Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_13.2442.532ON25725710561e-146
Skud_13.2252.532ON2542587861e-105
Smik_13.2482.532ON2552597701e-103
YMR069W (NAT4)2.532ON2852597502e-99
KAFR0A018502.532ON2562222942e-31
NCAS0D026402.532ON2602702786e-29
CAGL0K02981g2.532ON2782192492e-24
NDAI0I022702.532ON2772252412e-23
TDEL0A030602.532ON2442212359e-23
TPHA0C041802.532ON2641602183e-20
KNAG0C058202.532ON2712252193e-20
Kpol_1018.342.532ON2922092132e-19
SAKL0A09460g2.532ON2401531911e-16
ZYRO0B01980g2.532ON1881491839e-16
KLTH0D06820g2.532ON2601681815e-15
TBLA0G022202.532ON2781421711e-13
Kwal_26.80162.532ON2401491303e-08
Ecym_72562.532ON243161870.010
NOTE: 2 genes in the same pillar as Suva_13.244 were not hit in these BLAST results
LIST: Agos_YGOB_Anc_2.532 KLLA0E18569g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_13.244
         (257 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)...   411   e-146
Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W...   307   e-105
Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W...   301   e-103
YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N alph...   293   2e-99
KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.53...   117   2e-31
NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON...   111   6e-29
CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly...   100   2e-24
NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.53...    97   2e-23
TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.53...    95   9e-23
TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.53...    89   3e-20
KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {...    89   3e-20
Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {...    87   2e-19
SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly ...    78   1e-16
ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some si...    75   9e-16
KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some si...    74   5e-15
TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.53...    70   1e-13
Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W ...    55   3e-08
Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON} ...    38   0.010

>Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)
           [771 bp, 257 aa] {ON} YMR069W (REAL)
          Length = 257

 Score =  411 bits (1056), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 247/257 (96%), Positives = 247/257 (96%)

Query: 1   MFQQFLSICMEEFPQTLDYTGSDDENGDSTTTLLRRQMMYMPEDDGDDGGIDTPECMNYK 60
           MFQQFLSICMEEFPQTLDYTGSDDENGDSTTTLLRRQMMYMPEDDGDDGGIDTPECMNYK
Sbjct: 1   MFQQFLSICMEEFPQTLDYTGSDDENGDSTTTLLRRQMMYMPEDDGDDGGIDTPECMNYK 60

Query: 61  LHKADGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGN 120
           LHKADGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGN
Sbjct: 61  LHKADGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGN 120

Query: 121 DAQGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXXHXXXXXXXXXXAKALC 180
           DAQGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVH  H          AKALC
Sbjct: 121 DAQGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXXHRGRGLGRRLLAKALC 180

Query: 181 EGVAARVRRTCDDLFGVALTVFGDNTRARRLYESXXXXXXXXXXXXXXXXXXXXXXXGRA 240
           EGVAARVRRTCDDLFGVALTVFGDNTRARRLYES                       GRA
Sbjct: 181 EGVAARVRRTCDDLFGVALTVFGDNTRARRLYESXXXXXXXXXXXXXXXXXXXXXXXGRA 240

Query: 241 AAVARDPLYYVYCLRLA 257
           AAVARDPLYYVYCLRLA
Sbjct: 241 AAVARDPLYYVYCLRLA 257

>Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W
           (REAL)
          Length = 254

 Score =  307 bits (786), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 159/258 (61%), Positives = 184/258 (71%), Gaps = 7/258 (2%)

Query: 1   MFQQFLSICMEEFPQTLDYTGSDDENGDSTTTLLRRQMMYMPEDDGDDGGIDTPECMNYK 60
           MF++FLSIC++EFP+TL+YT S++     TTT+L+R++MY+PE++G+   ID P+C NY 
Sbjct: 1   MFKKFLSICIDEFPETLEYTESNENATVVTTTVLKREIMYIPEENGEVDSIDGPQCTNYN 60

Query: 61  LHKADGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGN 120
           LHK+ GD  L SCVQLVDEHLG KYRRASRTMYGNR+PWKANKLAEMKSAGL+YV YWGN
Sbjct: 61  LHKSHGDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWGN 120

Query: 121 DAQGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXXHXX--XXXXXXXXAKA 178
                 ALGAFASFMLTEETGLVEGD AHE SVPVIYLYE+H  H             +A
Sbjct: 121 G-----ALGAFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVAHAHRGHGLGRRLLERA 175

