ F C  C  +  R DNL QH+K
Sbjct: 330 PSPILDASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCQICGKKFSRSDNLNQHVK 389

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 328 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           +C  CEK FKR   LKRH+ S HS +R + C +C     R DNL QH+K
Sbjct: 309 KCNKCEKKFKRSEHLKRHIRSVHSTERPYHCQFCEKNFSRSDNLSQHLK 357

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHF 355
           + CQFCEK+F R   L +HL +H +   F
Sbjct: 337 YHCQFCEKNFSRSDNLSQHLKTHKRHGDF 365

>KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {ON}
           Anc_2.598 YMR037C
          Length = 443

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 328 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           +C  C K+F+R   LKRH+ S HS +R F C  C  +  R DNL QH+K
Sbjct: 387 KCDTCYKAFRRSEHLKRHIRSVHSTERPFACTICDKKFSRSDNLSQHLK 435

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 375
           +QCQ C K F R S L+ HLL+H+  R F CP+  C      K N+++H+K
Sbjct: 128 YQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLK 178

>CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {ON}
           some similarities with uniprot|P33748 Saccharomyces
           cerevisiae YMR037c MSN2
          Length = 597

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 329 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           C  C K+FKR   LKRH+ S HS  R F C  C  +  R DNL QH+K
Sbjct: 537 CHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHIK 584

>Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130C -
           Hypothetical ORF [contig 211] FULL
          Length = 403

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 37/65 (56%), Gaps = 2/65 (3%)

Query: 317 PAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           P+P  D      C FC++ FKR+  LKRH+ S H  ++ F C  C  +  R DNL QH+K
Sbjct: 336 PSPILDASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHIK 395

Query: 376 LKHTN 380
             HT+
Sbjct: 396 -THTD 399

>TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144
           YER130C
          Length = 687

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 317 PAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           P+P +D   I  C +C + FKR+  LKRH  S H  ++ F C  C  +  R DNL QH+K
Sbjct: 624 PSPFNDPSKIFICPYCNRRFKRQEHLKRHNRSLHMGEKPFDCHICNKKFSRSDNLAQHIK 683

>Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa]
           {ON} complement(101434..102513) [1080 nt, 360 aa]
          Length = 359

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 317 PAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           P+P  D   +  C+ C++ FKR+  LKRH+ S H  ++ F C  C  +  R DNL QH+K
Sbjct: 293 PSPILDPLKLFACEHCDRRFKRQEHLKRHVRSLHMGEKPFSCHICEKKFSRSDNLNQHIK 352

Query: 376 LKHTNY 381
             H+N+
Sbjct: 353 -THSNF 357

>ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 557

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 317 PAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           P+P  D      C++C++ FKR+  LKRH+ S H  ++ F C  C  +  R DNL QH+K
Sbjct: 493 PSPILDATKHFGCEYCDRRFKRQEHLKRHVRSLHMCEKPFGCHICGKKFSRSDNLNQHIK 552

>TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.144
           YER130C
          Length = 312

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 317 PAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           P+P  D      C+FC++ FKR+  LKRH+ S H  ++ F C  C  +  R DNL QH+K
Sbjct: 248 PSPIPDASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFNCHICDKKFSRSDNLNQHIK 307

>ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR113W (AZF1)
          Length = 769

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNY 381
           QC++C K F +   L+ H+  H+ +R + C  C  R  RK NL  HM L H NY
Sbjct: 516 QCEYCGKRFTQGGNLRTHVRLHTGERPYECDKCGKRFSRKGNLAAHM-LTHENY 568

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 4/65 (6%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN---YLL 383
           H+C +C K F + + L+ H+ SH   + F C +C  R  +  NL  H++L HT    Y  
Sbjct: 487 HKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL-HTGERPYEC 545

Query: 384 DELKK 388
           D+  K
Sbjct: 546 DKCGK 550

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC 357
           ++C  C K F RK  L  H+L+H   + F C
Sbjct: 543 YECDKCGKRFSRKGNLAAHMLTHENYKPFQC 573

>KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 168

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 2/63 (3%)

Query: 316 MPAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQH 373
           +PA +     +H+C  C K+F R S L  H L H+  + F+C  P C  R   K NL++H
Sbjct: 100 VPARAPPSATLHECHVCGKTFSRPSGLNTHALIHTGHQPFVCDVPHCGKRFNVKSNLIRH 159

Query: 374 MKL 376
            K+
Sbjct: 160 KKI 162

>KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 474

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 317 PAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           P+P  D      C++C++ FKR+  LKRH+ S H  ++ + C  C  +  R DNL QH+K
Sbjct: 408 PSPILDASKPFGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHLK 467

>CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} similar
           to uniprot|P46974 Saccharomyces cerevisiae YJR127c ZMS1
           or uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1020

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 388
           C  C + F R+  LKRH  SH+ ++ FLC  C     RKD +L+H++  H +Y  ++L K
Sbjct: 29  CPICSRGFVRQEHLKRHQNSHTHEKPFLCLICGKCFARKDLVLRHLQKLHRDYKTEQLDK 88

>TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {ON}
           Anc_8.144 YER130C
          Length = 439

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 317 PAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           P+P  D      C +CE+ FKR+  LKRH+ S H   + + C  C  +  R DNL QH+K
Sbjct: 376 PSPILDSSKQFGCDYCERRFKRQEHLKRHVRSLHMCVKPYACHICDKKFSRSDNLSQHIK 435

>KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.256
           YPL230W
          Length = 311

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%)

Query: 332 CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 386
           C  +F R   L RH+  H+ ++ F C  C     R DNL QH +  H N  +DE+
Sbjct: 26  CHMTFARAEHLARHVRRHTGEKPFECNVCFKHFSRVDNLKQHKETVHANVFIDEM 80

>NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {ON}
           Anc_8.144
          Length = 547

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 329 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           C +CE+ FKR+  LKRH+ S H  ++ + C  C     R DNL QH+K
Sbjct: 497 CDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHIK 544

>TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1384

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 36/59 (61%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 385
           + CQ C + F R+  LKRH  SH+ ++ FLC +C     R+D +L+H +  H++ + ++
Sbjct: 105 YICQTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLILRHQRRLHSSLMTND 163

>TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1311

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKH 378
           C FC+++F R+  L RH  SH+ ++ FLC  C     R+D L++H +  H
Sbjct: 154 CDFCKRAFARQEHLTRHKRSHTNEKPFLCNLCFKNFTRRDLLIRHAQKIH 203

>Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C
           (REAL)
          Length = 442

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 329 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           C+FC++ FKR+  LKRH+ S H  ++ F C  C     R DNL QH+K
Sbjct: 390 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

>Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON}
           YER130C (REAL)
          Length = 449

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 329 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           C+FC++ FKR+  LKRH+ S H  ++ F C  C     R DNL QH+K
Sbjct: 397 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 444

>Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON}
           YER130C (REAL)
          Length = 442

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 329 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           C+FC++ FKR+  LKRH+ S H  ++ F C  C     R DNL QH+K
Sbjct: 390 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKLKHTNYLLDE 385
           QC  C KS  R S L+ H+L H+  R F C W  C  R   K N+ +H KL     L +E
Sbjct: 492 QCHICGKSVTRTSTLQTHMLVHTGDRPFECVWSGCHKRFNVKSNMNRHYKLHLKKQLANE 551

Query: 386 L 386
           +
Sbjct: 552 V 552

>TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.351
           YJR127C
          Length = 1310

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 373
           C  C + F R+  LKRH +SH+ ++ FLC +C     RKD +L+H
Sbjct: 36  CSICTRGFVRQEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRH 80

>CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some
           similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c
          Length = 317

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 329 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           C+FC++ FKR+  LKRH+ S H  ++ + C  C  +  R DNL QH+K
Sbjct: 266 CEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHIK 313

>KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.144
           YER130C
          Length = 402

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           + C++CE+ FKR+  LKRH+ S H   + + C  C  +  R DNL QH K
Sbjct: 349 YSCEYCERRFKRQEHLKRHIRSLHLGAKPYTCHICARKFSRSDNLNQHTK 398

>YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON}
           Protein of unknown function; transcription is regulated
           by Haa1p, Sok2p and Zap1p transcriptional activators;
           computational analysis suggests a role as a
           transcription factor; C. albicans homolog (MNL1) plays a
           role in adaptation to stress
          Length = 443

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 329 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           C+FC++ FKR+  LKRH+ S H  ++ F C  C     R DNL QH+K
Sbjct: 391 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 438

>Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}
           similar to Ashbya gossypii AEL077W
          Length = 381

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 316 MPAPSSDQKYI-HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQ 372
           +P P+  +K + +QC  C K   R S L+ H+  H+ +R FLC W  C  R   K N+++
Sbjct: 284 LPTPNKRRKCVRNQCPVCAKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVR 343

