Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_13.1606.20ON1090109056880.0
Skud_13.1526.20ON1090109047470.0
Smik_13.1576.20ON1090109044980.0
YML002W6.20ON73773731670.0
TDEL0G044906.20ON1093109521900.0
ZYRO0C07810g6.20ON1099109620580.0
Sklu_YGOB_Anc_6.20b6.20ON1088110019750.0
NCAS0H008206.20ON1146111717410.0
Kpol_1037.256.20ON1105108317000.0
Sklu_YGOB_Anc_6.20singletonOFF84986316420.0
Ecym_30246.20ON1079108516450.0
CAGL0L07634g6.20ON1130108616320.0
ACR006C6.20ON1071107616030.0
Kwal_56.224246.20ON1089109915980.0
KLTH0C11242g6.20ON1097110515850.0
KNAG0M011606.20ON1131114115400.0
TPHA0J003306.20ON1107110315020.0
NDAI0D008006.20ON1193119114530.0
YML003WsingletonOFF29028912491e-163
KLLA0D01133g6.20ON1067110913101e-162
TBLA0A072606.20ON1204122111791e-141
KAFR0L004006.20ON9428498591e-98
KNAG0F008602.15ON62677810.68
Ecym_32514.267ON110961772.2
KNAG0C057802.536ON180104733.2
Ecym_61848.188ON85167754.1
SAKL0G09988g5.313ON21842717.3
KNAG0G033308.824ON112861737.4
TDEL0A067806.265ON20066708.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_13.160
         (1090 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML00...  2195   0.0  
Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML00...  1833   0.0  
Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML00...  1737   0.0  
YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative p...  1224   0.0  
TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {...   848   0.0  
ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] ...   797   0.0  
Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...   765   0.0  
NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6....   675   0.0  
Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON} (56141...   659   0.0  
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...   637   0.0  
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...   638   0.0  
CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]...   633   0.0  
ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...   622   0.0  
Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML00...   620   0.0  
KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] ...   615   0.0  
KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6...   597   0.0  
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...   583   0.0  
NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6....   564   0.0  
YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative p...   485   e-163
KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some ...   509   e-162
TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_...   458   e-141
KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20...   335   1e-98
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    36   0.68 
Ecym_3251 Chr3 (476367..479696) [3330 bp, 1109 aa] {ON} similar ...    34   2.2  
KNAG0C05780 Chr3 (1124591..1125133) [543 bp, 180 aa] {ON} Anc_2....    33   3.2  
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...    33   4.1  
SAKL0G09988g Chr7 complement(847730..848386) [657 bp, 218 aa] {O...    32   7.3  
KNAG0G03330 Chr7 (717383..720769) [3387 bp, 1128 aa] {ON} Anc_8....    33   7.4  
TDEL0A06780 Chr1 complement(1182697..1183299) [603 bp, 200 aa] {...    32   8.9  

>Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score = 2195 bits (5688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1070/1090 (98%), Positives = 1070/1090 (98%)

Query: 1    MSIYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKL 60
            MSIYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKL
Sbjct: 1    MSIYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKL 60

Query: 61   PLHELCYNADFINSHILLTTENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLR 120
            PLHELCYNADFINSHILLTTENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLR
Sbjct: 61   PLHELCYNADFINSHILLTTENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLR 120

Query: 121  RRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFNSYEETSKTARNAP 180
            RRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFNSYEETSKTARNAP
Sbjct: 121  RRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFNSYEETSKTARNAP 180

Query: 181  NLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKMFEELVEQAFDGM 240
            NLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKMFEELVEQAFDGM
Sbjct: 181  NLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKMFEELVEQAFDGM 240

Query: 241  KSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTENCEYFSVNQLLTDYYS 300
            KSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTENCEYFSVNQLLTDYYS
Sbjct: 241  KSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTENCEYFSVNQLLTDYYS 300

Query: 301  KDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTTDMGSHKPD 360
            KDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTTDMGSHKPD
Sbjct: 301  KDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTTDMGSHKPD 360

Query: 361  LSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFXXXXXXXKFGILGYAISTL 420
            LSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNF       KFGILGYAISTL
Sbjct: 361  LSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFSNNSSSSKFGILGYAISTL 420

Query: 421  EAVVCYFEXXXXXXXXXXXXXLLCIKTRDLLDKLSCENPTNEVNDLATYKDILAYRNEQG 480
            EAVVCYFE             LLCIKTRDLLDKLSCENPTNEVNDLATYKDILAYRNEQG
Sbjct: 421  EAVVCYFENFNKNNNNVAKANLLCIKTRDLLDKLSCENPTNEVNDLATYKDILAYRNEQG 480

Query: 481  QSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVGNLEATKILI 540
            QSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVGNLEATKILI
Sbjct: 481  QSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVGNLEATKILI 540

Query: 541  RIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNSSGQTPLFSI 600
            RIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNSSGQTPLFSI
Sbjct: 541  RIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNSSGQTPLFSI 600

Query: 601  FRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDVSILLQLTK 660
            FRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDVSILLQLTK
Sbjct: 601  FRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDVSILLQLTK 660

Query: 661  LNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDYAKDRLVLSK 720
            LNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDYAKDRLVLSK
Sbjct: 661  LNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDYAKDRLVLSK 720

Query: 721  IGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFVTAVINMKTIQGLLRSIVKD 780
            IGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFVTAVINMKTIQGLLRSIVKD
Sbjct: 721  IGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFVTAVINMKTIQGLLRSIVKD 780

Query: 781  NPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEA 840
            NPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEA
Sbjct: 781  NPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEA 840

Query: 841  SVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKASLNILRKILI 900
            SVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKASLNILRKILI
Sbjct: 841  SVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKASLNILRKILI 900

Query: 901  FLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHKMFSDLSLDELLEHVQFLEEC 960
            FLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHKMFSDLSLDELLEHVQFLEEC
Sbjct: 901  FLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHKMFSDLSLDELLEHVQFLEEC 960

Query: 961  TIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGTSSHIPLGGFIE 1020
            TIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGTSSHIPLGGFIE
Sbjct: 961  TIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGTSSHIPLGGFIE 1020

Query: 1021 TKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACLDQRTIVAFAI 1080
            TKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACLDQRTIVAFAI
Sbjct: 1021 TKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACLDQRTIVAFAI 1080

Query: 1081 KNISVLQECI 1090
            KNISVLQECI
Sbjct: 1081 KNISVLQECI 1090

>Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score = 1833 bits (4747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 879/1090 (80%), Positives = 970/1090 (88%)

Query: 1    MSIYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKL 60
            MS+YHLPTLLNPLINAIFNCPEPEKSPLKKLFANL+TRRFILLAPP   LLNYHDVKTKL
Sbjct: 1    MSVYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKL 60

Query: 61   PLHELCYNADFINSHILLTTENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLR 120
            PLHELCYN DFINSHILLTTENSY+NTTLRD HYETLDGK VV+QWKNN+IH LNGFP+R
Sbjct: 61   PLHELCYNVDFINSHILLTTENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFPIR 120

Query: 121  RRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFNSYEETSKTARNAP 180
            +RLKIL+TK+LPNFNDYF+GA  FAIL+IDQPL CE  PNDYL CF+SYEE  K A++  
Sbjct: 121  QRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKNAQSVS 180

Query: 181  NLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKMFEELVEQAFDGM 240
            NL +++ + ERSSF+NILHIH A L QLGQLFSNYRR A NDDPSKKMFE++V+Q+FDGM
Sbjct: 181  NLPVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKMFEDIVQQSFDGM 240

Query: 241  KSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTENCEYFSVNQLLTDYYS 300
            KSDSLFKNFSNLYDLIHDYFELNLY+DIWSRL  HFKGYEV+TE  +YFSVNQLL D++S
Sbjct: 241  KSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEKYKYFSVNQLLADFFS 300

Query: 301  KDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTTDMGSHKPD 360
            KDF+ FKLSDITFIERRV+VASKHFQKL L+HSYAEKSKILVETLQ LSG T++ SH+ +
Sbjct: 301  KDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTEISSHQQE 360

Query: 361  LSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFXXXXXXXKFGILGYAISTL 420
            L NG N+LTMDADTL+SLFVLVVCRSEQKH++SHLYYLQNF       KFGILGYAISTL
Sbjct: 361  LPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGILGYAISTL 420

Query: 421  EAVVCYFEXXXXXXXXXXXXXLLCIKTRDLLDKLSCENPTNEVNDLATYKDILAYRNEQG 480
            EAVVCYFE             +   KTR+LLDKLS ENPTNE+ +LATY+D L YRNEQG
Sbjct: 421  EAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLATYEDNLQYRNEQG 480

Query: 481  QSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVGNLEATKILI 540
            QSILS+CITN KN ILLDVL+EYE LFP+EDILEDET+DGSTLLIESIK GN+EA KILI
Sbjct: 481  QSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKTGNIEAAKILI 540

Query: 541  RIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNSSGQTPLFSI 600
             IML NC++ ELV+YVNK DKYAR+VAHYLTHEMDILKSIGSY++WK+KNSSGQTPLFSI
Sbjct: 541  GIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKNSSGQTPLFSI 600

Query: 601  FRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDVSILLQLTK 660
            FR+YDQPNYEEMVK+AFNIA+SWYQ+HN+SF Y DHTD+KGNSLLH+LK+DVSILLQL+K
Sbjct: 601  FRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDVSILLQLSK 660

Query: 661  LNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDYAKDRLVLSK 720
            L+ING NYKGLTPLM+YVKYKR+SNIDAITKD RLILEKVQNSTFFTCFDYAKD  VLSK
Sbjct: 661  LDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFDYAKDHSVLSK 720

Query: 721  IGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFVTAVINMKTIQGLLRSIVKD 780
            IGERGA DS+FGL+YLHSLRYHNLNAT N+T+ S T++PF+T VINMKTIQGLLRSI+KD
Sbjct: 721  IGERGARDSLFGLVYLHSLRYHNLNATTNITTASNTDKPFLTTVINMKTIQGLLRSILKD 780

Query: 781  NPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEA 840
            N FTFLP+++YID ISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEA
Sbjct: 781  NQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEA 840

Query: 841  SVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKASLNILRKILI 900
            SVLYWMRINTS+RNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEI SFKASLNILRKILI
Sbjct: 841  SVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKILI 900

Query: 901  FLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHKMFSDLSLDELLEHVQFLEEC 960
            FLSLKS+DFED Y SL +MG K+ NG+AADAF  I  NH MFSDL+L ELLEHV FLE+C
Sbjct: 901  FLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFSDLALAELLEHVSFLEQC 960

Query: 961  TIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGTSSHIPLGGFIE 1020
            TIQL   +QTILFD+I  WWKHYGEFL L KNYRKAFPS VKPKS   T SHIPLG FIE
Sbjct: 961  TIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATDTPSHIPLGSFIE 1020

Query: 1021 TKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACLDQRTIVAFAI 1080
            TKREQSEQRL+VQIKASSKILKELGSEIF+AHE LAEELSNYMEFRKACLDQRTIVAFA 
Sbjct: 1021 TKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLDQRTIVAFAT 1080

Query: 1081 KNISVLQECI 1090
             NI + QE I
Sbjct: 1081 TNIGIFQEYI 1090

>Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score = 1737 bits (4498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 835/1090 (76%), Positives = 942/1090 (86%)

Query: 1    MSIYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKL 60
            MSI HLPTLLNPLINAIFNCPEPEKSPLKKLFA L+T RFILLAPPS  LLNYHDVKTKL
Sbjct: 1    MSISHLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKL 60

Query: 61   PLHELCYNADFINSHILLTTENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLR 120
            PLHELCYNA+FINSHILL TENS+INT  RD HYETLDGKTVV+QWKNNVIH LNGF +R
Sbjct: 61   PLHELCYNAEFINSHILLMTENSFINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVR 120

Query: 121  RRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFNSYEETSKTARNAP 180
            RRLKIL TKILPNFNDYF+GA  F I+YI+QPL CE VPNDYL CF+SY++  K+  +  
Sbjct: 121  RRLKILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVH 180

Query: 181  NLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKMFEELVEQAFDGM 240
            NL +D+SQ ERSSFENILHIHP  LTQLG++FSNYR  A +DDPS+K+FE +V+QAF+GM
Sbjct: 181  NLSLDSSQQERSSFENILHIHPTRLTQLGEMFSNYRTLAPSDDPSEKIFECIVQQAFEGM 240

Query: 241  KSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTENCEYFSVNQLLTDYYS 300
            KSDSLFK F NLYDLIH+YFELNLY+DIWSRLT HFK YEV TE  +YFS+N LL D+YS
Sbjct: 241  KSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEEYKYFSINHLLADFYS 300

Query: 301  KDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTTDMGSHKPD 360
            KDF  FKL D+TFIE+RV +ASKHFQKL L+HSY EKSKILVETLQ LSGTTDMGSH+ D
Sbjct: 301  KDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGSHQLD 360

Query: 361  LSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFXXXXXXXKFGILGYAISTL 420
            +    NNL MDADTLISLFVLV+CRSEQKH++SHLYYLQNF       KFGILGYA+STL
Sbjct: 361  VPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFSNNSSSSKFGILGYAVSTL 420

Query: 421  EAVVCYFEXXXXXXXXXXXXXLLCIKTRDLLDKLSCENPTNEVNDLATYKDILAYRNEQG 480
            EAVVCYFE             +L  KT+ L++ LSCEN TN+V +LATYKDIL YRN QG
Sbjct: 421  EAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDILPYRNGQG 480

Query: 481  QSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVGNLEATKILI 540
            QSILS+CI+NNKN ILLD+LSEY+++FP+ED+LEDETIDGSTLLIESIK GNLEA KILI
Sbjct: 481  QSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEAAKILI 540

Query: 541  RIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNSSGQTPLFSI 600
            RIM+ NCT+EEL++Y+N+TDKY+R+VAHYLTHE+DILKSIG+Y++WK+KNS GQTPLFSI
Sbjct: 541  RIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGGQTPLFSI 600

Query: 601  FRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDVSILLQLTK 660
            FRSYDQPNYE MVK+AFNIA++WY++ N SF Y DHTDNKGN LLHVLKTD SILLQLTK
Sbjct: 601  FRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASILLQLTK 660

Query: 661  LNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDYAKDRLVLSK 720
            L+INGENYKGLTPLMVYVKYKRL+NI+AI KD RL+LEK+Q STFFTCFDYAKD  VLSK
Sbjct: 661  LDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAKDHTVLSK 720

Query: 721  IGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFVTAVINMKTIQGLLRSIVKD 780
            +GERGA DS+FGLIY HSLRYHNLNA VN+T  S TE+PF   VINMKTIQGLLRSI+KD
Sbjct: 721  VGERGAKDSLFGLIYFHSLRYHNLNAAVNITFASDTEKPFSNTVINMKTIQGLLRSILKD 780

Query: 781  NPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEA 840
            NPFTFLP++ YID IS L+RSD+TIIGKADV SLLHKL+NCFNVLLFLKKVP++LFTDEA
Sbjct: 781  NPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLFLKKVPKSLFTDEA 840

Query: 841  SVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKASLNILRKILI 900
            S+LYWMRINTS+RNQK PSK+N KTMEPEEINMIQSFLRFNFDEI SFKASL+ILRKILI
Sbjct: 841  SILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASLSILRKILI 900

Query: 901  FLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHKMFSDLSLDELLEHVQFLEEC 960
            F+SLKS+DF+D   +L +MG  + N KAADAF   + NH MF+D SL +LLEHV+FLEEC
Sbjct: 901  FISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNMFNDYSLAKLLEHVRFLEEC 960

Query: 961  TIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGTSSHIPLGGFIE 1020
            TIQL N +Q IL ++IPNWWKHYGE +TLHKNYRKAFPS VKPKST  TS HI LGGFIE
Sbjct: 961  TIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTDTSGHIQLGGFIE 1020

Query: 1021 TKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACLDQRTIVAFAI 1080
            TKREQSEQRL+VQIK SSK LKELGSEIF AHE LAEELSNYMEFRKACL+QR IVAFA 
Sbjct: 1021 TKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFRKACLNQRNIVAFAA 1080

Query: 1081 KNISVLQECI 1090
             NISVLQE I
Sbjct: 1081 TNISVLQENI 1090

>YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative
            protein of unknown function; expression induced by heat
            and by calcium shortage
          Length = 737

 Score = 1224 bits (3167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 586/737 (79%), Positives = 653/737 (88%)

Query: 354  MGSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFXXXXXXXKFGIL 413
            M SH+ +L +G NN+TMDADTLISLFVLVVCRSEQKH++SHLYYLQNF       KFGIL
Sbjct: 1    MDSHQLELPDGLNNMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGIL 60

Query: 414  GYAISTLEAVVCYFEXXXXXXXXXXXXXLLCIKTRDLLDKLSCENPTNEVNDLATYKDIL 473
            GYA+STLEAVVCYFE              LC KT++LLDKLSCENPTNEV DLATYKDIL
Sbjct: 61   GYAVSTLEAVVCYFEDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDIL 120

Query: 474  AYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVGNL 533
             YRNEQGQSILS+CITN+KN ILLD+LSEYE  FP+ED+LEDETIDGSTLLIESIK GNL
Sbjct: 121  TYRNEQGQSILSICITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNL 180

Query: 534  EATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNSSG 593
            EA K+LI+IMLFNCT+EELV+Y+NKTDKYAR+VAHYLTHEMDILKSIG+YI+WK+KNSSG
Sbjct: 181  EAAKVLIKIMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSG 240

Query: 594  QTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDVS 653
            QTPLFSIFRSYDQPNYEEMVK AF+IA++WY++HN+ F Y DHTDNKGNSLLHVLKT++ 
Sbjct: 241  QTPLFSIFRSYDQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIP 300

Query: 654  ILLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDYAK 713
            ILLQLTKL+IN ENYKGLTPLMVYVKYKRLSNIDAITKD RLILEKVQNSTFFTCFDYAK
Sbjct: 301  ILLQLTKLDINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAK 360

Query: 714  DRLVLSKIGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFVTAVINMKTIQGL 773
            D  VLSKIGERG  DS+FGLIY HSLRYHNLNAT N+TSVS  E+PF T VINMKTIQGL
Sbjct: 361  DHSVLSKIGERGVKDSLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGL 420

Query: 774  LRSIVKDNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQ 833
            LRSI+KDNPFTFLP++ YID ISHLNRSDLTIIGK DV SLLH+LTNCFNVLLFLKK+P+
Sbjct: 421  LRSILKDNPFTFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPE 480

Query: 834  NLFTDEASVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKASLN 893
            NLFTDEAS+LYWMRINTS+RNQKP  K+NPKTMEPEEINMIQSFLRFNFDEI SFKASLN
Sbjct: 481  NLFTDEASILYWMRINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLN 540

Query: 894  ILRKILIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHKMFSDLSLDELLEH 953
            ILRK+LIF++LKS DFEDAY  L +MG K+ N +A+ AF  II NH MFS+LSL  LLE+
Sbjct: 541  ILRKVLIFINLKSDDFEDAYKGLNEMGRKLINSEASSAFKGIITNHNMFSELSLAALLEN 600

Query: 954  VQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGTSSHI 1013
            V+FLE+CTIQL + +Q ILF++IPNWWKHYGEFL LHK+YRKAFP+ VKPKS + TSS  
Sbjct: 601  VRFLEQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRA 660

Query: 1014 PLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACLDQR 1073
            PLGGFIETKREQSEQRL+VQIKASSK+LKELGSEIF AHE LAEELSNYMEFRKACLDQR
Sbjct: 661  PLGGFIETKREQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQR 720

Query: 1074 TIVAFAIKNISVLQECI 1090
            ++VAFA  NISVLQEC+
Sbjct: 721  SLVAFATTNISVLQECV 737

>TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {ON}
            Anc_6.20 YML002W
          Length = 1093

 Score =  848 bits (2190), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/1095 (40%), Positives = 687/1095 (62%), Gaps = 33/1095 (3%)

Query: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLH 63
            YHLP LLNPL+NA+FNCP P  S LKKLF+NL+ R+FILL PP   LL+ +D  +  PL 
Sbjct: 3    YHLPVLLNPLVNAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSPLQ 62

Query: 64   ELCYNADFINSHILLTTENS--YINTTLRDD-HYETLDGKTVVVQWKNNVIHTLNGFPLR 120
            ELCY+ +F+ SH+LL  E +  Y+ T       ++TL+GK V+V+ +N +I T +GF ++
Sbjct: 63   ELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQVK 122

Query: 121  RRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFNSYEETSKTARNAP 180
            +R  I  T +  NFN+Y      F IL ID+P+  E V    +    +     +  ++  
Sbjct: 123  KRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKDGS 182

Query: 181  NLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKMFEELVEQAFDGM 240
            +  +D+SQ  +SSF+NIL IHP W  +  +LF+ YR     DDP  ++F +++ +A+  M
Sbjct: 183  SPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGDDPHIELFHDIIRRAYSAM 242

Query: 241  KSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTENCEYFSVNQLLTDYYS 300
            +SD+LF +  +L DLI+DY ELNLY+DIW R+T HFK  EV +    Y S++QL T  Y 
Sbjct: 243  RSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVESNGLRYLSLHQLETGLYP 302

Query: 301  KDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTTDMGSHKPD 360
              FE F L  +  +E  + +A   F +L L+H++A+K+  L++TL++LS        + D
Sbjct: 303  DKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLS--------RVD 354