Query: 179 LCEGVAARVRRTCDDLFGVALTVFGDNTRARRLYESXXXXXXXXXXXXXXXXXXXXXXXG 238
           LCEGVA RVRR   D FGVALTVFGDNTRARRLYE+                        
Sbjct: 176 LCEGVARRVRRVRCDFFGVALTVFGDNTRARRLYEAIGFCRAPGSPAPAAPALRPTRHGR 235

Query: 239 RAAAVARDPLYYVYCLRL 256
           +   VARDPLYYVYCL +
Sbjct: 236 KRVVVARDPLYYVYCLHM 253

>Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W
           (REAL)
          Length = 255

 Score =  301 bits (770), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 152/259 (58%), Positives = 176/259 (67%), Gaps = 8/259 (3%)

Query: 1   MFQQFLSICMEEFPQTLDYTGSDDENGDSTTTLLRRQMMYMPEDDGDDG-GIDTPECMNY 59
           MF QFL ICM++FP+TL+YT +D  NG +TTT+L+R+M+++PE D +    I+ P C+NY
Sbjct: 1   MFHQFLKICMQDFPETLEYTNTDGNNGTATTTVLKREMLFIPEGDSNSQDNIEIPTCVNY 60

Query: 60  KLHKADGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWG 119
           +LHK+ G+  L SCVQL+DEHLGAKYRRASRTMYGNR PWKANKLAEMKS  LVYV YW 
Sbjct: 61  RLHKSRGNHILDSCVQLIDEHLGAKYRRASRTMYGNRKPWKANKLAEMKSPNLVYVSYWD 120

Query: 120 NDAQGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXX--HXXXXXXXXXXAK 177
           N      AL AFASFMLTEETGLVEGD AHE SVPVIYLYEVH    H           +
Sbjct: 121 NG-----ALAAFASFMLTEETGLVEGDAAHEVSVPVIYLYEVHVACVHRGHGIGRRLLER 175

Query: 178 ALCEGVAARVRRTCDDLFGVALTVFGDNTRARRLYESXXXXXXXXXXXXXXXXXXXXXXX 237
           ALCEGVA  VR   ++ FGVALTVF DNTRARRLYE+                       
Sbjct: 176 ALCEGVARHVRCLYEEFFGVALTVFSDNTRARRLYEALGFYRAPGSPAAGAPTTRPTRHG 235

Query: 238 GRAAAVARDPLYYVYCLRL 256
           G    V RDPLYYVYCL +
Sbjct: 236 GERVVVPRDPLYYVYCLHM 254

>YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N
           alpha-acetyl-transferase, involved in acetylation of the
           N-terminal residues of histones H4 and H2A
          Length = 285

 Score =  293 bits (750), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 148/259 (57%), Positives = 176/259 (67%), Gaps = 9/259 (3%)

Query: 1   MFQQFLSICMEEFPQTLDYTGSDDENGDSTTTLLRRQMMYMPEDDGDD-GGIDTPECMNY 59
           MFQ FL++C+E+FP+++++  +D  NG+ TT +L R+++Y+PEDD D    +D+ +C+NY
Sbjct: 32  MFQHFLNLCVEKFPESIEHKDTDG-NGNFTTAILEREIIYIPEDDTDSIDSVDSLKCINY 90

Query: 60  KLHKADGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWG 119
           KLHK+ GDQ L +CVQL+D+HLGAKYRRASR MYGNR PWKANKLAEMKSAGLVYVCYW 
Sbjct: 91  KLHKSRGDQVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYWD 150

Query: 120 NDAQGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVH--XXHXXXXXXXXXXAK 177
           N       LGAF SFMLTEETGLVEGD  HE SVPVIYLYEVH    H            
Sbjct: 151 NG-----VLGAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEH 205

Query: 178 ALCEGVAARVRRTCDDLFGVALTVFGDNTRARRLYESXXXXXXXXXXXXXXXXXXXXXXX 237
           ALC+GVA   RR CD+ FGVALTVF DNTRARRLYE+                       
Sbjct: 206 ALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEALGFYRAPGSPAPASPTIRHTRHG 265

Query: 238 GRAAAVARDPLYYVYCLRL 256
           G    V  DPLYYVYCL +
Sbjct: 266 GGRVVVPCDPLYYVYCLHM 284

>KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.532
           YMR069W
          Length = 256

 Score =  117 bits (294), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 111/222 (50%), Gaps = 27/222 (12%)