Query: 373 HMKL 376
           H +L
Sbjct: 344 HYRL 347

>SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 899

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 2/69 (2%)

Query: 320 SSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHT 379
           +S +KYI  C FC K+F R     RH  SH+  + F C  C     R+D L +H++  H 
Sbjct: 3   ASQRKYI--CSFCAKAFSRSEHRTRHERSHTGVKPFTCTVCAHSFVRRDLLQRHIRTVHR 60

Query: 380 NYLLDELKK 388
            +LL   K+
Sbjct: 61  TFLLQCTKE 69

>Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}
           similar to Ashbya gossypii AEL174W
          Length = 663

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELK 387
           +CQFC+K F   S L+ H+ +H+ ++   C  C  R     NL +HMK+    Y+    K
Sbjct: 575 KCQFCDKRFTTSSSLRIHIRTHTGEKPLACNVCGKRFNESSNLSKHMKIHERKYMCKHCK 634

Query: 388 K 388
           +
Sbjct: 635 R 635

 Score = 33.5 bits (75), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           +C  C K+F  +  L +H+ +HS +R F C +C  R     +L  H++
Sbjct: 547 KCPHCSKTFSTEDILSQHIRTHSGERPFKCQFCDKRFTTSSSLRIHIR 594

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 4/60 (6%)

Query: 318 APSSDQKYIHQCQF--CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMK 375
            P+    Y  QC++  C K F ++  L RH+  H+  + F CP C      +D L QH++
Sbjct: 509 VPTGQSSY--QCRWDGCTKHFAQRQKLLRHIKVHTGYKPFKCPHCSKTFSTEDILSQHIR 566

>Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii ACR264W
          Length = 775

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNY 381
           QC++C K F +   L+ H+  H+ +R + C  C  R  RK NL  HM L H N+
Sbjct: 520 QCEYCGKRFTQGGNLRTHVRLHTGERPYECDKCGKRFSRKGNLAAHM-LTHENH 572

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 4/65 (6%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN---YLL 383
           H+C +C K F + + L+ H+ SH   + F C +C  R  +  NL  H++L HT    Y  
Sbjct: 491 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL-HTGERPYEC 549

Query: 384 DELKK 388
           D+  K
Sbjct: 550 DKCGK 554

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC 357
           ++C  C K F RK  L  H+L+H   + F C
Sbjct: 547 YECDKCGKRFSRKGNLAAHMLTHENHKPFQC 577

>NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144
          Length = 436

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 329 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           C++CE+ FKR+  LKRH+ S H   + + C  C     R DNL QH+K
Sbjct: 386 CEYCERRFKRQEHLKRHVRSLHIGVKPYTCHICQKNFSRSDNLSQHIK 433

>KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.234
           YER169W
          Length = 890

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 326 IHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 377
           ++ CQ C++ F     L RH  S HS ++ F CP C  R KR+D++LQH+  K
Sbjct: 780 VYICQICKRQFSSGHHLTRHKKSVHSGEKPFSCPKCGKRFKRRDHVLQHLNKK 832

>SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 385

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 3/75 (4%)

Query: 316 MPAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQH 373
           M  P+ + +  ++C+ C K F R    +RH+ +H+ ++   C  P C+ R  R D L +H
Sbjct: 14  MEYPADNDQRPYKCELCNKGFHRLEHKRRHIRTHTGEKPHACTFPGCMKRFSRSDELKRH 73

Query: 374 MKLKHTNYLLDELKK 388
           +++ HTN    + +K
Sbjct: 74  LRI-HTNTSKRKTRK 87

>YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putative
           transcription factor containing a C2H2 zinc finger;
           mutation affects transcriptional regulation of genes
           involved in growth on non-fermentable carbon sources,
           response to salt stress and cell wall biosynthesis
          Length = 391

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 25/47 (53%)

Query: 332 CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKH 378
           C  SF R   L RH+  H+ ++ F CP CL    R DNL QH +  H
Sbjct: 49  CTMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 95

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 323 QKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQ----HMKL 376
           +K  + C  C K FKR S L  H+  H+  + F CP+  C      K N+L+    H KL
Sbjct: 301 EKIKYHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNCTKSFNAKSNMLRHYKLHFKL 360

Query: 377 KHTNYLL 383
              NY+L
Sbjct: 361 SSGNYIL 367

>Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W
           (REAL)
          Length = 392

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 27/52 (51%)

Query: 332 CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLL 383
           C  SF R   L RH+  H+ ++ F CP CL    R DNL QH +  H +  L
Sbjct: 52  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHAHKQL 103

>NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.144
           YER130C
          Length = 484

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 329 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNY 381
           C  C + F+R+  +KRH+ + H Q+R + C  C     R DNL QH++    NY
Sbjct: 415 CTICSRRFRRQEHMKRHIRTIHFQERPYTCYVCEKTFSRSDNLNQHLRTHTRNY 468

>KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.281
           YBR066C
          Length = 254

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 2/67 (2%)

Query: 322 DQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKLKHT 379
           +Q+  + C  C K F     L RH   H+ +++ LCP+  C  R  R+DN LQH +    
Sbjct: 180 EQRRKYLCTTCTKGFTTSGHLARHKRIHTGEKNHLCPFEGCKQRFSRQDNCLQHYRTHFK 239

Query: 380 NYLLDEL 386
           N+    L
Sbjct: 240 NFTFTNL 246

>KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1379

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 35/60 (58%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 388
           C+ C ++F R+  L RH  SH++++ ++C  C  R  R+D L++H +  H     D +++
Sbjct: 127 CKVCTRAFARQEHLTRHERSHTKEKPYVCGICERRFTRRDLLIRHCQKLHGGNCGDYIRR 186

>NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144
          Length = 289

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 3/71 (4%)

Query: 319 PSSDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 377
           P   ++Y   C  C+K FKR   LKRH  + H + R F C  C  R  R DNL QH+++ 
Sbjct: 217 PDDSKQYF--CHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHVRIH 274

Query: 378 HTNYLLDELKK 388
               +++ ++K
Sbjct: 275 EQQPIMEPIRK 285

>Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..7102)
           [4026 nt, 1342 aa]
          Length = 1341

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 27/45 (60%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 373
           C  C + F R   LKRH +SH+ ++ FLC +C     RKD +L+H
Sbjct: 38  CSICTRGFVRHEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRH 82

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKL 376
           C  C K F R S L+ H+L HS  + F C W  C  +   K NL++H+KL
Sbjct: 234 CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKL 283

>NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531
          Length = 354

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 34/61 (55%), Gaps = 4/61 (6%)

Query: 319 PSSDQK--YIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHM 374
           PS ++K   IH+C  C+K   R + L+ HLL H+ ++ + C W  C +    K N+ +H 
Sbjct: 286 PSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY 345

Query: 375 K 375
           K
Sbjct: 346 K 346

>TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298
          Length = 511

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 323 QKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKL 376
           + + + C  C K F+R S LK H+  H+  + +LCP+  C      K N+L+H KL
Sbjct: 411 KNFKYHCDICHKFFRRPSSLKTHMNIHTGVKPYLCPYNNCYKPFNAKSNMLRHFKL 466

>Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON}
           YPL230W (REAL)
          Length = 386

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 25/47 (53%)

Query: 332 CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKH 378
           C  SF R   L RH+  H+ ++ F CP CL    R DNL QH +  H
Sbjct: 49  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 95

>TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.234
           YER169W
          Length = 967

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 321 SDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 377
           S+   I+ CQ C++ F     L RH  S HS ++   CP C  R KR+D++LQH+  K
Sbjct: 853 SENGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 910

>NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON} 
          Length = 350

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 375
           +H C  C KS  R + L+ H+L H+  R F C W  C +    K N+ +H K
Sbjct: 284 LHICVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFK 335

>Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W
           (REAL)
          Length = 398

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 25/47 (53%)

Query: 332 CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKH 378
           C  SF R   L RH+  H+ ++ F CP CL    R DNL QH +  H
Sbjct: 49  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 95

>TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1655

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 29/47 (61%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 373
           + CQ C + F R+  L+RH  +H+ ++ FLC +C     R+D +L+H
Sbjct: 87  YLCQICTRGFVRQEHLRRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 133

>Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {ON}
           YMR182C (REAL)
          Length = 216

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%)

Query: 332 CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 388
           C  SF R   L RH+  H+ ++ F C  CL    R DNL QH    H++  L  L++
Sbjct: 27  CNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDVDLMSLRR 83

>TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.80
           YGL035C
          Length = 350

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 322 DQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMKLKHT 379
           D    H C  C+++F+R     RHL +H+ ++   C  P C  R  R D L +H ++ HT
Sbjct: 24  DAPRPHVCPICQRAFRRLEHQTRHLRTHTGEKPHACDFPGCAKRFSRSDELTRHRRI-HT 82