Query: 361  LS-NGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFXXXXXXXKFGILGYAIST 419
             S    + + + ADTL+SLFVLV+CR++ ++++  L+YLQNF        FG+LGYAIST
Sbjct: 355  KSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYAIST 414

Query: 420  LEAVVCYFEXXXXXXXXXXXXXLLCIKTRDLLDKLSCENPTNEVNDLATYKDILAYRNEQ 479
            LEA VCYF+               C   R L+DKLS E  ++ VN L  Y+  L+YR EQ
Sbjct: 415  LEAAVCYFDELKGSKKMSRLESE-CENARSLVDKLSSE--SSSVN-LIHYQKTLSYRTEQ 470

Query: 480  GQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVGNLEATKIL 539
            G+S+LS+CI N KNDIL ++LS+ E  FP+EDILED+T +G TLL++S+K GN +A  ++
Sbjct: 471  GESLLSICIANGKNDILQELLSD-ERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASLI 529

Query: 540  IRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNSSGQTPLFS 599
            + ++  +CT EE+  Y N++DK  R+ AHYLTHE++IL+ IG++ +W  K+SSG T LF+
Sbjct: 530  VDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALFT 589

Query: 600  IFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDVSILLQLT 659
            IFRSYDQPNY++M++ +F  A+ WY      F ++ H D K N+LLH+LK  +SILL+  
Sbjct: 590  IFRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEYE 649

Query: 660  KLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDYAKDRLVLS 719
             +++N  N KGLTPLMVY KY RL N  +I  D R+IL K+Q+       DYAK+ L+L 
Sbjct: 650  SVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLILH 709

Query: 720  KIGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFVTAVINMKTIQGLLRSIVK 779
            +I ++ A D+ FG  ++H+L+Y + +  VN+T  +  +  F T   ++KT+Q   R++++
Sbjct: 710  EIAKQSAMDTAFGKCFVHTLKYESSSWLVNITVQADRKGNFETVEFHLKTVQNFFRTVLR 769

Query: 780  DNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDE 839
              P TFLP+D+ ++ ++ L ++ L+ IGK +    L  LTNCFNVL+  +++P+++  +E
Sbjct: 770  TCPMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILANE 829

Query: 840  ASVLYWMRIN-TSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKASLNILRKI 898
            + +L W+++   + RN    +    K +EPEE+++IQ FLRFN  E+ + ++ L++++K+
Sbjct: 830  SKLLSWIKVQYKAFRNGT--THIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKL 887

Query: 899  LIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHK-----MFSDLSLDELLEH 953
             IFL LKSSD E +   LL +G++       D +   + +HK     ++ + S+  L+E 
Sbjct: 888  AIFLRLKSSDVEQSVELLLPLGSE----GMGDLYP--LTDHKFSCTTVYGNDSMILLVED 941

Query: 954  VQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGTSSHI 1013
            +  + +CTI+L++ I  +L  +IP WWK YGE L   K Y + FP  VK   T+  +  I
Sbjct: 942  IDLMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETSTDAGII 1001

Query: 1014 PLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACLDQR 1073
              G  +E K+E+ E+RLS  I  + + + + G+ I   HE+LAE+LS +MEF+ A + + 
Sbjct: 1002 --GKILEGKKEKLEKRLSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRG 1059

Query: 1074 TIVAFAIKNISVLQE 1088
             I  +  +NI  L+E
Sbjct: 1060 VIKRWVRENIKELKE 1074

>ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] {ON}
            similar to uniprot|Q04257 Saccharomyces cerevisiae
            YML003W/YML002W Hypothetical ORF
          Length = 1099

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/1096 (40%), Positives = 664/1096 (60%), Gaps = 32/1096 (2%)

Query: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLH 63
            YH+P LLNPL+N++FNC  P  S  KKLF  L+T RFILL PP+  LL + D ++   ++
Sbjct: 3    YHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSSMN 62

Query: 64   ELCYNADFINSHILLTTENSY----INTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPL 119
            +LC N DF+ SHILL  +++Y     N +     Y+TL+ K V V+  +  I T  GFPL
Sbjct: 63   DLCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGFPL 122

Query: 120  RRRLKILDTKILPNFNDYFKGAEYFAILYIDQPL-GCEFVPNDYLHCFNSYEETSKTARN 178
            RRR +I + +++ NFNDY  G+E FA+++ID PL G      D              A+ 
Sbjct: 123  RRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPRGLAQGNFNGVDAKG 182

Query: 179  APNLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKMFEELVEQAFD 238
            +  L+ D +Q   SSFENIL +HP W   L   F+ YR   L + P +++F  +V+Q   
Sbjct: 183  S--LVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPYEELFRMIVKQVHA 240

Query: 239  GMKSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTENCEYFSVNQLLTDY 298
             M +D LF+   +LYDLI DY ELNL++D+W R+   ++  E++TE  ++ S+N+L T+ 
Sbjct: 241  KMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEPLKFLSINELETEL 300

Query: 299  YSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTTDMGSHK 358
            Y K +E F+L D+T +E+ + +A   F  L L+H++AEK+  L+ TLQ LS T +     
Sbjct: 301  YQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQSLSNTREQDMDI 360

Query: 359  PDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFXXXXXXXKFGILGYAIS 418
              L      +TMDADTLIS FVLVVCR++ K+I+SHL+YL+ F       KFGILGYAIS
Sbjct: 361  QTLP-----ITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGILGYAIS 415

Query: 419  TLEAVVCYFEXXXXXXXXXXXXXLLCIKTRDLLDKLSCENPTNEVNDLATYKDILAYRNE 478
            TLEAVV YF+                 K ++L   +S ++    V D++ ++  L +R  
Sbjct: 416  TLEAVVFYFDGLKGTKKLQKLQDD-SNKAKELYILISDKSTGQAVLDISQFRSNLEFRTP 474

Query: 479  QGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVGNLEATKI 538
            QG+S+LS CI N+KN +L ++L  YE +FP+EDIL+DET+DGSTLLI+++K  N EA ++
Sbjct: 475  QGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDNSEAAQM 534

Query: 539  LIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNSSGQTPLF 598
            ++ ++  +CT++EL  YVN+ DK  R+VAHYLTHEM+IL+SIG YINWK ++S+G TPLF
Sbjct: 535  IVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSNGHTPLF 594

Query: 599  SIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDVSILLQL 658
            +IFR YDQ NYE M+  AF  A  WYQ +   F +SDH DNKGN+LLH++K +VSILL  
Sbjct: 595  TIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVSILLDY 654

Query: 659  TKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDYAKDRLVL 718
              ++IN  N KGLTPLM+Y +Y R  N+  I +D R+IL+K+Q+ +F   FDYA++ LVL
Sbjct: 655  DNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYARNPLVL 714

Query: 719  SKIGERGANDSIFGLIYLHSLRYHNLNATVNVTSV--SKTEEPFVTAVINMKTIQGLLRS 776
             ++  +    + F L ++H L+Y   +   ++T    +  +E + T  +++KT+Q L + 
Sbjct: 715  KELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTLQNLFQV 774

Query: 777  IVKDNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLF 836
            ++K +  +FLP++  ++ +S+L +S +  I K +     + LT+CF+VLL    + + L 
Sbjct: 775  LLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLRHDNLNK-LV 833

Query: 837  TDEASVLYWMR-----INTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKAS 891
              E+ ++ W+R      N S++ QK       K +EPEEI ++ SFLRFN  E+ + K  
Sbjct: 834  LRESRLVSWIRSQDKKCNNSKKLQK------QKNVEPEEIGIMASFLRFNRGELSAVKLK 887

Query: 892  LNILRKILIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHKMFSDLSLDELL 951
            L  ++K+LIFL LK++D   +Y  L   GT+    +    F  +  N   F + +    +
Sbjct: 888  LMTMKKLLIFLKLKNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLEINCCAFGEEATMTFV 947

Query: 952  EHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGTSS 1011
              + FLE CT +L + ++ +L   IP WWK YG+ L +HK Y++ FP+  +  S  G   
Sbjct: 948  REIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNISRNDSGTGI-- 1005

Query: 1012 HIPLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACLD 1071
               +  F E KRE+ E +LS  +    K ++ +G  I S HE LAEELS YMEF+     
Sbjct: 1006 ---IASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKSNFFI 1062

Query: 1072 QRTIVAFAIKNISVLQ 1087
               +     +NI++L+
Sbjct: 1063 NGILRRAVRENINILK 1078

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
            aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/1100 (37%), Positives = 652/1100 (59%), Gaps = 43/1100 (3%)

Query: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLH 63
            YHLP LLNPL+N++FNCP P  SPLKK+FA+L+ +RFIL+ P  ++LL+Y D+ T   L 
Sbjct: 3    YHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSSLQ 62

Query: 64   ELCYNADFINSHILLTTENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLRRRL 123
            +LCY  +F+ +HI++  ++S  +    D  ++TL+GKTV+++ +N ++ T +GFP +RR 
Sbjct: 63   DLCYTYEFVANHIIILKKDSKYS----DQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRC 118

Query: 124  KILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFNSYEETSKTARNAPNLL 183
            KI +T++  NFNDY KG++YF +++ID+PL  + V ND L  F        T  ++  L 
Sbjct: 119  KITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFG----VRSTNTSSLPLS 174

Query: 184  MDTSQLERSSFENILHIHPAWLTQLGQLFSNY---RRAALND-----DPSKKMFEELVEQ 235
             D +Q E SSFE +  +HP    QLG  FS     +R  +N      D     F++   +
Sbjct: 175  TDLTQREVSSFEQLFRLHP----QLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYE 230

Query: 236  AFDGMKSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTEN----CEYFSV 291
            AF+ ++ +  F+N S L+  +H+Y ELNLY+DIW ++T  ++  E+         +Y ++
Sbjct: 231  AFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAI 290

Query: 292  NQLLTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGT 351
            +Q+ T +Y +    F L  +T  E+ +  A+  F++LA S S++EK+KI+++TLQ L+  
Sbjct: 291  SQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDY 350

Query: 352  TDMGSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFXXXXXXXKFG 411
            ++     PD      ++T+DADTLI L VLVVCRS+ K+++SHL+YLQNF       KFG
Sbjct: 351  SEF----PDAD--IEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFG 404

Query: 412  ILGYAISTLEAVVCYFEXXXXXXXXXXXXXLLCIKTRDLLDKLSCENPTNEVNDLATYKD 471
            ++ YA+STLEAV+CYFE               C + +   D LSC+  +   + L +Y+D
Sbjct: 405  VVAYALSTLEAVLCYFEDAENSGKIRSLE-FNCRRNKQFWDHLSCKAVS--FDSLKSYRD 461

Query: 472  ILAYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVG 531
            IL  R   G+S LS+CI       +  +L  +E   P+EDIL+D+TI+GSTLL+++++ G
Sbjct: 462  ILRIRTAGGESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETG 521