Query: 1   MFQQFLSICMEEFPQTLDYTGSDDENGDSTTTLLRRQMMYMPEDDGDDGGIDTPECMN-- 58
           +F  FL I  +EFP+ L   G +          L+R+++Y+  +D ++   D+   +N  
Sbjct: 6   IFNGFLKIVSDEFPKELRTKGQN----------LKRKILYIASEDEENKESDS--VINEQ 53

Query: 59  ---YKLHKADGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYV 115
               K  +  G + L S ++++D +LG KY + SR +Y N   WK NKL EMKS GL+YV
Sbjct: 54  DDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYV 113

Query: 116 CYWGNDAQGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXXHX----XXXXX 171
            YW  +A+ ++    F SFMLTEE  +V+      +   VIYLYE+              
Sbjct: 114 SYWKEEAE-KKTCALFLSFMLTEEDFVVDDI----RKFSVIYLYEIQLIEKYRGCQLGTR 168

Query: 172 XXXXAKALCEGVAARVRRTCDDLFGVALTVFGDNTRARRLYE 213
                  +C+    ++R     L G+ LTVF DN RA + YE
Sbjct: 169 LIKGLSNVCQIAQVKIRPAF-PLIGIQLTVFSDNKRAIKFYE 209

>NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON}
           Anc_2.532 YMR069W
          Length = 260

 Score =  111 bits (278), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 80/270 (29%), Positives = 123/270 (45%), Gaps = 28/270 (10%)

Query: 2   FQQFLSICMEEFPQTLDYTGSDDENGDSTTTLLRRQMMYMPEDDGDDGGIDTPECMNYKL 61
           F+ F  + +EEFP TL+ T  +          L+R+++ + E D    G ++ + +  K 
Sbjct: 4   FEAFSHMILEEFPLTLEVTLQEQ------LKCLKRKILII-EPDNCTSGKNSQDVVYMKC 56

Query: 62  HKADGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGND 121
               GD+ L   + ++D +LG KY + S+ +Y N  PWK NKL EM+S GLVYV YW  D
Sbjct: 57  STDQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYW--D 114

Query: 122 AQGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXXHXXXXXXXXXXAKAL-C 180
            + +  +  F SFMLTEE G  E D    + + V+YLYE+                A   
Sbjct: 115 EESDEPM-LFLSFMLTEEDGFTEDD----KLLSVVYLYEIQILPSLRNRKLGTRLLAEHL 169

Query: 181 EGVAARVRRTCDDLF-----GVALTVFGDNTRARRLYESXXXXXXXXXXXXXXXXXXXXX 235
           +   +R+R    +L      G+ LTVF DN  A + Y+S                     
Sbjct: 170 QDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRR 229

Query: 236 XXGRAA--------AVARDPLYYVYCLRLA 257
             G A          + + P+YY++ L L+
Sbjct: 230 TRGMAQNISTSVGRTIVQKPIYYLFYLPLS 259

>CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069w
          Length = 278

 Score =  100 bits (249), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 69/219 (31%), Positives = 99/219 (45%), Gaps = 19/219 (8%)

Query: 5   FLSICMEEFPQTLDYTGSDDENGDSTTTLLRRQMMYMPEDDGDD----GGIDTPECMNYK 60
           FL   ++ FP+ +  T   +   D     L+R+++ +   DGDD        T E +   
Sbjct: 15  FLHHVLDCFPKVI--TTKSNLPKDIEDVQLQRKVLVI---DGDDYCLANKALTNEVVLRS 69

Query: 61  LHKADGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGN 120
            H  +    L S ++L+D++LG KY  +S+ MYGN+ PWK NK+ EM + G++YV YW  
Sbjct: 70  KHIKESKNILSSLLELLDQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSYWTK 129

Query: 121 DAQGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXXHXXXXXXXXXXAKALC 180
                     F SFMLTEE  L   D        VI+LYE+                + C
Sbjct: 130 VDDEHTVPLLFLSFMLTEEENLTHNDPVSS----VIFLYEIQISKELRKQGLGQYFLSNC 185

Query: 181 EGVAARVRRTCDDL------FGVALTVFGDNTRARRLYE 213
               A+     D L       G+ LTVF DN  A  LY+
Sbjct: 186 LFQCAKRLLDNDSLNLEFPFAGIELTVFADNLPAINLYQ 224

>NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.532
           YMR069W
          Length = 277

 Score = 97.4 bits (241), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 108/225 (48%), Gaps = 26/225 (11%)