Query: 380 N 380
           N
Sbjct: 83  N 83

>Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {ON}
           YMR182C (REAL)
          Length = 211

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%)

Query: 332 CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 388
           C  SF R   L RH+  H+ ++ F C  CL    R DNL QH    H++  L  L++
Sbjct: 27  CNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDIDLVSLRR 83

>ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 616

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 319 PSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKH 378
           PS  +KY+  C FC K+F R     RH  SH+  + F C  C     R+D L +H++  H
Sbjct: 2   PSQQRKYV--CSFCSKAFSRSEHRARHERSHTGMKPFECKVCRHAFVRRDLLQRHIRTVH 59

Query: 379 TNYLL 383
              LL
Sbjct: 60  RELLL 64

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1238

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELK 387
           C  C + F R+  LKRH  SH+ ++ FLC +C     R+D +L+H +  H + L+D+ K
Sbjct: 75  CPICTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHAS-LMDQDK 132

>YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}
           RGM1Putative zinc finger DNA binding transcription
           factor; contains two N-terminal C2H2 zinc fingers and
           C-terminal proline rich domain; overproduction impairs
           cell growth and induces expression of genes involved in
           monosaccharide catabolism and aldehyde metabolism;
           deletion decreases expression of Y-prime telomeric
           elements; regulates expression of subtelomeric COS genes
           in conjunction with RNA binding protein Pub1p; localized
           to X elements within subtelomeric regions by ChIP
          Length = 211

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%)

Query: 332 CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 388
           C  SF R   L RH+  H+ ++ F C  CL    R DNL QH    H++  L  L++
Sbjct: 27  CNMSFNRTEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDVDLMSLRR 83

>CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169w
          Length = 980

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 321 SDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 377
           SD   I+ CQ C++ F     L RH  S HS ++   CP C  R KR+D++LQH+  K
Sbjct: 896 SDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 953

>Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa]
           {ON} complement(131384..133768) [2385 nt, 795 aa]
          Length = 794

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 32/65 (49%), Gaps = 4/65 (6%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNL----LQHMKLKHTNYLL 383
           QC++C K F +   L+ H   H+ +R + C  C  +  RK NL    L H KLK     L
Sbjct: 537 QCEYCGKRFTQGGNLRTHQRLHTGERPYSCELCGKKFSRKGNLAAHFLTHQKLKPYVCKL 596

Query: 384 DELKK 388
           DE  K
Sbjct: 597 DECNK 601

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           H+C +C + F + + L+ H+ SH   + F C +C  R  +  NL  H +L
Sbjct: 508 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHQRL 557

 Score = 37.0 bits (84), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 2/64 (3%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKLKHTNYLLD 384
           + C+ C K F RK  L  H L+H + + ++C    C     +  N+  H    H N L++
Sbjct: 564 YSCELCGKKFSRKGNLAAHFLTHQKLKPYVCKLDECNKSFTQLGNMKAHQNRFHLNTLME 623

Query: 385 ELKK 388
              K
Sbjct: 624 LTAK 627

>SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 819

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 380
           QC++C K F +   L+ H   H+ ++ + C  C  R  RK NL  HM L H N
Sbjct: 569 QCEYCGKRFTQGGNLRTHTRLHTGEKPYSCEKCGKRFSRKGNLAAHM-LTHEN 620

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           H+C +C K F + + L+ H+ SH   + F C +C  R  +  NL  H +L
Sbjct: 540 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHTRL 589

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 17/31 (54%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC 357
           + C+ C K F RK  L  H+L+H   + + C
Sbjct: 596 YSCEKCGKRFSRKGNLAAHMLTHENLKPYHC 626

>Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {ON}
           YMR182C (REAL)
          Length = 212

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%)

Query: 332 CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 388
           C  SF R   L RH+  H+ ++ F C  CL    R DNL QH    H++  L  L++
Sbjct: 27  CNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDVDLMSLRR 83

>TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON} 
          Length = 501

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 324 KYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKL 376
           + IHQC  C +   R   L  H+L H++ + F C W  C      K NL +HMK+
Sbjct: 423 RAIHQCPICNRVTTRSYSLHAHMLVHTKDKPFKCEWQDCGKAFSIKSNLSRHMKI 477

>ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON}
           NOHBY437; No homolog in Saccharomyces cerevisiae
          Length = 278

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMKL 376
           C+ C +  +R S LK H+L+H+ QR F C  P C      + N+L+H +L
Sbjct: 206 CKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERL 255

>CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa]
           {ON} weakly similar to uniprot|P07248 Saccharomyces
           cerevisiae YDR216w ADR1 zinc-finger transcription factor
          Length = 1489

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 373
           CQ C ++F R+  L RH  SH++++ + C  C  R  R+D LL+H
Sbjct: 32  CQTCTRAFARQEHLTRHERSHTKEKPYCCGICDRRFTRRDLLLRH 76

>SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa]
           {ON} similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1129

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%)

Query: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 385
           +  C+ C ++F R+  L RH  SH++++ + C  C  R  R+D LL+H    H     + 
Sbjct: 58  LFVCKICTRAFARQEHLTRHERSHTKEKPYFCGICDRRFSRRDLLLRHAHKLHGGNCGET 117

Query: 386 LKK 388
           +KK
Sbjct: 118 IKK 120

>NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80
          Length = 493

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMKLKHTN 380
           H C  C+++F R     RHL +H+ ++  +C  P C+ R  R D L +H ++ HTN
Sbjct: 43  HVCPVCQRAFHRLEHQTRHLRTHTGEKPNVCDFPGCIKRFSRSDELTRHKRI-HTN 97

>Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON}
           similar to Ashbya gossypii ADR308C
          Length = 276

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMKL 376
           C+ C +  +R S LK H+L+H+ QR F C  P C      + N+L+H +L
Sbjct: 215 CKVCGRECRRPSTLKTHMLTHTGQRPFCCRHPGCNKSFNVRSNMLRHERL 264

>NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]
           {ON} Anc_4.351
          Length = 1341

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 388
           C  C + F R+  LKRH  SH+ ++ FLC +C     R+D +L+H    H   + +EL++
Sbjct: 74  CPTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHAALIGNELQQ 133

>KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {ON}
           Anc_8.144 YER130C
          Length = 453

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 329 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           C++C++ FKR+  LKRH+ S H  ++ F C  C     R DNL QH+K
Sbjct: 400 CEYCDRRFKRQEHLKRHIRSLHICEKPFHCHICDKHFSRSDNLNQHIK 447

>KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.234
           YER169W
          Length = 875

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 326 IHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 377
           ++ CQ C++ F     L RH  S HS ++ + CP C  R KR+D++LQH+  K
Sbjct: 759 VYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKRFKRRDHVLQHLNKK 811

>TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {ON}
           Anc_4.214 YGR067C
          Length = 737

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLD 384
           H C FC ++F R    KRH  SH   + F C  C     R+D L +H+K  H  +LL+
Sbjct: 5   HVCAFCRRAFSRSEHRKRHERSHQGVKPFQCAVCNHVFVRRDLLKRHIKTVHRAWLLE 62

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 375
           QC  C+K   R + LK HLL H+    F CPW  C      K N+L+H+K
Sbjct: 150 QCHICKKICSRPATLKTHLLIHTGDTPFKCPWENCPKSFNVKSNMLRHLK 199

>AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML081W and
           YJR127C (ZMS1)
          Length = 1191

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELK 387
           C  C + F R+  LKRH  SH+ ++ FLC +C     R+D +L+H +  H + L+D+ K
Sbjct: 82  CPVCTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHAS-LMDQDK 139

>Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar to
           Ashbya gossypii AFR531W
          Length = 349

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 8/77 (10%)

Query: 319 PSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW----CL----SRQKRKDNL 370
           P+++   I++C +C  SFK + +L RHL  H   + F CP+    C         RKD  
Sbjct: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTF 285

Query: 371 LQHMKLKHTNYLLDELK 387
             H+K  H  Y +   K
Sbjct: 286 RTHLKSIHFVYPVGTTK 302

>ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} similar
           to uniprot|P39956 Saccharomyces cerevisiae YER169W RPH1
           Transcriptional repressor of PHR1 which is a photolyase
           induced by DNA damage binds to AG(4) (C(4)T) sequence
           upstream of PHR1 Rph1p phosphorylation during DNA damage
           is under control of the MEC1-RAD53 pathway
          Length = 867

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 321 SDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 377
           S+   ++ CQ C++ F     L RH  S HS ++ + CP C  + KR+D++LQH+  K
Sbjct: 782 SENGKVYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 839

>Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W
           (REAL)
          Length = 777

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 31/57 (54%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 385
           C  C + F R+  LKRH  +H+ ++ FLC +C     R+D +L+H    H+  +  E
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKE 119

>KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.351
           YJR127C
          Length = 1076