Query: 532  NLEATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNS 591
            N     +L+ I+  +CT  EL  Y+N+ +++ R+ AHYLT ++ +   IG + +W+ K+ 
Sbjct: 522  NTRMADVLLEILCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDI 581

Query: 592  SGQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTD 651
            SG TPLF+IFRSYD P+Y +MV  AF  AS WY+    +F +S H D KGN+LLHV+KT+
Sbjct: 582  SGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTN 641

Query: 652  VSILLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDY 711
            + ILL+   +++N  N KGLTPLMVYVKY RL N+  I +D+RLI+EK Q S F  CFDY
Sbjct: 642  IEILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDY 701

Query: 712  AKDRLVLSKIGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEP-FVTAVINMKTI 770
             K+ ++ +++G   A  + FG +  H+ R+ N    + +T   K  E  F T   N++ I
Sbjct: 702  VKNPVIQAELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAI 761

Query: 771  QGLLRSIVKDNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKK 830
            QGLL+  ++ NP +FLPID  ++ +  + ++ L  +GK +V   L +LT    ++   ++
Sbjct: 762  QGLLQVYLRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEE 821

Query: 831  VPQNLFTDEASVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKA 890
              + L+   + ++ W+R +  +R       +  + +EPEEIN IQSFLRFN  E+   + 
Sbjct: 822  FKKALYLPASDLVNWIRESGRKRT------NVSRRIEPEEINSIQSFLRFNLSELSLIRD 875

Query: 891  SLNILRKILIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHKMFSDLSLDEL 950
             ++IL+K+ IF  LK+ D   A   L     ++ +   + AF     + K   DLS   L
Sbjct: 876  KISILQKLSIFSELKAQDINQARCMLFSQSVRLEDTAISQAFGISGLSEKDSEDLSATIL 935

Query: 951  LEHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGTS 1010
              ++ FL+ECT +L   I  +L  ++  WWK Y E L     Y K FP++VKP       
Sbjct: 936  TSNIDFLKECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKPHLDDNKG 995

Query: 1011 SHIPLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACL 1070
                 G ++E KR + E++LS QIK+  + L+ L  E+   HE LAEELS Y+EF+   L
Sbjct: 996  ---LFGTYVEGKRSKLEEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYL 1052

Query: 1071 DQRTIVAFAIKNISVLQECI 1090
                I  F +  I+ L++ +
Sbjct: 1053 RTGIIQDFTVGKINTLKDTM 1072

>NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6.20
            YML002W
          Length = 1146

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/1117 (36%), Positives = 667/1117 (59%), Gaps = 64/1117 (5%)

Query: 1    MSIYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKL 60
            M  YHLPTLLNPL+N+IFNCP P  SPLKKL+A+L+ + FILL PP+  LLNY D KTK+
Sbjct: 1    MEQYHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKI 60

Query: 61   PLHELCY-NADFINSHILLTTENSYINTTLRD----------DHYETLDGKTVVVQWKNN 109
             L +LCY N DFI +HILL  ++S  +++             + ++TL+G  ++V+W+NN
Sbjct: 61   QLEDLCYHNVDFIGAHILLPPKDSISSSSSTIDDGYTRLASIEQFDTLNGDNILVKWRNN 120

Query: 110  VIHTLNGFPLRRRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVP-NDYLHCFNS 168
             +  L+G P R+++KI   ++LPNFNDY +G+ YF +++ID+PL  + +  ND L CF++
Sbjct: 121  FLVLLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDT 180

Query: 169  ---YEETSKTARNAPNLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPS 225
               ++    ++ +A  L+ D SQ ERS FENI++ +  W  +     + Y+ +   ++P+
Sbjct: 181  LTLHDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPN 240

Query: 226  KKMFEELVEQAFDGMKSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLT-IHFKGYEVNTE 284
            + +F+++V  A++ +KS+ +FK F +L  LIH+Y E+NLY+ +W ++T +     E    
Sbjct: 241  ETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALDDETKGT 300

Query: 285  NCEYFSVNQLLTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVET 344
              +  S+ ++   +Y    E F L  IT +E+ +  ++    KL   +S+ EKS+ L+ T
Sbjct: 301  RIKNISIEEIDDKFY----EMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLIAT 356

Query: 345  LQHLSGTTD-MGSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQK--HIRSHLYYLQNF 401
            LQ L+   + +G    +   G NNL +DADTLI+L +L++CRSE     ++ +++YL+ F
Sbjct: 357  LQILTNMDNPIGELNQENEKGANNL-IDADTLINLLILIICRSEINIVDLKRNIFYLKKF 415

Query: 402  XXXXXXXKFGILGYAISTLEAVVCYFEXXXXXXXXXXXXXLLCIKTRDLLDKLSCENPTN 461
                    FGIL Y IST E V+  FE                    ++++KL   +   
Sbjct: 416  NYDENLINFGILSYTISTFEIVIYSFENIVEYDKLKSYS--------EIIEKLIKVDDLK 467

Query: 462  EVNDLATYKDILAYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGS 521
            +V     ++  L +R++ G+SIL  CITNN+ +  LD+L +YE +F +++IL+D  ++G+
Sbjct: 468  KVPKTIKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANVEGT 527

Query: 522  TLLIESIKVGNLEATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIG 581
            TLL++++   N + + +LI ++L NC++++++ Y+NK DK+ R+V HYL +E++ILK IG
Sbjct: 528  TLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEILKIIG 587

Query: 582  SYINWKQKNSSGQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKG 641
             Y+NWKQ++  G+TPLF+IFR YDQPNY+E++   F+I  +WY  +   F  SDH D K 
Sbjct: 588  KYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYDLKD 647

Query: 642  NSLLHVLKTDVSILLQLTKLN-----INGENYKGLTPLMVYVKYKRLSNIDAITKDHRLI 696
            NS+LH+L++++ IL   +K N     IN  NYKG TPLM+YVKY RLSN+  I  D RL+
Sbjct: 648  NSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDDRLL 707

Query: 697  LEKVQNSTFFTCFDYAKDRLVLSKIGERG-ANDSIFGLIYLHSLRYH-NLNATVNVT-SV 753
              + Q   + TCFDYA D  + +++G+    N+++FG IY+HSL+   + NAT ++T  +
Sbjct: 708  FNRYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATFSLTFPL 767

Query: 754  SKTEEPFVTAVINMKTIQGLLRSIVKDNPFTFLPIDNYIDGISHL--NRSDLTIIGKADV 811
               E    T  I +K I  LL+ I K +  + LP+D  I  +  L    ++  I+ K ++
Sbjct: 768  PDKENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIVRKIEM 827

Query: 812  ---RSLLHKLTNCFNVLLFLKKVPQ--NLFTDEASVLYWM-RINTSRRNQKPPSKDNPKT 865
               +SLL +LT+C + LLF        +L TDE  +L W+   NT  ++    +    K+
Sbjct: 828  LRNQSLLRRLTDCLDTLLFFDIGIDYLSLITDETKLLGWVTNENTKLKHNVNKTHGEKKS 887

Query: 866  MEPEEINMIQSFLRFNFDEILSFKASLNILRKILIFLSLKSSDFEDAYASLLKMGTKVTN 925
            ++PE+IN+IQSFL+FN  E+ +   ++  L K+L F+ LKS D +++  + + +   + N
Sbjct: 888  LKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKSIKN 947

Query: 926  GKAADA----FTTIIKNHKMFSDLSLDELL-EHVQFLEECTIQLFNSIQTILFDRIPNWW 980
             + A A       II+   + +    + L+ + + FL+ CT+ L  +I+ IL  +IPNWW
Sbjct: 948  DQIAQATNRSLEPIIEMQSLENQYYNNTLIRDELDFLKACTLILTGNIEDILRTQIPNWW 1007

Query: 981  KHYGEFLTLHKNYRKAFPS-------AVKPKSTAGTSSHI----PLGGFIETKREQSEQR 1029
            K YGE L L+K+Y K FP        A   + +A  S+ +      GG IE +R ++ ++
Sbjct: 1008 KLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQRNKAVKK 1067

Query: 1030 LSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFR 1066
            L   I      L+ LG+EIF  HE LAEEL+ YMEF+
Sbjct: 1068 LKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFK 1104

>Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON}
            (56141..59458) [3318 nt, 1106 aa]
          Length = 1105

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/1083 (34%), Positives = 628/1083 (57%), Gaps = 41/1083 (3%)

Query: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLH 63
            YH+P LLNPLINA+FNCP+P  SPL+KLF  ++ + F+L+ PP+ +LL+Y D +  L L 
Sbjct: 6    YHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLTLK 65

Query: 64   ELCYNADFINSHILLTTENSYINTTLR--------DDHYETLDGKTVVVQWKNNVIHTLN 115
            ELCY  +F+ SHI+L T+NS  N  ++        D+ Y++L+   ++++  N +    N
Sbjct: 66   ELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSLNNNQLLIKNNNIIPLDFN 125

Query: 116  GFPLRRRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCF-------NS 168
                +++ KI+D KILPNFN+Y  G+E + I+Y D P    ++P   +  F       N+
Sbjct: 126  NSTQKKKYKIIDIKILPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKESNN 185

Query: 169  YEETSKTARNAPNLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKM 228
             +    T   +P L  D +Q  +SSF +I++IH  W         +++   LN       
Sbjct: 186  IKAAQITNHKSP-LSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLNLTSLPIY 244

Query: 229  FEELVEQAFDGMKSDSLFKNFSN-LYDLIHDYFELNLYEDIWSRLTIHFKGYE-VNTENC 286
            F E+V++A+  MK + +F +F N LY+LI +Y E + Y  IW  +  +    + ++TE  
Sbjct: 245  FREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQFLHTEMM 304

Query: 287  EYFSVNQLLTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQ 346
            ++ S++QL  + Y+++F+ F L ++  +ER V  A+  F+K+  S S++EK +IL++ LQ
Sbjct: 305  DFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKCQILIDALQ 364

Query: 347  HLSGTTDMGSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFXXXXX 406
             L+   D+  ++P        L +DADTL++LF+LV+CRS+   +R+HLYYLQNF     
Sbjct: 365  KLTSYDDV-HYEP--------LMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDEN 415

Query: 407  XXKFGILGYAISTLEAVVCYFEXXXXXXXXXXXXXLLCIKTRDLLDKLSCENPTNEVNDL 466
              KFG+LGY IST EA +CY +             L CI+ ++L+ K+S E   +    +
Sbjct: 416  NVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQV-LNCIRNKELISKISSE-ADHSTFQV 473

Query: 467  ATYKDILAYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIE 526
              YKD   +RNE G+SIL+LCI + KN+ L ++L  +E +FP+EDIL+DE I+G+TLL++
Sbjct: 474  KLYKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPLEDILDDEDIEGTTLLMK 533

Query: 527  SIKVGNLEATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINW 586
            ++KV N    K+++ ++  +C+++EL+ Y N+TD   R  AHY+T+++D+LK IG + NW
Sbjct: 534  ALKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFNW 593

Query: 587  KQKNSSGQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLH 646
            K K+  G TPL +I R+YDQ  YE+M++ AF  A  WY+  N    + DH D+K N+LLH
Sbjct: 594  KIKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLLH 653

Query: 647  VLKTDVSILLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFF 706
            +LK D+ +LL+   +NIN  N K +TPLM YVKY R+SNI  I +D RLIL K Q  TF 
Sbjct: 654  ILKCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTFL 713

Query: 707  TCFDYAKDRLVLSKIGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFVTAVIN 766
             C+D+ K+ ++   +G R   +S+F L   +SLR  N N  +  T     ++ ++T  ++
Sbjct: 714  DCYDFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDSYITKSVS 773

Query: 767  MKTIQGLLRSIVKDNPFTFLPIDNYIDGISHLNRSDL-TIIGKADVRSLLHKLTNCFNVL 825
            +K +  +++   K  P  F+P    +  ++ + +++    I K   R+ L+ ++N F  L
Sbjct: 774  LKILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNYFGTL 833

Query: 826  LFLKKVPQNLFTDEASVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEI 885
            +        LF +  S+  W++    +R  K   ++  K M  ++INMI+SF++FN +E+
Sbjct: 834  IETDDFDTELFKNPESLTKWIK--AGKRKHK--KENYYKRMTLDDINMIKSFVQFNINEL 889

Query: 886  LSFKASLNILRKILIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTI--IKNHKMFS 943
                 +L IL+K+  FL+LK +D  ++Y      G  +     ++    I  +   K F 
Sbjct: 890  GKLNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKYFQ 949

Query: 944  DLSLDELLEHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKP 1003
             + L  LL+ + FLE CTI + ++   ++ + IP W   +     L K Y++ F      
Sbjct: 950  SIFL-ILLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDF--- 1005

Query: 1004 KSTAGTSSHIPLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYM 1063
             S  G + +I L  + + KRE +E+R+S +I  ++ +  ++ + I+ AHENLAEE + ++
Sbjct: 1006 DSRNGLNENI-LSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFL 1064

Query: 1064 EFR 1066
             F+
Sbjct: 1065 TFK 1067

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/863 (38%), Positives = 530/863 (61%), Gaps = 34/863 (3%)

Query: 4   YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLH 63
           YHLP LLNPL+N++FNCP P  SPLKK+FA+L+ +RFIL+ P  ++LL+Y D+ T   L 
Sbjct: 3   YHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSSLQ 62

Query: 64  ELCYNADFINSHILLTTENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLRRRL 123
           +LCY  +F+ +HI++  ++S  +    D  ++TL+GKTV+++ +N ++ T +GFP +RR 
Sbjct: 63  DLCYTYEFVANHIIILKKDSKYS----DQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRC 118

Query: 124 KILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFNSYEETSKTARNAPNLL 183
           KI +T++  NFNDY KG++YF +++ID+PL  + V ND L  F        T  ++  L 
Sbjct: 119 KITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFG----VRSTNTSSLPLS 174

Query: 184 MDTSQLERSSFENILHIHPAWLTQLGQLFSNY---RRAALND-----DPSKKMFEELVEQ 235
            D +Q E SSFE +  +HP    QLG  FS     +R  +N      D     F++   +
Sbjct: 175 TDLTQREVSSFEQLFRLHP----QLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYE 230

Query: 236 AFDGMKSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTEN----CEYFSV 291
           AF+ ++ +  F+N S L+  +H+Y ELNLY+DIW ++T  ++  E+         +Y ++
Sbjct: 231 AFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAI 290

Query: 292 NQLLTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGT 351
           +Q+ T +Y +    F L  +T  E+ +  A+  F++LA S S++EK+KI+++TLQ L+  
Sbjct: 291 SQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDY 350

Query: 352 TDMGSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFXXXXXXXKFG 411
           ++     PD      ++T+DADTLI L VLVVCRS+ K+++SHL+YLQNF       KFG
Sbjct: 351 SEF----PDAD--IEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFG 404

Query: 412 ILGYAISTLEAVVCYFEXXXXXXXXXXXXXLLCIKTRDLLDKLSCENPTNEVNDLATYKD 471
           ++ YA+STLEAV+CYFE               C + +   D LSC+  +   + L +Y+D
Sbjct: 405 VVAYALSTLEAVLCYFEDAENSGKIRSLE-FNCRRNKQFWDHLSCKAVS--FDSLKSYRD 461

Query: 472 ILAYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVG 531
           IL  R   G+S LS+CI       +  +L  +E   P+EDIL+D+TI+GSTLL+++++ G
Sbjct: 462 ILRIRTAGGESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETG 521

Query: 532 NLEATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNS 591
           N     +L+ I+  +CT  EL  Y+N+ +++ R+ AHYLT ++ +   IG + +W+ K+ 
Sbjct: 522 NTRMADVLLEILCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDI 581

Query: 592 SGQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTD 651
           SG TPLF+IFRSYD P+Y +MV  AF  AS WY+    +F +S H D KGN+LLHV+KT+
Sbjct: 582 SGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTN 641

Query: 652 VSILLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDY 711
           + ILL+   +++N  N KGLTPLMVYVKY RL N+  I +D+RLI+EK Q S F  CFDY
Sbjct: 642 IEILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDY 701

Query: 712 AKDRLVLSKIGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEP-FVTAVINMKTI 770
            K+ ++ +++G   A  + FG +  H+ R+ N    + +T   K  E  F T   N++ I
Sbjct: 702 VKNPVIQAELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAI 761

Query: 771 QGLLRSIVKDNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKK 830
           QGLL+  ++ NP +FLPID  ++ +  + ++ L  +GK +V   L +LT    ++   ++
Sbjct: 762 QGLLQVYLRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEE 821

Query: 831 VPQNLFTDEASVLYWMRINTSRR 853
             + L+   + ++ W+R +  +R
Sbjct: 822 FKKALYLPASDLVNWIRESGRKR 844

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
            Ashbya gossypii ACR006C
          Length = 1079

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/1085 (34%), Positives = 598/1085 (55%), Gaps = 44/1085 (4%)

Query: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLH 63
            YHLP LLNPL+NA+FNCP P  SPLKKLF N++ +RFILL P + +LL Y D+ + LPL 
Sbjct: 3    YHLPVLLNPLVNAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLPLS 62

Query: 64   ELCYNADFINSHILLTTENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLRRRL 123
            ELCYN DF+ SHIL+  + S +     +  Y TL+G +V+++ +  ++ +    P  R+ 
Sbjct: 63   ELCYNYDFVASHILIQLQESKVT----EQEYRTLNGNSVIIRSQAGIVMSK---PELRKC 115

Query: 124  KILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFNSYEETSKTARNAPNLL 183
            ++   ++L NFNDY     YF +L+ID+PL    V ND L  F SYE  + +     N +
Sbjct: 116  RVKSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVFGSYEMHNPSKSKTINTI 175

Query: 184  MDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALND----DPSKKMFEELVEQAFDG 239
             +        FE  + ++P    QL   F   R+   N+    D   K+F++LV   +  
Sbjct: 176  SEN----HIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLVIDVYGV 231

Query: 240  MKSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYE-----VNTENCEYFSVNQL 294
            +K D  F+N+  L ++  +Y ELN+YEDIW +L +   G +         + +Y S+N +
Sbjct: 232  IKEDKNFRNYMELLNVTQEYVELNMYEDIWLKL-VQLNGSKEPDRVSGYSSTKYISLNNV 290

Query: 295  LTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTTDM 354
             T  Y +   SF L  +T +E+RV  A+  F KL+L++S+ EK+KI+V T Q L+   + 
Sbjct: 291  ATILYPEGTNSFDLRVVTEVEKRVVKATDCFAKLSLTNSHNEKAKIVVSTFQILTTKMEY 350

Query: 355  GSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFXXXXXXXKFGILG 414
             S  P         T+DADTLI L ++V+CRS+ K+++SHL YL+ F       KFG+ G
Sbjct: 351  TSIDP---------TIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTG 401

Query: 415  YAISTLEAVVCYFEXXXXXXXXXXXXXLLCIKTRDLLDKLSCENPTNEVNDLATYKDILA 474
            Y++ST+EAV+ YFE             L     R   D +     +     L++YK+ L 
Sbjct: 402  YSLSTIEAVLAYFEAGDGTEKLKKLISL-SEANRVFWDLIR----SGVAVSLSSYKNSLI 456

Query: 475  YRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVGNLE 534
             R+   +S LS+CI   + D++ ++L  Y+    +ED+L D     STLLI++++ G+ E
Sbjct: 457  SRSSNCESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDE 516

Query: 535  ATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNSSGQ 594
              ++LI +M+ NCT+ E   YVN+++   R+VAHYL     I++ IG Y++W++K+ +  
Sbjct: 517  IAELLIDVMISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMH 576

Query: 595  TPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDVSI 654
            TPLF I R+YDQ +Y EM+  +F     + +R    F ++DH D  GNSLLH++K  +  
Sbjct: 577  TPLFIICRAYDQLHYSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQS 636

Query: 655  LLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDYAKD 714
            +L    +N+N  N KG+TPLM+Y KY R+ NI  I +D RLI+ K+QN       DY K+
Sbjct: 637  ILSQPNINVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKN 696

Query: 715  RLVLSKIGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFVTAVINMKTIQGLL 774
             ++L+ IG   A +S++GL+    +++ + N      +V  ++  + T   ++K IQGLL
Sbjct: 697  PMILNLIGTHIAKNSLYGLLSADGIKFED-NCWYLWITVKFSDNSYSTLRQSVKNIQGLL 755

Query: 775  RSIVKDNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQN 834
            +   K +P  FLPID+ +  + ++ +  +  +   +    L  LT   +V+    +    
Sbjct: 756  QFYNKKHPMNFLPIDHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAV 815

Query: 835  LFTDEASVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKASLNI 894
            L  +E+ +  W+R N  +     P  +  + +EPEE++ IQSFL+FN  E    K    I
Sbjct: 816  LRYNESDLSTWLRTNNFK-----PRANKDERIEPEEVSSIQSFLKFNLSEFSEIKEKFTI 870

Query: 895  LRKILIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHKMFSDLSLDELLEHV 954
            LRK+++F SLK+ D E A   + +    V+N        T I +++ +   SLD   + +
Sbjct: 871  LRKLVVFQSLKAQDIECAQRIIYQQMEIVSNSVGPSVEKTFIGSNENY---SLDSFQQAI 927