Query: 5   FLSICMEEFPQTLDYTGSDDENGDSTTTLLRRQMMYMPEDDGDDGGID-TPECMNYKLHK 63
            L+I  EEFP  L       ++ D  TT  RR++ + P  D     I+ + E  N     
Sbjct: 9   LLNIVCEEFPTIL-------QSADGVTTW-RRRIHHKPSHDEVSIPIEHSSEVYNLSSDP 60

Query: 64  ADGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGNDAQ 123
                 L+  + ++D +LGAKY + S+T+Y N   WK+NKL EM S GL+YV YW  D +
Sbjct: 61  QQRSDVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYW--DEK 118

Query: 124 GERALGAFASFMLTEETGLV-------EGDTAHEQSVPVIYLYEVHXXHXX--XXXXXXX 174
            +  L  F SFMLTE  G +       + +  ++Q + VIYLYE+               
Sbjct: 119 YQEPL-LFLSFMLTEGDGFIGTHSNDDDENEHNDQLMSVIYLYEIQILPQLRGQGIGTKL 177

Query: 175 XAKALCEGVAARVRRTCDD-----LFGVALTVFGDNTRARRLYES 214
            +  L +  ++ V +   D     L G+ LTVF DN +A   Y+S
Sbjct: 178 LSVHLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKS 222

>TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.532
           YMR069W
          Length = 244

 Score = 95.1 bits (235), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 106/221 (47%), Gaps = 34/221 (15%)

Query: 11  EEFPQTLDYTGSDDENGDSTTTLLRRQMMYMPEDDGDDGGIDTPECMNYKLHKADGDQTL 70
           + FP T++  G            L R+++ +   D ++  ++T +C++Y     + ++ L
Sbjct: 15  QNFPTTINAAGIQ----------LTRKLLAI---DTEEYPVETDQCISYVHSPREAEKLL 61

Query: 71  HSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCY----WGNDAQGER 126
              ++++DE+LG KY  +SR +Y N  PW+ NK  EM + GLVYV Y         Q   
Sbjct: 62  WQLLEILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSTAATTTATQRRN 121

Query: 127 ALGA---FASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXXHXXXXXXXXXXAKALCEGV 183
           A  +   F SFMLTEE GLV  D     +  V+YLYE+              A+ L + +
Sbjct: 122 APFSPLLFLSFMLTEEDGLVADDPTEVWT--VLYLYELQL--LPRVRRLGLAARLLGDHL 177

Query: 184 AARVRRTC----------DDLFGVALTVFGDNTRARRLYES 214
           A   R+ C             FG+ LTVF DN  A RLYES
Sbjct: 178 AQCGRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYES 218

>TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.532
           YMR069W
          Length = 264

 Score = 88.6 bits (218), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 51/160 (31%), Positives = 78/160 (48%), Gaps = 7/160 (4%)

Query: 57  MNYKLHKADGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVC 116
           + Y  +K + +      + ++D +LG  Y   ++ +YGN  PWK NK+ EMK+ GL+YV 
Sbjct: 54  LTYSQNKEECEIEFSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVV 113

Query: 117 YWGNDAQGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXXHXXXXX--XXXX 174
           Y   D +  + +  + SF LT+E+G +          PVIYLYE+               
Sbjct: 114 YHLEDEK--KTVSLYLSFTLTKESGFLPDIDVFS---PVIYLYEIQLTPEVRNNGLGTKL 168

Query: 175 XAKALCEGVAARVRRTCDDLFGVALTVFGDNTRARRLYES 214
            A  L + +         D+ G+ LTVF DNT A R YE+
Sbjct: 169 IAGYLKDCLVDVHENIHKDIIGIELTVFSDNTNAIRFYET 208

>KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {ON}
           Anc_2.532 YMR069W
          Length = 271

 Score = 89.0 bits (219), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 71/225 (31%), Positives = 101/225 (44%), Gaps = 35/225 (15%)

Query: 5   FLSICMEEFPQTLDYTGSDDENGDSTTTLLRRQMMYMPEDDGDDGGIDTPECMNYKLHK- 63
           FL     +FP  +      D NG  T   L+R++ Y+ E  GDD      + M+Y     
Sbjct: 9   FLQTVDRQFPTVI----GCDLNG--TAVSLKRRIHYI-EGVGDDDDESHNKIMSYPGGLP 61

Query: 64  -----------ADGDQTLHSCV----QLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMK 108
                      A  D T   C+    +++D +LG  Y R SR +YGN   W+ NK  EM 
Sbjct: 62  PLPPTTDDNPTAKEDNTCERCLRIFLEILDNNLGPVYARLSRKIYGNSKHWRENKWLEML 121