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 386
           C  C ++F R+  LKRH  SH+ ++ F+C +C     R+D +L+H    H+  +  EL
Sbjct: 54  CSVCTRAFIRQEHLKRHQRSHTNEKPFICVFCGRCFARRDLVLRHQHKLHSALIGTEL 111

>KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081W
          Length = 1332

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELK 387
           C  C + F R+  L+RH  SH+ ++ FLC +C     R+D +L+H +  H + L+D+ K
Sbjct: 85  CPICTRGFARQEHLRRHERSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHAS-LMDQDK 142

>TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON}
           Anc_2.303 YNL027W
          Length = 762

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 22/35 (62%)

Query: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWC 360
           I+ C+ C+K F R   LK HL +H+ +R F+C  C
Sbjct: 650 IYACELCDKKFTRPYNLKSHLRTHTNERPFICSIC 684

>KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON}
           similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1128

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 380
           C  C + F R+  LKRH  +H+ ++ FLC +C     R+D +L+H +  H++
Sbjct: 34  CSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLHSS 85

>Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {ON}
           YML081W - Hypothetical ORF [contig 376] FULL
          Length = 1178

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 380
           C  C + F R+  LKRH  +H+ ++ FLC +C     R+D +L+H +  H+ 
Sbjct: 80  CSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLHST 131

>CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa]
           {ON} some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 348

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 26/55 (47%), Gaps = 2/55 (3%)

Query: 324 KYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKL 376
           K   QC  C K   R S LK H L H+    F CPW  C      K N+L+H+K 
Sbjct: 282 KLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKC 336

>TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {ON}
           Anc_8.234 YER169W
          Length = 912

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 321 SDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 377
           S+   ++ CQ C++ F     L RH  S HS ++   CP C  R KR+D++LQH+  K
Sbjct: 771 SENGKVYICQDCKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 828

>ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} similar
           to uniprot|P07248 Saccharomyces cerevisiae YDR216W ADR1
           Positive transcriptional regulator controls the
           expression of ADH2 peroxisomal protein genes and genes
           required for ethanol glycerol and fatty acid utilization
          Length = 1346

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHM-KLKHTNY 381
           +  CQ C ++F R+  L RH  SH++++ + C  C  +  R+D LL+H  K+   NY
Sbjct: 85  LFVCQVCTRAFARQEHLTRHERSHTKEKPYCCGICNRKFSRRDLLLRHAHKIHGGNY 141

>KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1255

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 30/54 (55%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYL 382
           C  C + F R+  LKRH  SH+++R FLC  C     RKD +L+H +  H   +
Sbjct: 51  CPTCTRGFVRQEHLKRHQRSHTRERPFLCVLCGRCFARKDLVLRHQQKLHATIV 104

>NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256
          Length = 274

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%)

Query: 332 CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYL 382
           C  +F R   L RH+  H+ ++ F C  CL R  R DNL QH +  H   +
Sbjct: 27  CHMAFTRAEHLARHIRKHTGEKPFQCDVCLKRFSRVDNLKQHRESVHATVV 77

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHM 374
           ++C +C K F +   LK H+  H+ ++ F C +C  R  RK NL  H+
Sbjct: 416 YKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEFCSKRFSRKGNLTAHL 463

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKLKHTNYLLDEL 386
           C+FC K F RK  L  HL++H + R F+C    C+    +  N+  H    H N L +  
Sbjct: 446 CEFCSKRFSRKGNLTAHLVTHEKVRPFVCKLNGCMKTFTQLGNMKSHQNRFHQNTLTELT 505

Query: 387 KK 388
           ++
Sbjct: 506 RR 507

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           H+C  C K F + + L+ HL SH   + + C WC     +  NL  H++L
Sbjct: 388 HECNICHKLFIQLTHLEVHLRSHLGDKPYKCTWCGKGFTQGGNLKTHVRL 437

>NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON}
           Anc_2.162
          Length = 839

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 386
           ++C+ C+K F RK  L  HLL+H + + F+C   L    R    L +MK     + LD L
Sbjct: 571 YECELCDKKFSRKGNLAAHLLTHQKVKPFICK--LDNCNRSFTQLGNMKAHQNRFHLDTL 628

Query: 387 K 387
           K
Sbjct: 629 K 629

 Score = 38.5 bits (88), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHM 374
           +QC +C K F +   L+ H   H+ ++ + C  C  +  RK NL  H+
Sbjct: 543 YQCGYCGKRFTQGGNLRTHQRLHTGEKPYECELCDKKFSRKGNLAAHL 590

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 27/50 (54%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           H+C +C + F + + L+ H+ SH   + + C +C  R  +  NL  H +L
Sbjct: 515 HKCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGYCGKRFTQGGNLRTHQRL 564

>AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR216W (ADR1)
          Length = 1057

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%)

Query: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 385
           +  C  C ++F R+  L RH  SH+ ++ ++C  C  R  R+D LL+H    H     D 
Sbjct: 48  LFVCHTCTRAFARQEHLIRHKRSHTNEKPYICGICDRRFSRRDLLLRHAHKLHGGSCGDA 107

Query: 386 LKK 388
           L K
Sbjct: 108 LLK 110

>CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {ON}
           some similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230w USV1 or uniprot|Q00453 Saccharomyces
           cerevisiae YMR182c RGM1
          Length = 613

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 24/47 (51%)

Query: 332 CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKH 378
           CE SF R   L RH+  H+ ++ F C  CL    R DNL QH    H
Sbjct: 33  CEMSFSRAEHLARHIRRHTGEKPFKCDICLKYFSRIDNLKQHKDTVH 79

>Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113W
           (AZF1) - similar to Zn-finger transcription factors
           [contig 204] FULL
          Length = 786

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 380
           QC++C K F +   L+ H+  H+ ++ + C  C  R  RK NL  H +L H N
Sbjct: 532 QCEYCGKRFTQGGNLRTHVRLHTGEKPYECEKCGRRFSRKGNLAAH-RLTHEN 583

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           H+C +C K F + + L+ H+ SH   + F C +C  R  +  NL  H++L
Sbjct: 503 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL 552

>CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1321

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 373
           H C  C + F R   LKRH  +H+ ++ FLC +C     R+D +L+H
Sbjct: 33  HLCPICTRGFVRLEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 79

>ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1119

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 373
           C  C + F R+  LKRH  SH+ ++ FLC +C     R+D +L+H
Sbjct: 77  CSICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRH 121

>KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 768

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 380
           QC++C K F +   L+ H+  H+ ++ + C  C  R  RK NL  H +L H N
Sbjct: 515 QCEYCGKRFTQGGNLRTHVRLHTGEKPYECEKCGRRFSRKGNLAAH-RLTHEN 566

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           H+C +C K F + + L+ H+ SH   + F C +C  R  +  NL  H++L
Sbjct: 486 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL 535

>KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1155

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYL 382
           C  C + F R+  LKRH  +H+ ++ FLC +C     R+D +L+H    H++ +
Sbjct: 56  CSICTRGFVRQEHLKRHQRAHTSEKPFLCTFCGRCFARRDLVLRHQHKLHSSLI 109

>NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa]
           {ON} Anc_4.351
          Length = 1537

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYL 382
           C  C + F R   LKRH  SH+Q++ +LC +C     R+D +L+H    H++ L
Sbjct: 47  CPTCTRGFVRLEHLKRHERSHTQEKPYLCIFCGRCFARRDLVLRHQTKLHSSIL 100

>TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 319 PSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCP--WCLSRQKRKDNLLQHMKL 376
           PS +++   +C  C + F R    KRH+ +H+ ++  LCP   C     R D L +HMK+
Sbjct: 8   PSDNEERPFKCPMCHRGFYRAEHKKRHIRTHTGEKPHLCPILGCNKSFSRTDELKRHMKV 67

>NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {ON}
           Anc_4.351
          Length = 1362

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 373
           C  C + F R+  LKRH  SH+ ++ FLC +C     R+D +L+H
Sbjct: 73  CSTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRH 117

>TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {ON}
           Anc_2.162 YOR113W
          Length = 823

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 31/66 (46%), Gaps = 4/66 (6%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNL----LQHMKLKHTNYL 382
           +QC FC K F +   LK H   H+ ++ + C  C  R  RK NL    L H KLK     
Sbjct: 545 YQCNFCGKKFTQGGNLKTHQRLHTGEKPYSCKICNKRFSRKGNLTAHVLTHKKLKPYFCK 604

Query: 383 LDELKK 388
           LD   K
Sbjct: 605 LDNCNK 610

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%)

Query: 317 PAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           P  S  +K  HQC +C + F + + L+ H+ SH   + + C +C  +  +  NL  H +L
Sbjct: 507 PTRSRTKKKTHQCPYCHRFFSQSTHLEVHIRSHIGYKPYQCNFCGKKFTQGGNLKTHQRL 566

>CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {ON}
           some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 315

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 4/59 (6%)

Query: 320 SSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKL 376
           S D K+I  C+ C K FKR S L  H+  H+ ++ + CP+  C      K N+L+H KL
Sbjct: 168 SEDTKFI--CKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKL 224

>TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {ON}
           Anc_8.234 YER169W
          Length = 837

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 321 SDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 377
           S+   ++ CQ C++ F     L RH  S HS ++ + CP C  + KR+D++LQH+  K
Sbjct: 750 SENGKVYICQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 807

>Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON}
           (118186..120660) [2475 nt, 825 aa]
          Length = 824

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 321 SDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 377
           S+   ++ CQ C++ F     L RH  S HS ++   CP C  R KR+D++LQH+  K
Sbjct: 681 SENGKVYICQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 738

>NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON}
           Anc_8.425
          Length = 1350

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 34/58 (58%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 386
           C+ C ++F R+  L RH  SH++++ + C  C  +  R+D L++H +  H   ++D +
Sbjct: 118 CEICTRAFARQEHLVRHERSHTKEKPYNCGICSKKFTRRDLLIRHAQKVHNGNVVDTV 175

>NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON} 
          Length = 338

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 31/66 (46%), Gaps = 6/66 (9%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKLKH----TNY 381
           QC  C K   R S LK H L H+    F CPW  C      K N+L+H+K         Y
Sbjct: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTY 330

Query: 382 LLDELK 387
           +++E K
Sbjct: 331 VINERK 336

>KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169W RPH1 Transcriptional repressor of
           PHR1 which is a photolyase induced by DNA damage binds
           to AG(4) (C(4)T) sequence upstream of PHR1 Rph1p
           phosphorylation during DNA damage is under control of
           the MEC1-RAD53 pathway
          Length = 832

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 321 SDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 377
           SD+  ++ CQ C + F     L RH  S HS ++   CP C  + KR+D++LQH+  K
Sbjct: 733 SDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 790

>Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON}
           (31069..33561) [2493 nt, 831 aa]
          Length = 830

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%)

Query: 321 SDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 380
           S   + H C +C ++F R     RH  SH+  + + C  CL    R+D L +H++  H +
Sbjct: 3   SSTNWKHICSYCNRAFSRSEHKARHERSHTGTKPYECKVCLREFVRRDLLQRHIRTVHKS 62

Query: 381 YLLDELKK 388
            LL +  K
Sbjct: 63  LLLSKASK 70

>Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {ON}
           YER169W (RPH1) - Repressor of PHR1 transcription; binds
           to PHR1 URS [contig 177] FULL
          Length = 828

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 321 SDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 377
           SD+  ++ CQ C + F     L RH  S HS ++   CP C  + KR+D++LQH+  K
Sbjct: 729 SDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 786

>Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 321 SDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 377
           SD   I+ C+ C + F     L RH  S HS ++   CP C  R KR+D++LQH+  K
Sbjct: 822 SDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4.351
           YJR127C
          Length = 1199

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 373
           + C  C + F R+  LKRH  SH+ ++ FLC +C     R+D +L+H
Sbjct: 57  YLCPICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRH 103

>NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa]
           {ON} 
          Length = 505

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 323 QKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKL 376
           +K   QC+ C K   R S L+ H+L H+  R F C W  C      K N+ +H+KL
Sbjct: 443 RKRKKQCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKL 498

>YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC
           domain-containing histone demethylase and transcription
           factor; involved in expression of genes during nutrient
           limitation; negatively regulates DPP1 and PHR1; activity
           is modulated by limited proteasome-mediated proteolysis;
           has a JmjC and a JmjN domain in the N-terminal region
           that interact, promoting Gis1p stability and proper
           transcriptional activity; contains transactivating
           domains TAD1 and TAD2 downstream of the Jmj domains and
           a C-terminal DNA binding domain
          Length = 894

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 321 SDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 377
           SD   I+ C+ C + F     L RH  S HS ++   CP C  R KR+D++LQH+  K
Sbjct: 822 SDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 317

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 27/61 (44%), Gaps = 2/61 (3%)

Query: 317 PAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHM 374
           P  S   +   QC  C K   R S LK H L H+    F CPW  C      K N+L+H 
Sbjct: 248 PTDSLSARLKRQCPICGKLCSRPSTLKTHFLIHTGATPFKCPWLNCNKSFNVKSNMLRHY 307

Query: 375 K 375
           K
Sbjct: 308 K 308

>Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa]
           {ON} YPR186C (PZF1) - Transcription factor IIIA (TFIIIA)
           with putative Zn-fingers [contig 8] FULL
          Length = 429

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLL 383
           QC  C + F RK+ L+RH+ SHS+ + F C +C      K  L +H ++ HT   +
Sbjct: 82  QCTVCARQFSRKTHLERHMFSHSEDKPFKCSYCGKGVTTKQQLRRH-EITHTRSFV 136

>KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {ON}
           some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 111

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 316 MPAPSSDQKYI-HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCP--WCLSRQKRKDNLLQ 372
           +P P+   K + +QC  C K F R S L+ H+L H+  R F+CP   C      K N+ +
Sbjct: 37  VPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNR 96

Query: 373 HMK 375
           H K
Sbjct: 97  HFK 99

>TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON} 
          Length = 454

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 329 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 377
           C  C +SF     L RH  + H  ++ F CP C  R KR+D++LQH+  K
Sbjct: 392 CYECCRSFSSSHHLTRHKKTVHLNEKPFSCPRCRKRFKRRDHVLQHLNKK 441

>Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W
           (REAL)
          Length = 916

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 321 SDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 377
           SD   I+ C+ C + F     L RH  S HS ++   CP C  R KR+D++LQH+  K
Sbjct: 844 SDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 901

>TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543
           YPR186C
          Length = 472

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 4/53 (7%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWC----LSRQKRKDNLLQHMK 375
           H C  C   F RKS L+RHL+SHS ++ F C +C     +RQ+ K + + H K
Sbjct: 108 HSCDVCGSKFSRKSHLERHLISHSAEKPFHCSFCDKGLTTRQQLKRHEITHSK 160

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 321 SDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKL 376
           S++   + C+ C K FKR S L  H+  H+  + ++CP+  C      K N+L+H KL
Sbjct: 252 SEEIAKYGCKHCNKRFKRPSSLNTHMNIHTGNKPYVCPYEECRKSFNAKSNMLRHYKL 309

>Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 321 SDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 377
           SD   I+ C+ C + F     L RH  S HS ++   CP C  R KR+D++LQH+  K
Sbjct: 822 SDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No
           homolog in Saccharomyces cerevisiae
          Length = 173

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 317 PAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHM 374
           PA S  +     C  C KSF RK+ L+ H+L H++ + + CP+  C      K NL +H 
Sbjct: 106 PANSVHKVSGKTCAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHE 165

Query: 375 KLKHTN 380
           ++   N
Sbjct: 166 RIHKRN 171

>KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}
           Anc_3.298
          Length = 394

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 34/61 (55%), Gaps = 3/61 (4%)

Query: 318 APSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 375
           +PS+D K  + C+ C K FKR S L  H+  H+  + + CP+  C      K N+L+H K
Sbjct: 270 SPSTD-KVKYCCKVCSKRFKRPSSLSTHMNIHTGYKPYQCPFSNCQKSFNAKSNMLRHYK 328

Query: 376 L 376
           L
Sbjct: 329 L 329

>TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1375

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKH 378
           C  C ++F R+  L RH  SH++++ + C  C  +  R+D LL+H +  H
Sbjct: 46  CSICTRAFARQEHLTRHERSHTKEKPYCCGLCQRKFSRRDLLLRHAQKIH 95

>Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 373
           C  C + F R+  LKRH  +H+ ++ FLC +C     R+D +L+H
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 107

>KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.144
           YER130C
          Length = 225

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 329 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           CQ+C + F+R+  +KRH+ S H  ++ + C  C     R DNL QH K
Sbjct: 173 CQYCHRRFRRQEHMKRHIRSLHIAEKPYSCQICSKAFSRNDNLKQHRK 220

>Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 373
           C  C + F R+  LKRH  +H+ ++ FLC +C     R+D +L+H
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 107

>KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5.586
           YHR006W
          Length = 314

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 12/65 (18%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQ------------KRKDNLLQHMKL 376
           C +C+  F+ + +L RH+  H+ ++ F CP+    Q             R+D    H+K+
Sbjct: 63  CHYCDARFRMRGYLTRHIKKHAIEKAFRCPFFQRGQPRDLQCHPSGGFSRRDTYKTHLKV 122

Query: 377 KHTNY 381
           KH  Y
Sbjct: 123 KHVLY 127

>TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.303
           YNL027W
          Length = 532

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%)