Query: 109 SAGLVYVCYWGNDAQGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXXHXXX 168
           SA LVYV YW +D++       + SFMLTEE G+    ++ E +  V+YLYE+       
Sbjct: 122 SAQLVYVSYWVSDSEP----VLYTSFMLTEENGI----SSIESTDRVVYLYEIQLIEAIR 173

Query: 169 XXXXXXXAKALCEGVAARVRRTCDDLFGVALTVFGDNTRARRLYE 213
                    +     A        ++  VALTVF DN +A + YE
Sbjct: 174 RQKLGQAIVSYLTECALE----SPEVAAVALTVFSDNEKALKFYE 214

>Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {ON}
           complement(109063..109941) [879 nt, 293 aa]
          Length = 292

 Score = 86.7 bits (213), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 95/209 (45%), Gaps = 15/209 (7%)

Query: 13  FPQTLDYTGSDDENGDSTTTLLRRQMMYMPEDDGDDGGIDT-PECMNYKLHKADGDQTLH 71
           FP+TL+    D+ +  +   +L RQ++ +   D  +  ID     ++Y       D  L+
Sbjct: 15  FPETLELLN-DNSSTSNQKKVLHRQLIAI---DSKNNQIDVRNNVLSYYKDNVKCDVVLN 70

Query: 72  SCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGNDAQGERALGAF 131
             + ++D +LG  Y   S  +Y N  PWK NK+ EMKS GL+YV Y  +D   E  L  F
Sbjct: 71  KLLDILDNNLGPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIY-NDDITKEPLL--F 127

Query: 132 ASFMLTEETGLV-----EGDTAHEQSVPVIYLYEVHXXHXXXXXX--XXXXAKALCEGVA 184
            SFM+T++  LV     + +     +  VIYLYE+                   L + + 
Sbjct: 128 MSFMITDDPSLVVPTDNDSNELSNSTAAVIYLYEIQLLELIRNQKLGTILITNYLKKTIE 187

Query: 185 ARVRRTCDDLFGVALTVFGDNTRARRLYE 213
              +    ++  + LTVF +N  A   Y+
Sbjct: 188 ILNKDYQKNIIALELTVFSNNINAINFYK 216

>SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069W NAT4 N alpha-acetyl-transferase involved in
           acetylation of the N-terminal residues of histones H4
           and H2A
          Length = 240

 Score = 78.2 bits (191), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 73/153 (47%), Gaps = 12/153 (7%)

Query: 63  KADGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGNDA 122
           +   +  L   ++++D +LG+KYR  S T+YGN   W  NKL EM++ GLVYV Y+    
Sbjct: 56  RQSSNSLLIQFLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYF---- 111

Query: 123 QGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXX-HXXXXXXXXXXAKALCE 181
           QG   L  F SF+LT+E   +         V V+YLYE+                +   +
Sbjct: 112 QGVSPL-MFLSFLLTDEPDFL------PDPVKVVYLYEIQLLPEVQGQRLGTQMLQVYLK 164

Query: 182 GVAARVRRTCDDLFGVALTVFGDNTRARRLYES 214
                + R    L G+ LTVF DN  A  LY S
Sbjct: 165 NTVHSLSRLDPLLKGIELTVFSDNDAALHLYYS 197

>ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl-transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 188

 Score = 75.1 bits (183), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 73/149 (48%), Gaps = 15/149 (10%)

Query: 65  DGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGNDAQG 124
             D+ L   +QL++ +LG+ Y + ++T+Y N   W++NK  EM S  L +V YW  ++  
Sbjct: 16  SNDKILEKQLQLIEINLGSYYNKYNKTIYKNNKRWQSNKWQEMCSENLFHVSYWNVESN- 74

Query: 125 ERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXX-HXXXXXXXXXXAKALCEGV 183
              L  F S M  EE+ +VEG+ ++     +IYLYE+H                AL E +
Sbjct: 75  --ELVCFCSIMPCEES-IVEGEMSN-----IIYLYEIHVAPEWRNQKFGKSILNALKEKL 126

Query: 184 AARVRRTCDDLFGVALTVFGDNTRARRLY 212
             +       L G+ LTVF  N RA   Y
Sbjct: 127 CPKAH-----LSGIELTVFSSNERAINFY 150

>KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 260

 Score = 74.3 bits (181), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 75/168 (44%), Gaps = 14/168 (8%)