Query: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           I+ C  CEK F R   L+ HL +H+ +R F+C  C     R+ +  +H  L
Sbjct: 419 IYDCVICEKKFTRPYNLRSHLRTHTNERPFVCTVCGKAFAREHDRKRHEDL 469

>AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL056C (ZAP1)
          Length = 661

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 388
           C +C K F   S L+ H+ +H+ ++   C  C  R     NL +HMK+    Y+    K+
Sbjct: 574 CHYCRKQFSTSSSLRVHIRTHTGEKPLSCTVCGKRFNESSNLSKHMKIHERKYMCKLCKR 633

>YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}
           TDA9DNA-binding protein, putative transcription factor;
           green fluorescent protein (GFP)-fusion protein localizes
           to the nucleus; null mutant is sensitive to expression
           of the top1-T722A allele; not an essential gene
          Length = 1251

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 373
           C  C + F R+  LKRH  +H+ ++ FLC +C     R+D +L+H
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 107

>Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON}
           complement(28325..32557) [4233 nt, 1411 aa]
          Length = 1410

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 373
           C  C ++F R+  L RH  SH++++ + C  C  +  R+D LL+H
Sbjct: 120 CSICTRAFARQEHLTRHERSHTKEKPYCCGICQRKFSRRDLLLRH 164

>YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON}
           Putative zinc finger protein; YPR013C is not an
           essential gene
          Length = 317

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 26/57 (45%), Gaps = 2/57 (3%)

Query: 321 SDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 375
           S  K   QC  C K   R S LK H L H+    F C W  C      K N+L+H+K
Sbjct: 248 SSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLK 304

>AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR067C
          Length = 838

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 320 SSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHT 379
           +S +KYI  C FC ++F R     RH  SH+  + F C  C     R+D L +H++  H 
Sbjct: 3   ASQRKYI--CSFCAQAFSRSEHKTRHERSHTGVKPFSCKVCNHSFVRRDLLQRHIRTVHR 60

Query: 380 NYLLD 384
           + LL+
Sbjct: 61  SMLLE 65

>CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} similar
           to uniprot|P27705 Saccharomyces cerevisiae YGL035c MIG1
           transcriptional repressor
          Length = 424

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMKLKHTNYL 382
           H C  C ++F R     RH+ +H+ ++   C  P C+ R  R D L +H ++ HTN L
Sbjct: 43  HVCPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRI-HTNPL 99

>AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER169W
           (RPH1) and YDR096W (GIS1)
          Length = 799

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 321 SDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 377
           SD+   + CQ C++ F     L RH  S HS ++   CP C  + KR+D++LQH+  K
Sbjct: 726 SDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 783

>KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON} 
          Length = 370

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 375
           QC  C K   R S LK H L H+    F CPW  C      K N+L+H K
Sbjct: 299 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCPWKGCTKSFNVKSNMLRHFK 348

>TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {ON}
           Anc_2.162 YOR113W
          Length = 717

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNL----LQHMKLK 377
           QC+FC K F +   L+ H   H+ ++ + C  C  R  RK NL    L H KLK
Sbjct: 438 QCEFCGKRFTQGGNLRTHQRLHTGEKPYNCEMCGKRFSRKGNLAAHALTHQKLK 491

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           H+C +C + F + + L+ H+ SH   + F C +C  R  +  NL  H +L
Sbjct: 409 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEFCGKRFTQGGNLRTHQRL 458

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 18/31 (58%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC 357
           + C+ C K F RK  L  H L+H + + ++C
Sbjct: 465 YNCEMCGKRFSRKGNLAAHALTHQKLKPYIC 495

>SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]
           {ON} similar to uniprot|P39956 Saccharomyces cerevisiae
           YER169W RPH1 Transcriptional repressor of PHR1 which is
           a photolyase induced by DNA damage binds to AG(4)
           (C(4)T) sequence upstream of PHR1 Rph1p phosphorylation
           during DNA damage is under control of the MEC1-RAD53
           pathway
          Length = 814

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 321 SDQKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 377
           S++  ++ CQ C++ F     L RH  S HS ++   CP C  + KR+D++LQH+  K
Sbjct: 712 SEKGKVYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 769

>NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 322 DQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKL 376
           D+K  + C  C K F+R S L+ H    S  R + CP+  C      K N+L+H KL
Sbjct: 234 DEKLGYFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKL 290

>SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {ON}
           some similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 548

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%)

Query: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           I+ C+ C+K F R   LK HL +H+ +R F C  C     R+ +  +H  L
Sbjct: 423 IYACELCDKKFTRPYNLKSHLRTHTDERPFACNVCGKAFARQHDRKRHEDL 473

>Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar to
           Ashbya gossypii AGR031W
          Length = 257

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 4/63 (6%)

Query: 322 DQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMK--LK 377
           +++  H+CQ C+K F     L RH   H+ +++  C  P C  R  R DN LQH +  LK
Sbjct: 188 EKRRKHRCQTCDKGFTTSGHLARHNRIHTGEKNHRCHFPGCGQRFSRHDNCLQHYRTHLK 247

Query: 378 HTN 380
            T+
Sbjct: 248 KTS 250

>KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 782

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 380
           C+FC K F +   L+ H+  H+ ++ + C  C  +  RK NL  H KL H N
Sbjct: 553 CEFCGKRFTQGGNLRTHIRLHTGEKPYECERCGRKFSRKGNLAAH-KLTHDN 603

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           QC +C K F + + L+ H+ SH   + F C +C  R  +  NL  H++L
Sbjct: 524 QCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEFCGKRFTQGGNLRTHIRL 572

>KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON} 
          Length = 467

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 380
           QCQFC K F +   L+ H   H+ ++ + C  C  R  RK NL  H+ L H N
Sbjct: 331 QCQFCGKKFTQGGNLRTHQRLHTGEKPYQCESCGRRFSRKGNLAAHI-LTHKN 382

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 27/50 (54%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           H+C +C + F + + L+ H+ SH   + F C +C  +  +  NL  H +L
Sbjct: 302 HECPYCHRLFSQSTHLEVHIRSHIGYKPFQCQFCGKKFTQGGNLRTHQRL 351

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 2/64 (3%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKLKHTNYLLD 384
           +QC+ C + F RK  L  H+L+H   + F+C    C     +  N+  H    H N L++
Sbjct: 358 YQCESCGRRFSRKGNLAAHILTHKNLKPFVCKLDNCDKSFTQLGNMKAHQNRFHLNTLIE 417

Query: 385 ELKK 388
              K
Sbjct: 418 LTNK 421

>Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C -
           Hypothetical ORF [contig 227] FULL
          Length = 254

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMKL 376
           H+C+ C K+F R S L  H L H+  + + C  P C  R   K NL++H K+
Sbjct: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKI 245

>CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some
           similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c or uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q03825 Saccharomyces
           cerevisiae YMR164c MSS11
          Length = 344

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 27/57 (47%), Gaps = 2/57 (3%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKLKHTNYL 382
           QC  C K   R S LK H+L H+    F C W  C      K NLL+H+K    N L
Sbjct: 285 QCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLKSHEKNSL 341

>Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {ON}
           similar to Ashbya gossypii AFR580C
          Length = 938

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 320 SSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHT 379
           +S +KYI  C FC ++F R     RH  SH+  + F C  C     R+D L +H++  H 
Sbjct: 3   ASQRKYI--CCFCARAFSRSEHRTRHERSHTGVKPFSCKVCSHSFVRRDLLQRHIRTVHR 60

Query: 380 NYLLD 384
           + LL+
Sbjct: 61  SMLLE 65

>KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 526

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 380
           ++ C+ C+K F R   LK HL +H+ +R F C  C     R+ +  +H  L HT 
Sbjct: 407 VYACELCDKKFTRPYNLKSHLRTHTDERPFACAICGKAFARQHDRKRHEDL-HTG 460

>NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {ON}
           Anc_8.425
          Length = 1152

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKH 378
           C  C ++F R+  L RH  SH+ ++ + C  C  +  R+D LL+H +  H
Sbjct: 80  CDVCSRAFARQEHLDRHARSHTNEKPYQCGICTKKFTRRDLLLRHAQKVH 129

>KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON}
           Anc_8.425 YDR216W
          Length = 627

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%)

Query: 321 SDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 380
           S  K    C  C+K+F R+  L RHL SH+ ++ F C  C     R+D L++H    H++
Sbjct: 43  SGNKRTFLCFVCQKAFARQEHLDRHLRSHTNEKPFKCAVCDKDFTRRDLLIRHSNKLHSD 102

>TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1207

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 373
           CQ C ++F R+  L RH  SH++++ + C  C     R+D LL+H
Sbjct: 61  CQICTRAFARQEHLTRHERSHTKEKPYSCGICNRNFSRRDLLLRH 105

>AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; No
           homolog in Saccharomyces cerevisiae'
          Length = 336