Query: 47  DDGGIDTPECMNYKLHKADGDQTLHSCVQLVDEHLGAKYRRASRTMYG-NRLPWKANKLA 105
           + G     EC +     AD    L   + LV  +LG  Y R +R +YG  R  W A K A
Sbjct: 58  EPGPTPASECDSVPRPPAD---LLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRA 114

Query: 106 EMKSAGLVYVCYWGNDAQGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXXH 165
           EM++ GLVYV Y  + +Q       F S +LT+E  L       E +  V+YL+E+H   
Sbjct: 115 EMETPGLVYVVYSDSHSQPL----VFMSLLLTDEPEL-----GQELAARVLYLFEIHVSD 165

Query: 166 XXXXXXXXXXAKALC-EGVAARVRRTCDDLFGVALTVFGDNTRARRLY 212
                         C  G  A + R    + G  LTVF +N RA RLY
Sbjct: 166 IIRGQGLGTHLLRDCLGGTLASLSRASPSVLGAELTVFSENQRALRLY 213

>TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.532
           YMR069W
          Length = 278

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 74/142 (52%), Gaps = 11/142 (7%)

Query: 75  QLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGNDAQGERALGAFASF 134
           QL+DE+LG  Y++ S+ +Y N L W  NK  EM ++ ++Y+ YW  D + + ++  F S 
Sbjct: 76  QLIDENLGKLYKKKSKKIYENDLDWSINKREEMFTSNMIYITYW--DCK-QNSVALFLSI 132

Query: 135 MLTEETGLVEGDTAHEQSVPVIYLYEVH--XXHXXXXXXXXXXAKALCEGVAA--RVRRT 190
           +  EET ++E +   E    V+YLYE+H    +             L E +    ++ R 
Sbjct: 133 LSCEETYILENNDQGE----VLYLYEIHITKEYQRQGIGERLIKDYLIEKLIKPLKIERQ 188

Query: 191 CDDLFGVALTVFGDNTRARRLY 212
            ++  G+ LTVF +N  A+  Y
Sbjct: 189 DNNFIGLELTVFSENNDAQNFY 210

>Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W -
           Hypothetical ORF [contig 55] FULL
          Length = 240

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/149 (35%), Positives = 68/149 (45%), Gaps = 14/149 (9%)

Query: 70  LHSCVQLVDEHLGAKYRRASRTMYGNRL-PWKANKLAEMKSAGLVYVCYWGNDAQ--GER 126
           L   + LVD +LG  Y + ++ +YG++   WK  K  EM + GLVYV Y   D +   E 
Sbjct: 53  LEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGKEG 112

Query: 127 ALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXXHXXXXXXXXXXAKALCEGVAAR 186
              AF S +LT+E  L     A      V+YL E+H                  EGVA  
Sbjct: 113 LPLAFLSLLLTDEPELGPAPAA------VVYLMEIHVADIIRGLGLGGTLLR--EGVAGT 164

Query: 187 V---RRTCDDLFGVALTVFGDNTRARRLY 212
           V   RR    + G  LTVF DN  A RLY
Sbjct: 165 VRGARRAHPFIQGTELTVFTDNEGALRLY 193

>Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON}
           similar to Saccharomyces cerevisiae YMR069W
          Length = 243

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 60/161 (37%), Gaps = 33/161 (20%)

Query: 78  DEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGNDAQGERALGAFASFMLT 137
           D H    Y R +R+      PW+A+K AE++  G  +V Y   +  G  A+  F S +  
Sbjct: 63  DVHAHLLYPRLTRSR-----PWQAHKRAELQGLGTCHVLYRKENPGG--AIAGFVSLLFC 115

Query: 138 EETGLVEGD---------------------TAHEQSVP-----VIYLYEVHXXHXXXXXX 171
           +E     G+                      A E++ P     V+Y+ E+H         
Sbjct: 116 DEPHWPAGNGSRAAASTAERERGPSGRSAEPAFEETPPPPPCKVVYVMEIHVSPSFQNQG 175

Query: 172 XXXXAKALCEGVAARVRRTCDDLFGVALTVFGDNTRARRLY 212
                      +   ++ +   L G+ LTVF  N +A  LY
Sbjct: 176 LGSCMLLCARQLVQHMQPSFPQLKGLELTVFTGNRQALALY 216

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,976,360
Number of extensions: 875407
Number of successful extensions: 1944
Number of sequences better than 10.0: 19
Number of HSP's gapped: 1931
Number of HSP's successfully gapped: 19
Length of query: 257
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 150
Effective length of database: 41,212,137
Effective search space: 6181820550
Effective search space used: 6181820550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)