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKL 376
           QC  C K   R S L+ H+  H+ +R FLC W  C  R   K N+++H +L
Sbjct: 275 QCPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRL 325

>SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {ON}
           conserved hypothetical protein
          Length = 288

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 324 KYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKL 376
           K  H C  C KSF+R S LK H + H  +  + C W  C  R   K NLL+H ++
Sbjct: 215 KLQHLCPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHYRI 269

>TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.214
           YGR067C
          Length = 770

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 33/70 (47%)

Query: 316 MPAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           MP  S  Q+  + C +C K F R     RH  SH+  + F C  C     R+D L +H++
Sbjct: 1   MPTNSQSQQKKYICSYCGKPFSRSEHKARHERSHTGVKPFECKVCRHSFVRRDLLQRHIR 60

Query: 376 LKHTNYLLDE 385
             H   LL E
Sbjct: 61  TVHRELLLVE 70

>KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1053

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 373
           C  C + F R   LKRH  SH++++ +LC +C     RKD +L+H
Sbjct: 24  CPVCSRGFVRLEHLKRHQRSHTREKPYLCVFCGRCFARKDLVLRH 68

>Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to
           Ashbya gossypii AGR186C
          Length = 312

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           C  C KSF R+S L+ HLL H+  + F C +C      K NL +H ++
Sbjct: 173 CPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCEKEFNVKSNLNRHERI 220

>KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C
          Length = 922

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 320 SSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHT 379
           +S +KYI  C FC K F R     RH  SH+  + F C  C     R+D L +H++  H 
Sbjct: 3   ASQRKYI--CSFCAKPFSRSEHKARHERSHTGSKPFSCSICSHSFVRRDLLQRHIRTVHK 60

Query: 380 NYLLDELK 387
           + L   LK
Sbjct: 61  SSLNSMLK 68

>KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.162
           YOR113W
          Length = 729

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHM 374
           +QCQ+C K F +   L+ H   H+ ++ + C  C  R  RK NL  H+
Sbjct: 521 YQCQYCGKKFTQGGNLRTHERLHTGEKPYQCELCGKRFSRKGNLAAHV 568

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 28/50 (56%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           H+C++C + F + + L+ H+ SH   + + C +C  +  +  NL  H +L
Sbjct: 493 HECRYCHRFFTQLTHLEVHIRSHIGIKPYQCQYCGKKFTQGGNLRTHERL 542

>TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {ON}
           Anc_2.162 YOR113W
          Length = 714

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHM 374
           QCQ+C K F +   L+ H   H+ ++ + C  C  R  RK NL  H+
Sbjct: 453 QCQYCGKRFTQGGNLRTHQRLHTGEKPYECELCGKRFSRKGNLAAHV 499

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           H+C +C + F + + L+ H+ SH   + F C +C  R  +  NL  H +L
Sbjct: 424 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCQYCGKRFTQGGNLRTHQRL 473

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKLKHTNYL 382
           ++C+ C K F RK  L  H+++H + + F+C    C     +  N+  H    H N L
Sbjct: 480 YECELCGKRFSRKGNLAAHVVTHQKLKPFICKLDGCNKTFTQLGNMKAHQNRFHLNTL 537

>SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P27705 Saccharomyces
           cerevisiae YGL035C MIG1 Transcription factor involved in
           glucose repression; C2H2 zinc finger protein similar to
           mammalian Egr and Wilms tumor proteins
          Length = 548

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 5/65 (7%)

Query: 318 APSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMK 375
            P S + Y+  C  C ++F R     RH+ +H+ ++   C  P C  R  R D L +H +
Sbjct: 27  GPDSPRPYV--CPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTR 84

Query: 376 LKHTN 380
           + HTN
Sbjct: 85  I-HTN 88

>TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.162
           YOR113W
          Length = 425

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHM 374
           H+C+FC   F +   LK H   H+ ++ F C  C  +  RK NL  H+
Sbjct: 279 HKCRFCNVCFTQSGNLKTHEKLHTSEKDFECEICNKKFSRKGNLASHI 326

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 19/32 (59%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW 359
           +C+ C K F RK  L  H+ +H++ R  +C +
Sbjct: 308 ECEICNKKFSRKGNLASHIATHNRLRLHICKF 339

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           QC FC K F + S  + H+ SH   +   C +C     +  NL  H KL
Sbjct: 252 QCSFCLKVFNQASHFEVHIRSHIGYKPHKCRFCNVCFTQSGNLKTHEKL 300

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 324 KYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCP--WCLSRQKRKDNLLQHMKL 376
           K  + C  C K FKR S L  H+  H+ Q+ + CP   C      K N+L+H KL
Sbjct: 267 KIKYDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHISCSKAFNAKSNMLRHYKL 321

>YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}
           AZF1Zinc-finger transcription factor, involved in
           induction of CLN3 transcription in response to glucose;
           genetic and physical interactions indicate a possible
           role in mitochondrial transcription or genome
           maintenance
          Length = 914

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           H+C +C + F + + L+ H+ SH   + F+C +C  R  +  NL  H +L
Sbjct: 593 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERL 642

 Score = 37.0 bits (84), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 23/46 (50%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHM 374
           C +C K F +   L+ H   H+ ++ + C  C  +  RK NL  H+
Sbjct: 623 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 668

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC 357
           + C  C+K F RK  L  HL++H + + F+C
Sbjct: 649 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVC 679

>TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.326
           YJL056C
          Length = 985

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           ++C+ C KSF   S LK H+ +H+ ++ F C  C  R     N  +HMK+
Sbjct: 928 YKCEICGKSFSISSSLKIHVRTHTGEKPFECKVCGKRFVESSNYSKHMKV 977

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 324 KYIHQCQF--CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMK 375
           K  ++C++  C K FK++  + RHL +HS  + F C  C      K+ L+QH +
Sbjct: 867 KNSYECKWHNCHKVFKQRQKILRHLKTHSGFKPFKCDVCSRCFSSKETLIQHYR 920

>Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}
           YDR043C (REAL)
          Length = 232

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 323 QKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 375
           +KYI  C+ C + F     L RH   H+ +++  CP+  C  R  R DN LQH +
Sbjct: 173 RKYI--CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYR 225

>Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii ADL042W
          Length = 305

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 320 SSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 375
           SS +K    C+ C K FKR S L+ H++ H+  + + C    C  R   K N+L+HM+
Sbjct: 242 SSYRKSGSICEICGKDFKRPSALRTHMVVHNNDKPYKCEHIDCQKRFNVKSNMLRHMR 299

>SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {ON}
           weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 441

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKL 376
           QC  C K F R S L+ H L H+  R F C W  C      K N+++H +L
Sbjct: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRL 432

>TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON}
           Anc_8.234 YER169W
          Length = 519

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 329 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 377
           C  C +SF     L RH  + H  ++ F CP C  R KR+D++LQH+  K
Sbjct: 449 CFECRRSFSSSHHLTRHRKTVHLNEKPFSCPKCGKRFKRRDHVLQHLNKK 498

>KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 596

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%)

Query: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWC 360
           ++ C  C+K F R   LK HL SH+ +R ++C  C
Sbjct: 468 VYACDICDKKFTRPYNLKSHLRSHTDERPYVCSVC 502

>KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518
           YGL209W
          Length = 439

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 319 PSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMK 375
           P +D+   ++C  C + F R    KRHL +H+ ++   C  P C     R D L +H++
Sbjct: 12  PENDENRPYKCGICSRGFHRLEHKKRHLRTHTGEKPHKCVFPGCTKGFSRGDELKRHLR 70

>Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 bp,
           515 aa] {ON} YGL035C (REAL)
          Length = 515

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMKLKHTN 380
           H C  C+++F R     RH+  H+ ++   C  P C+ R  R D L +H ++ HTN
Sbjct: 38  HACPICQRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRI-HTN 92

>TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.117
           YPR015C
          Length = 162

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 375
           QC  C K   R S LK H L H+    F C W  C      K N+L+H+K
Sbjct: 102 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCSWGNCTKSFNVKSNMLRHLK 151

>ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 930

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           H+C +C + F + + L+ H+ SH   + FLC  C  R  +  NL  H +L
Sbjct: 562 HECPYCHRFFTQSTHLEVHVRSHIGYKPFLCECCGKRFTQGGNLRTHQRL 611

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKLKHTNYL 382
           ++C+ C K F RK  L  H+++H + + F+C    C     +  N+  H    H N L
Sbjct: 618 YECELCGKRFSRKGNLAAHIVTHQKLKPFVCKLDGCNKTFTQLGNMKAHQNRFHLNTL 675

>Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113W
           (REAL)
          Length = 917

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           H+C +C + F + + L+ H+ SH   + F+C +C  R  +  NL  H +L
Sbjct: 594 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERL 643

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 23/46 (50%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHM 374
           C +C K F +   L+ H   H+ ++ + C  C  +  RK NL  H+
Sbjct: 624 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 669

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC 357
           + C  C+K F RK  L  HL++H + + F+C
Sbjct: 650 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVC 680

>KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {ON} 
          Length = 519

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 324 KYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 375
           K   QC  C K   R S LK H + H+    F CPW  C      K N+ +H+K
Sbjct: 452 KLRKQCPVCGKICSRPSTLKTHYMIHTGDTPFKCPWEGCNKSFNVKSNMFRHLK 505

>NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON}
           Anc_2.162
          Length = 1064

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKH 378
           QC FC K F +   L+ H   H+ ++ + C  C  R  RK NL  H KL H
Sbjct: 629 QCNFCGKRFTQGGNLRTHQRLHTGEKPYRCEICDKRFSRKGNLAAH-KLTH 678

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           H+C +C + F + + L+ H+ SH   + F C +C  R  +  NL  H +L
Sbjct: 600 HECPYCHRLFSQSTHLEVHIRSHLGYKPFQCNFCGKRFTQGGNLRTHQRL 649

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 2/64 (3%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKLKHTNYLLD 384
           ++C+ C+K F RK  L  H L+H   + F+C    C     +  N+  H    H   LL+
Sbjct: 656 YRCEICDKRFSRKGNLAAHKLTHRDVKPFVCKLDNCNKTFTQLGNMKAHQNKFHLQTLLE 715

Query: 385 ELKK 388
              K
Sbjct: 716 LTSK 719

>NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {ON}
           Anc_6.256
          Length = 409

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 332 CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKH 378
           C   F R+  L RH+  H+ ++ F C  CL    R DNL QH +  H
Sbjct: 23  CSMVFTREEHLARHIRKHTGEKPFQCDICLRFFSRVDNLKQHRETVH 69

>KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.303
           YNL027W
          Length = 618

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%)

Query: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           I+ C  C+K F R   LK HL +H+ +R F+C  C     R+ +  +H  L
Sbjct: 498 IYACDMCDKKFTRPYNLKSHLRTHTNERPFVCSICGKAFARQHDRKRHEDL 548

>Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W
           (REAL)
          Length = 535

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 39/76 (51%), Gaps = 12/76 (15%)

Query: 318 APSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW---CLSRQ---------K 365
           A  S +   + C +C+  F+ + +L RH+  H++++ + CP+    +S++          
Sbjct: 196 ADESSETLPYVCHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDDSISQELRCHTSGGFS 255

Query: 366 RKDNLLQHMKLKHTNY 381
           R+D    H+K +H NY
Sbjct: 256 RRDTYKTHLKSRHFNY 271

>Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113W
           (REAL)
          Length = 909

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           H+C +C + F + + L+ H+ SH   + F+C +C  R  +  NL  H +L
Sbjct: 583 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERL 632

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 23/46 (50%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHM 374
           C +C K F +   L+ H   H+ ++ + C  C  +  RK NL  H+
Sbjct: 613 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 658

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC 357
           + C  C+K F RK  L  HL++H + + F+C
Sbjct: 639 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVC 669

>Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {ON}
           YDR043C (NRG1) - transcriptional repressor which can
           bind to UAS-1 in the STA1 promoter and which can
           interact with Ssn6p [contig 33] FULL
          Length = 264

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 322 DQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCP--WCLSRQKRKDNLLQHMK 375
           +Q+  + C+ C K F     L RH   H+ +++ +CP   C  R  R DN +QH K
Sbjct: 196 EQRRRYVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQHYK 251

>KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.162
           YOR113W
          Length = 796

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 373
           +CQFC K F +   L+ H   H+ ++ + C  C  R  RK NL  H
Sbjct: 501 ECQFCGKRFTQGGNLRTHQRLHTGEKPYACQHCSKRFSRKGNLAAH 546

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%)

Query: 323 QKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           Q+  H+C +C   F + + L+ H+ SH   + F C +C  R  +  NL  H +L
Sbjct: 468 QQKKHECPYCHHKFAQTTHLEVHVRSHLGYKPFECQFCGKRFTQGGNLRTHQRL 521

 Score = 37.0 bits (84), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 2/60 (3%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKLKHTNYLLD 384
           + CQ C K F RK  L  H L+H + + FLC    C     +  N+  H    H+  +L+
Sbjct: 528 YACQHCSKRFSRKGNLAAHQLTHREVKPFLCKLDNCGKTFAQLGNMKNHQNRFHSQTVLE 587

>KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.80
           YGL035C
          Length = 335

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMKLKHTN 380
           H C  C+++F R     RH+ +H+ ++   C  P C+ R  R D L +H ++ HTN
Sbjct: 21  HVCPICQRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRI-HTN 75

>Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON}
           (65876..67336) [1461 nt, 487 aa]
          Length = 486

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 320 SSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKL 376
           +S++K  ++C  C K   R   L  H+L H++ R + C W  C      K NL +H+K+
Sbjct: 417 TSNKKATYECSVCGKRVTRAYSLHAHMLIHTKVRPYKCDWENCGKTFNVKSNLNRHVKI 475

>Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {ON}
           YPR186C (REAL)
          Length = 432

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 31/52 (59%), Gaps = 4/52 (7%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWC----LSRQKRKDNLLQHMK 375
           QC  C KSF +KS L+RHL SHS  + F C +C     +RQ+ K + + H K
Sbjct: 84  QCDKCPKSFVKKSHLERHLYSHSDTKPFQCSYCGKGVTTRQQLKRHEVTHTK 135

>AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON}
           NOHBY743; No homolog in Saccharomyces cerevisiae
          Length = 287

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           C  C KSF R+S L+ HLL H+  + F C +C      K NL +H ++
Sbjct: 169 CPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCDKEFNVKSNLNRHERI 216

>CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa]
           {ON} weakly similar to uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 463

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 323 QKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 375
           +KY+  C+ C K F     L RH   H+ ++  +CP+  C  R  R DN LQH K
Sbjct: 400 RKYL--CKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYK 452

>NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa]
           {ON} Anc_3.518
          Length = 426

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMK 375
           +CQFC + F R    KRH+ +H+ ++  +C  P C     R+D L +H++
Sbjct: 22  RCQFCSRGFHRLEHKKRHVRTHTGEKPHVCNFPHCKKGFSRRDELKRHIR 71

>ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL027W (CRZ1)
          Length = 547

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376
           I+ C  C+K F R   LK HL +H+ +R F C  C     R+ +  +H  L
Sbjct: 425 IYSCNLCDKKFTRPYNLKSHLRTHTDERPFSCSVCGKAFARQHDRKRHEDL 475

>YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON}
           PZF1Transcription factor IIIA (TFIIIA); essential DNA
           binding protein required for transcription of 5S rRNA by
           RNA polymerase III; not involved in transcription of
           other RNAP III genes; nine conserved zinc fingers; may
           also bind 5S rRNA
          Length = 429

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 31/52 (59%), Gaps = 4/52 (7%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWC----LSRQKRKDNLLQHMK 375
           QC  C KSF +KS L+RHL +HS  + F C +C     +RQ+ K + + H K
Sbjct: 81  QCDKCAKSFVKKSHLERHLYTHSDTKPFQCSYCGKGVTTRQQLKRHEVTHTK 132

>YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbon
           source-responsive zinc-finger transcription factor,
           required for transcription of the glucose-repressed gene
           ADH2, of peroxisomal protein genes, and of genes
           required for ethanol, glycerol, and fatty acid
           utilization
          Length = 1323

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%)

Query: 329 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYL 382
           C+ C ++F R+  LKRH  SH+ ++ + C  C     R+D L++H +  H+  L
Sbjct: 106 CEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNL 159

>KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {ON}
           similar to uniprot|P39933 Saccharomyces cerevisiae
           YPR186C PZF1 Transcription factor IIIA (TFIIIA) with
           putative Zn-fingers
          Length = 472

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 328 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWC----LSRQKRKDNLLQHMKLKHTNY 381
           +C  C K F +KS L RH+ SH+  + F C  C     +RQ+ K + + H K  H +Y
Sbjct: 138 KCDTCGKEFAKKSHLNRHMFSHTDDKPFTCSICGKGVTTRQQLKRHEITHTKSFHCSY 195

>TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298
          Length = 833

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCP--WCLSRQKRKDNLLQHMKL 376
           ++C++C K F+R S LK HL  H+  + F CP   C      + N+L+H KL
Sbjct: 714 NKCEYCLKKFRRPSSLKTHLNIHTGIQPFKCPSKRCDKSFNARSNMLRHYKL 765

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.132    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,570,207
Number of extensions: 848141
Number of successful extensions: 4149
Number of sequences better than 10.0: 597
Number of HSP's gapped: 3853
Number of HSP's successfully gapped: 733
Length of query: 419
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 307
Effective length of database: 40,638,807
Effective search space: 12476113749
Effective search space used: 12476113749
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)