Query: 955  QFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGTSSHIP 1014
            +F+  C   L + IQ +L  ++  WW+ YGE  +L + Y++ FPS  K    +G  S   
Sbjct: 928  EFIAMCLETLSSKIQYVLDSKVTLWWRLYGELSSLRREYQRNFPSDFKSSDVSGEESKGF 987

Query: 1015 LGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACLDQRT 1074
               +IE KR+++E +L  +++     L+ L  E+   HENLAEE+S ++ F+    +   
Sbjct: 988  FESYIEGKRQKTEDKLQARLRVCITKLQTLSGELKKDHENLAEEISFFVTFKNFAYESFV 1047

Query: 1075 IVAFA 1079
            +  +A
Sbjct: 1048 MKTYA 1052

>CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa] {ON}
            some similarities with uniprot|Q04257 Saccharomyces
            cerevisiae YML002w and some similarities with
            uniprot|Q04257 Saccharomyces cerevisiae YML003w
          Length = 1130

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/1086 (35%), Positives = 607/1086 (55%), Gaps = 48/1086 (4%)

Query: 16   AIFNCPEPEKSPLKKLFANLQTR-RFILLAPPSHLLLNYHDVKTKLPLHELCYNADFINS 74
            AI NC EP  SPLKKL+  L  + ++++L PP+ LLL Y D ++   LH+LCY  +F ++
Sbjct: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78

Query: 75   HILL-----TTENSYINTTL-------RDDHY-ETLDGKTVVVQWKNNVIHTLN--GFPL 119
            HILL     T  N+     L        D H+ + +D     + WKN VI+  N  G  +
Sbjct: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQI 138

Query: 120  RRRLKILDTKILPNFNDYFKGAE-YFAILYIDQ-----PLGCEFVPNDYLHCFNSYEETS 173
            + R KILD + +P FN+Y K  +    I+YID       L C    +  +    S    S
Sbjct: 139  KNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSD--IDLLRSPSMRS 196

Query: 174  KTARNAPNLLMDTS-----QLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKM 228
                  P+L+   S        +++F++IL ++  W ++  Q F  +R  A  DD    +
Sbjct: 197  IPTAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLANQDDLPIDV 256

Query: 229  FEELVEQAFDGMKSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTENCEY 288
            F  ++E+  + M SD+LFKN  +L ++I++Y ELNL++DIW  +    K  E++      
Sbjct: 257  FHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEIDLNPFGN 316

Query: 289  FSVNQLLTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHL 348
             S+ Q+ +++ S ++  F L ++   ER +  ASK  QK+  + +Y  K+ IL+ TL+ L
Sbjct: 317  ISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANILILTLRTL 376

Query: 349  SGT--TDMGSHKPDLSN-GFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFXXXX 405
            +G    D  S K D  N  F  L +DAD L++LFVLV CR++ K+++ HL YLQNF    
Sbjct: 377  TGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHLSYLQNFYNND 436

Query: 406  XXXKFGILGYAISTLEAVVCYFEXXXXXXXXXXXXXLLCIKTRDLLDKLSCENPTNEVND 465
               KFGILGYA+STLEAVVCYFE               C     L+  LS      E N 
Sbjct: 437  SDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDF-CNSNERLVKVLSSTKKY-ETNA 494

Query: 466  ----LATYKDILAYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGS 521
                L  Y+  L YR+  GQS+L+LCI + +ND L  +L+EYE LFPIED+L DE+IDGS
Sbjct: 495  ALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLLADESIDGS 554

Query: 522  TLLIESIKVGNLEATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIG 581
            TLLI+++K  N  +  +L+ I+  NCT+ EL+ Y+N+ D   R+  H+LT+E+++LK +G
Sbjct: 555  TLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNELEVLKLMG 614

Query: 582  SYINWKQKNSSGQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKG 641
             YINW QK+++GQTPLF+IFRSYDQ NY+EMV  +   A++WY  +  +F Y DH D KG
Sbjct: 615  KYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNYLDHVDKKG 674

Query: 642  NSLLHVLKTDVSILLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQ 701
            N+LLH+LK ++ ILL    +N+N  N  G TPLM  ++YKR  NI  +  D RL ++  Q
Sbjct: 675  NTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDPRLRVDITQ 734

Query: 702  NSTFFTCFDYAKDRLVLSKIGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFV 761
             +   T FD++KD  +   +GE    +S +  +Y H+L+Y   N+  N++   K ++   
Sbjct: 735  KNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKY--TNSRWNLSLTVKLKDAPK 792

Query: 762  TAVINMKTIQGLLRSIVKDNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNC 821
            T    +KT++G+LR ++K+N   FLP+   ++ +   NR   + + +  V  +L  ++ C
Sbjct: 793  TTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRIKVLEMLPFISFC 852

Query: 822  FNVLLFLKKVPQNLFTDEASVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFN 881
             + L+ +K +  N+F  E + + W+++N S   +   + D    + PE+I+MIQ+FL+FN
Sbjct: 853  LSALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSD----ITPEDISMIQNFLKFN 908

Query: 882  FDEILSFKASLNILRKILIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHKM 941
              EI   K  L I  K+ +F  LKS D  ++  + + + +++++ +         ++ K+
Sbjct: 909  ITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLKYSAEDTKL 968

Query: 942  FSDLSLDELLEHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAV 1001
             S  +   LL  + +L+ C  +L N I +I    I NWW  YGE L  HK+Y +AFP   
Sbjct: 969  LSVRAEKALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHYTRAFPELA 1028

Query: 1002 KPKSTAGTSSHIPLGGFIET-KREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELS 1060
               +    +  + L   I   KR + E+RLS +IK  ++ L  +G +I   HE  AEE+S
Sbjct: 1029 ---NVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELAAEEVS 1085

Query: 1061 NYMEFR 1066
             +++ +
Sbjct: 1086 RFIDLK 1091

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML002W and
            YML003W; YML002W and YML003W represent one ORF in this
            genome
          Length = 1071

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/1076 (34%), Positives = 600/1076 (55%), Gaps = 59/1076 (5%)

Query: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLH 63
            YHLP LLNPL+NA+FNCP P  SPLKKLF N + ++FIL+ P + +LL Y D  T +PL 
Sbjct: 3    YHLPVLLNPLVNAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVPLT 62

Query: 64   ELCYNADFINSHILLTTENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLRRRL 123
            ELCYN +F+ SH L+  + + +     +  ++T++GK+VV++ ++ +I      P  ++ 
Sbjct: 63   ELCYNYEFVASHTLVQLQEARVT----ELEFQTINGKSVVIRPQSGII---TAQPSAKKC 115

Query: 124  KILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFN------SYEETSKTAR 177
            +I   ++L +FNDY  G   FA+LYID+PL  E      L  F        Y+  ++TA 
Sbjct: 116  RIQRCELLRSFNDYLLGRTAFALLYIDRPLVGEIELITPLRVFGPQEQPLQYQRITQTA- 174

Query: 178  NAPNLLMDTSQLERSSFENILHIHPAWLTQLGQLFSN----YRRAALNDDPSKKMFEELV 233
            +AP  L           E  L +HP    QL ++F +     R  AL+     ++F ELV
Sbjct: 175  DAPLPL-----------EQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHELV 223

Query: 234  EQAFDGMKSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTENCEYF---- 289
            E+ +  +K D  F+N+ NL +++  Y ELN+YED+W +L +   G         Y+    
Sbjct: 224  EKVYCLIKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKL-VQLNGKNEPDRVPGYYITRS 282

Query: 290  -SVNQLLTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHL 348
             S+NQL T  Y ++ + F LS +T IE+RV  A++ F KL L++S+ EK++IL+ T Q L
Sbjct: 283  ISLNQLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKL 342

Query: 349  SGTTDMGSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFXXXXXXX 408
            +  T   +  P          +DADTL+ L V+VVCR++ K+++SHL YL+ F       
Sbjct: 343  TTKTSQATLDP---------MIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDV 393

Query: 409  KFGILGYAISTLEAVVCYFEXXXXXXXXXXXXXLLCIKTRDLLDKLSCENPTNEVNDLAT 468
            KFG+LGY++STLEAVV YF+               C + +   + +    P N    L  
Sbjct: 394  KFGLLGYSLSTLEAVVGYFDIGGSSIKLERLITQ-CQRNKIFWNLIEQGIPIN----LKE 448

Query: 469  YKDILAYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESI 528
            ++++L  R    +S+LSLCI   + D+  D+++ Y++ F +EDIL+D      +LLI+++
Sbjct: 449  HEEVLISRTPSCESVLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQAL 508

Query: 529  KVGNLEATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQ 588
            + GN + T+ +I +++ NCT+ E+  Y+NK D   R+V HYL    +I+  +G +++WK+
Sbjct: 509  QAGNKDITEAVIDLLIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKR 568

Query: 589  KNSSGQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVL 648
            K+ +  TPLF++ R+YD P+Y E++   F     +Y      F ++DH D  GN+LLH++
Sbjct: 569  KDLNMHTPLFTVCRAYDHPSYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHII 628

Query: 649  KTDVSILLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTC 708
            K  + + L     N+N  N +G+TPLMVY KY R+ NI  I  D RLIL K+Q+      
Sbjct: 629  KDGIQLALSTPGANVNKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKA 688

Query: 709  FDYAKDRLVLSKIGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFVTAVINMK 768
             DY K+ ++L+ IG   A +S++G + +H+++Y      + +TS S + E + T+   +K
Sbjct: 689  IDYVKNPIILNLIGTAMAKNSLYGCLSVHNIKYEENAWYLWITS-SLSPESYKTSSYALK 747

Query: 769  TIQGLLRSIVKDNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFL 828
             IQ LL+   K +P +FLPID++++ +  L +S +  +   +   LL  LT   +++   
Sbjct: 748  DIQSLLQIYNKKHPMSFLPIDHHLETLKTLGKSGIISVINLENSMLLEALTFSLSIIQ-Q 806

Query: 829  KKVPQNLFT-DEASVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILS 887
            ++  +N+F+  E+ +  W+R   S   QKP  +D    +EPEEI+ IQ+FL+F+  E   
Sbjct: 807  REDYKNVFSYTESELSTWLR--ASMVKQKPNKRDK---IEPEEIHSIQNFLKFSLTEFNY 861

Query: 888  FKASLNILRKILIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHKMFSDLSL 947
             +    +L+K++IF   KS D E +   L   G  + +   +    T   +++ F+D  +
Sbjct: 862  LREKFTVLKKLIIFEHYKSHDIECSQRILYSQGEIIASVVPSKRLRTSPFDNE-FND-GI 919

Query: 948  DELLEHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTA 1007
            D   + V F+  C   L + I  +L  ++  WW  YGE   L K Y++ FP   KP S +
Sbjct: 920  DPFEQAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSAS 979

Query: 1008 GTSSHIPLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYM 1063
               S      ++E KR++ E +L  ++   S+ L+ L +E+   HE LAEE+S ++
Sbjct: 980  SEDSKGFFVSYMEDKRQKLESKLQSRLSVCSENLQHLDAELKHCHELLAEEISFFI 1035

>Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML002W -
            Hypothetical ORF [contig 185] FULL
          Length = 1089

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/1099 (34%), Positives = 600/1099 (54%), Gaps = 48/1099 (4%)

Query: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLH 63
            Y+LP LLNPLINA+FNCP P  S LKK+F+ ++  RF+L+APP+ LLL Y D+++ LPL 
Sbjct: 3    YYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLPLQ 62

Query: 64   ELCYNADFINSHILLTTENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLRRRL 123
            +LCY   F++ HI+L          L+++ Y+TL GKT++++ +  +I T   F  RRR 
Sbjct: 63   DLCYATGFVSDHIVLLDGRE----GLQEEEYKTLSGKTILLRSQQGIIFTAAAFDTRRRC 118

Query: 124  KILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCF--NSYEETSKTARNAPN 181
            +I   ++L NFN+Y KG   F I+++D PL       D   CF     +E +   +N+  
Sbjct: 119  RIQRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKNQEHTNGPKNSGK 178

Query: 182  LLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKM-----FEELVEQA 236
            L    + +   S E +L I+P +   L  +    +R +LN   +        F +  ++A
Sbjct: 179  LSHGDNNI---SLEQLLRINPEYGESLNDIV-KAQRISLNSSVTGTTHLASHFVQTCKKA 234

Query: 237  FDGMKSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTEN----CEYFSVN 292
             D +++   F+   NL   +H+Y ELNLY+D W++LT   +  E+ + +     ++ SV+
Sbjct: 235  LDVVRAYPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHISVS 294

Query: 293  QLLTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTT 352
            Q+ +  Y  + E F L  IT  E+ V  A + F+K+A+++ ++ K+K+++ETLQ LS + 
Sbjct: 295  QVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLSRSL 354

Query: 353  DMGSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFXXXXXXXKFGI 412
             +             +T+DADTL+SLFV+VVC ++ K +RSHL+YLQ F        FGI
Sbjct: 355  LVDDRA---------VTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGI 405

Query: 413  LGYAISTLEAVVCYFEXXXXXXXXXXXXXLLCIKTRDLLDKLSCENPTNEVNDLATYKDI 472
            L Y +STLEAV+CYFE               C         +S  +     +      D+
Sbjct: 406  LAYGMSTLEAVLCYFESPEKVASLEKY----CRANLSHWKSISEGSIDLNADTTVPLDDL 461

Query: 473  LAYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVGN 532
            L  R   GQS L++C+ + + +    + +  EA FP+ED+L DET DGS LLI  ++ G 
Sbjct: 462  LKIRTSDGQSCLAVCLQHRRTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGC 521

Query: 533  LEATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNSS 592
                 +LI  ++ NCT +EL+ ++N T+KY RS  HYL H   ++  +G  +NW+Q++ +
Sbjct: 522  DRLAVMLINTLISNCTKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCN 581

Query: 593  GQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDV 652
            G TPLF+I R+YD+P+Y +MV  A+  A    +  N+ F  S+HTD+KGN+LLHV+K+DV
Sbjct: 582  GHTPLFAIVRAYDRPDYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDV 641

Query: 653  SILLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDYA 712
            SILL    +++N  N KGLTPLMVYV+Y R+ N+  I +D RLI+ K Q+  + +CFDY 
Sbjct: 642  SILLADPFIDVNATNAKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYV 701

Query: 713  KDRLVLSKIGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEE-PFVTAVINMKTIQ 771
            K+  VL ++G+  +       I +HS++       + +T     ++ P      +++ IQ
Sbjct: 702  KNPAVLKELGKYASYLPFEFSINVHSVKREGDEWVLWITVTGGEKQVPVKVFKRSLRFIQ 761

Query: 772  GLLRSIVKDNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKV 831
              L      +P TF+P+D  +  +  L++S + I+ K D +  L +   C   L  + + 
Sbjct: 762  AFLTLFSDAHPMTFVPVDELLRELRALSQSRILILNKMDTKRFLKR---CSVTLSMVSQ- 817

Query: 832  PQNLFTDEASVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKAS 891
             + LF D  +       ++           N K MEPEE+  IQS L+FN  EI + K +
Sbjct: 818  -ERLFADAFTDSNLNLSSSRGLGSSESFTQNMKMMEPEEVRSIQSILKFNLSEISALKTA 876

Query: 892  LNILRKILIFLSLKSSDFEDAYASLLKMGTKVTNGK--AADAFTTIIKNHKMFSDLSLDE 949
            + +++K+ +F  LK  D  +A  +       VT GK  + D F   ++   +F     + 
Sbjct: 877  MLLMKKLAVFEGLKGKDLSEACMTFGAKCKYVTQGKIQSFDHFLN-VQAPNLF---DFEG 932

Query: 950  LLEHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGT 1009
            +  ++   E C+  L   I  +L D IP WW  YGE L+L + Y+K+FP A +P  +  +
Sbjct: 933  IANNIALCELCSSLLCKHIGQVLNDDIPKWWHTYGELLSLRREYKKSFPDANRPHVSENS 992

Query: 1010 SSHIPLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKAC 1069
                  G +IETKR + EQ  + +I  +S  L E+ ++I   +E LA EL+N++ F+   
Sbjct: 993  GL---FGSYIETKRTKLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEF 1049

Query: 1070 LDQRTIVAFAIKNISVLQE 1088
            L +  I   A  NI  L+E
Sbjct: 1050 L-KSAIKEHADTNIKRLRE 1067

>KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] {ON}
            similar to uniprot|Q04263 Saccharomyces cerevisiae
            YML002W Hypothetical ORF
          Length = 1097

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/1105 (33%), Positives = 605/1105 (54%), Gaps = 58/1105 (5%)

Query: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLH 63
            Y+LP LLNPLINA+FNCP P+ SPL+K+F  ++ +RF L+ P   +LL Y D+++   L 
Sbjct: 3    YYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSSLQ 62

Query: 64   ELCYNADFINSHILLTTENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLRRRL 123
            +LCY+A F++ HILL            ++ Y+TL GKT+ ++ +   + T  GF  RRR 
Sbjct: 63   DLCYSASFVSDHILLLGGGG----CSHEEEYKTLSGKTITLRNQQKALFTGEGFDARRRC 118

Query: 124  KILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFNSYEETSKTARNAPNLL 183
            ++L+T++L NFN+YF+G+  + I+++D PL       D    F +Y   S    +A + L
Sbjct: 119  QVLETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYRFASTDTTSANSSL 178

Query: 184  MDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAAL-----NDDPSKKMFEELVEQAFD 238
              +++  ++S E +L  HP++  +L  +    +RAAL     N D     F +  E+A  
Sbjct: 179  AASTE-PKASLEQMLRAHPSYGDKLSAIIRT-QRAALSSSTYNADNLAAHFMQTCEKALA 236

Query: 239  GMKSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTEN----CEYFSVNQL 294
             ++ D  F+ F NL   IH+Y E+NLY+D W++LT   K  E+  ++        S++Q+
Sbjct: 237  AIQEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNISISQV 296

Query: 295  LTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTTDM 354
             +  Y  D + F +  +T +E+ +  A +  ++L +++S++ K+K++VETLQ +S + ++
Sbjct: 297  PSFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEI 356

Query: 355  GSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFXXXXXXXKFGILG 414
                         +++DADTL+SL V+VVC++E K ++SHL+YLQ F        FGIL 
Sbjct: 357  NDKV---------ISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILA 407

Query: 415  YAISTLEAVVCYFEXXXXXXXXXXXXXLLCIKTRDLLDKLS-CENPTNEVNDLATYKDIL 473
            Y +STLEAV+ YFE               C       + L+  + P   +N  +  KDIL
Sbjct: 408  YGMSTLEAVLSYFESREKLKLLEKH----CSSNASYWEALADGKLPLGSLNP-SEVKDIL 462

Query: 474  AYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVGNL 533
              R   G S LS+C+ N + ++ L + +++E  FP+ED+L DET++GS LLI+ +  G  
Sbjct: 463  RTRTPAGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCS 522

Query: 534  EATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNSSG 593
              +   I ++  +CT  EL +++N  ++Y RS  HYL H +D++  +G +INW+Q++ +G
Sbjct: 523  SLSGNFIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCNG 582

Query: 594  QTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDVS 653
             TPLF+I R+YD  +Y+ MV  A+  A  W       F  S H DNKGN+LLHV+K++VS
Sbjct: 583  HTPLFAIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVS 642

Query: 654  ILLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDYAK 713
            ++L    +N+N  N KGLTP+MVY +Y RL NI +I +D RLI++K QN ++ TCFDY K
Sbjct: 643  VVLDDPLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYIK 702

Query: 714  DRLVLSKIGERGANDSIFGLIYLHSLRYHNLNATVN--------VTSVSKTEEPFVTAVI 765
            + +VL ++G+       F L   + +R HN+    +        V SV     P      
Sbjct: 703  NPVVLGELGKHA-----FFLPQSYQIRAHNIKFEGDEWVLWMTLVGSVPNA--PAKVIQR 755

Query: 766  NMKTIQGLLRSIVKDNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVL 825
            ++K IQ  L S  K N  TF+P ++  + +S L +  +  I + + +  L + +   +++
Sbjct: 756  SLKFIQSFLISFSKTNSMTFIPAESLAEELSLLAKMKIISINRLETKHFLRRASVVLSLI 815

Query: 826  LFLKKVPQNLFTDEASVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEI 885
               ++  +++F + +  L    +N +   Q+  +      +EPEE+  IQ  ++FN  EI
Sbjct: 816  CRQEEF-EHIFNNPSGSL----VNAAEHVQEQEANSTYGMIEPEEVASIQKIMKFNRTEI 870

Query: 886  LSFKASLNILRKILIFLSLKSSDFEDAYASLLKMGTKVTN--GKAADAFTTIIKNHKMFS 943
            L+ K+   +L+K+ IF  LK  D E ++      G   T   G++ + F ++   H +  
Sbjct: 871  LAIKSGALMLKKLAIFGILKGKDLERSHTMFQSHGNNFTKIIGRSTNVFGSL--KHSL-P 927

Query: 944  DLSLDELLEHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKP 1003
                  L  +   LE  +  L   I  IL   IP+WWK YGE ++L   Y K FP  V+P
Sbjct: 928  QCEFGYLANNTALLELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPDDVRP 987

Query: 1004 KSTAGTSSHIPLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYM 1063
            +    T     +  +IETKR + EQ L  +I  SSK L      +  ++E+LA EL+N++
Sbjct: 988  RVAENTGF---ISSYIETKRVRLEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNNFI 1044

Query: 1064 EFRKACLDQRTIVAFAIKNISVLQE 1088
             F+       TI   A  NI  LQE
Sbjct: 1045 NFKAEFWVSATIKEHAAMNIKWLQE 1069

>KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6.20
            YML002W
          Length = 1131

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/1141 (35%), Positives = 617/1141 (54%), Gaps = 87/1141 (7%)

Query: 6    LPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLHEL 65
            +P LLNPL++A+FNC + E SPL+K++++L    FILL PP+  L  Y D  TK PLHEL
Sbjct: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60

Query: 66   CYNADFINSHILLT---TENSYINTTL------RDDHYETLDGKTVVVQWKNNVIHTLNG 116
            C++ +F++SHIL      +N  I+T L      R+  + T +GK +   +    ++T +G
Sbjct: 61   CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDG 120

Query: 117  FPLRRRLKILDTKILPNFNDYFKGAEYFAILYIDQPL--GCEFVPNDYLHCF-NSYEETS 173
            F  R   +IL  + L +F +Y +G+  F ++YIDQPL      +  + L CF N    T+
Sbjct: 121  FSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPNLTINTT 180

Query: 174  KTARNAPNLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKM----F 229
             + R+  NL       +R+   N + IH  +  +   +F NYR+       S+ M    F
Sbjct: 181  PSTRSLANLSSAEVPPQRNPLLNSM-IHAQYNWKFRAVFQNYRKEITQ---SESMLIPGF 236

Query: 230  EELVEQAFDGMKSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKG---YEVNTENC 286
             + +++ +DG+  D+ F     +  LI +Y E N+Y+D+W  L          E  +E+ 
Sbjct: 237  RKTIDKIYDGL--DNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQSESS 294

Query: 287  EYF---SVNQLLTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVE 343
            + F   S++QL TD+Y   F  F L DI  +E+ +S A+K F+ L+++H+Y EK ++LVE
Sbjct: 295  DIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVLVE 354

Query: 344  TLQHLSGTTDMGSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFXX 403
            TLQ LS        KP    G   + + ADTL+SLF+L++ R++ K+IR HLYYLQNF  
Sbjct: 355  TLQILS--------KPVKRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQ 406

Query: 404  XXXXXKFGILGYAISTLEAVVCYFEXXXXXXXXXXXXXLLCIKTRD--------LLDKLS 455
                 KFG+LGYAISTLEAV+CY E             L CI+  D        LL +  
Sbjct: 407  DENSIKFGLLGYAISTLEAVICYLETIETDKER-----LDCIEKNDANLEEFLTLLTRSK 461

Query: 456  CENPTNEVNDLATYKDILAYRNEQGQSILSLCITNNKNDILLDVLSE-YEALFPIEDILE 514
            C   +NE  DL+ Y     YRN  G S LSLCI N KNDI  ++LSE YE+ F  ED+LE
Sbjct: 462  C--VSNEGLDLSKYSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLE 519

Query: 515  DETIDGSTLLIESIKVGNLEATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEM 574
            D+T +G+TLL++S++  N E T+ L  IML N T+EEL  Y  K DKY R++ HY+  + 
Sbjct: 520  DQTTEGTTLLMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQ 579

Query: 575  DILKSIGSYINWKQKNSSGQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQR-HNTSFGY 633
             +L+ IG YI W  K+ +GQTPL  IFRSYDQ  Y+ MV+ +F IA  WY    N+ F +
Sbjct: 580  TLLQKIGKYIKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCF 639

Query: 634  SDHTDNKGNSLLHVLKTDVSILLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDH 693
             DHTD+KGN+LLH++K ++S LLQ   ++IN  N +GL+PL     Y R  N++A+ KD 
Sbjct: 640  RDHTDSKGNTLLHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDP 699

Query: 694  RLILEKVQNSTFFTCFDYAKDRLVLSKIGERGANDSIF-GLIYLH-SLRYHNLNATVNVT 751
            RLI        F   +   K   +LS       N++ F  +I  H   R  N  + V +T
Sbjct: 700  RLIFSSFD---FLKQYPNTKSAPILSHYC--LDNEAPFRNIIASHFDFRISNKRSVV-LT 753

Query: 752  SVSK--TEEPFVTAVINMKTIQGLLRSIVKDNPFTFLPIDNYIDGISHLNR--SDLTIIG 807
            S SK   +E   +    +K ++ L R ++K +PFTF P++  +D +S + +  S  +++ 
Sbjct: 754  SRSKEDAQELIGSEAFELKNLKALFRLLLKQHPFTFFPLEELLDELSVVEKTASSRSLMK 813

Query: 808  KADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEASV---LYWMRINTSRRNQKPPSKDNPK 864
             +    +L KLT C + ++ ++ +P       A +   +   ++       K  SKD  K
Sbjct: 814  SSFCSKVLKKLTYCLDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKLKRRSKD--K 871

Query: 865  TMEPEEINMIQSFLRFNFDEILSFKASLNILRKILIFLSLKSSDFEDAYASLLKMGTKVT 924
             M+PE I  I +FL++  + +L  K ++  LRK  I   LKS D  ++   +  +G +V+
Sbjct: 872  KMQPESIGTITTFLKYILESLLKLKGTIIELRKFSILSKLKSKDISESKNIVCTLGAEVS 931

Query: 925  N---GKAADAFTTIIKNHKMFSDLSLDELLEHVQFLEECTIQLFNSIQTILFDRIPNWWK 981
            +   G+A   ++TI  ++K   + S D L+  + F E C   + NSI  +L  +IP WWK
Sbjct: 932  SKKIGRAMVRYSTI--DNKFLGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWK 989

Query: 982  HYGEFLTLHK---------NYRKAFPSA---VKPKSTAGTSSHIPLGGFIETKREQSEQR 1029
             YG+ L L K         +  K  P+A   V   +T  TS    LG FIE KR ++++R
Sbjct: 990  CYGQLLELSKEDPSVLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQER 1049

Query: 1030 LSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACLDQRTIVAFAIKNISVLQEC 1089
                I    + LK L +EI + +  +  E   ++ F+   +    +  +   NI++L++ 
Sbjct: 1050 TRAAISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQSKFIHSAMLEKWVKLNINLLKKS 1109

Query: 1090 I 1090
            +
Sbjct: 1110 L 1110

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
            YML002W
          Length = 1107

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/1103 (32%), Positives = 605/1103 (54%), Gaps = 31/1103 (2%)

Query: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLH 63
            Y +P L NPLINA+FNCP+P  SP KKL+  L+ + F+LL P   +LL Y D  + +   
Sbjct: 3    YFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNISFR 62

Query: 64   ELCYNADFINSHILLTTENSYI------NTTLRDDHYETLDGKTVVVQWKNNVIHTLNGF 117
            ELCY  DF+ +HIL+  +NS        N    D + ++L+GK V++  + ++   + G+
Sbjct: 63   ELCYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLL--RQSLCIPIKGY 120

Query: 118  PLRRRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGC-EFVPNDYLHCFNSYEETS--K 174
              +R+ ++ D  +L NFNDY  G+ +F I++ID PLG  ++   D L  F    E     
Sbjct: 121  FSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGFEESRELPFHS 180

Query: 175  TARNAPNLLMDTSQ--LERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKMFEEL 232
              ++ P LL  T +   +R  F  +      W  +L +    Y+      +   ++F ++
Sbjct: 181  QDKDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQNIGSELFHDI 240

Query: 233  VEQAFDGMKSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTENCEYFSVN 292
            V   ++ +K +  F+ F+NLYD+ ++Y E  LY+DIW++L  H++   ++       S++
Sbjct: 241  VNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDKILDFRLVSQLSLD 300

Query: 293  QLLTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTT 352
             L T +Y++ F++F+L DI  +E  +  A   F+ +  ++SY++K  ++ +TL  ++G  
Sbjct: 301  MLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIFKTLNIITGK- 359

Query: 353  DMGSHKPDLSNGFNNLTM-DADTLISLFVLVVCRSEQKHIRSHLYYLQNFXXXXXXXKFG 411
               S      N    L + DADTL+SLF L++CR+  + +  H+ YLQ+F       KFG
Sbjct: 360  --NSDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYKDENTVKFG 417

Query: 412  ILGYAISTLEAVVCYFEXXXXXXXXXXXXXLLCIKTRDLLDKLSCENPTNEVNDLATYKD 471
             LGY +ST+EA + YF               L +   D L K+  ++  +++  +  +KD
Sbjct: 418  ALGYTLSTIEATLSYFYELSNSDESRIQLQKLSL-LEDFLIKIRSQH--DDLIPINQFKD 474

Query: 472  ILAYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVG 531
               YR + G+SILSL I N KN+ L + L  +E +FP++D+L D  + GSTLLI+ +K  
Sbjct: 475  YFRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLLIKCLKER 534

Query: 532  NLEATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNS 591
            NLEA +ILI I   +CT+ EL+ Y NKTDK  R++AHY+T E++IL+ IG YINW  K+ 
Sbjct: 535  NLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIGKYINWTLKDL 594

Query: 592  SGQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTD 651
             G+T LF+IFRSYDQ  Y   +K+A + A  WY+ ++  F  SDHTD  G+SLLH+LK+ 
Sbjct: 595  KGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSLLHILKSQ 654

Query: 652  VSILLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDY 711
            VS+LL+   L+IN  N KG+TPLM YVKY R+ NI  I +D RLI++K+Q   +  C DY
Sbjct: 655  VSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQKDKYLNCLDY 714

Query: 712  AKDRLVLSKIGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFVTAVINMKTIQ 771
             K+  V + +  + + D IF   Y+   RY   +  + + SV K +  + T +I +K   
Sbjct: 715  GKNFTVFNLLAAKLSKDVIFENAYISYARYEKSHWYLCI-SVQKDDLEYTTNIIKLKKYY 773

Query: 772  GLLRSIVKDNPFTFLPIDNYIDGISHLNRS-DLTIIGKADVRSLLHKLTNCFNVLLFLKK 830
             L+ ++ K     F+P  + +D +  +    ++  I +  +++ L+ L++  + LL+ +K
Sbjct: 774  NLINAMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLSALLYFEK 833

Query: 831  VPQNLFTDEASVLYWMRINTSRRNQKPPSKDNPKTMEP---EEINMIQSFLRFNFDEILS 887
            +      DE  ++ W+   +S+  Q+  S D+  + +P   E+IN I++F  F+F EI  
Sbjct: 834  IDPLTLLDENLIIKWI---SSKLQQQEKSIDDHSSFKPLSAEDINNIKAFCDFSFQEIGK 890

Query: 888  FKASLNILRKILIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTI--IKNHKMFSDL 945
                +    K+ IF  +K++D   +Y  L ++G+  +N + +     +  I  H + S +
Sbjct: 891  TNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQSISPH-VHSSM 949

Query: 946  SLDELLEHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKS 1005
               EL + + F+++CT+ L + + + + D++  W K   + L   K Y   F  + +   
Sbjct: 950  VYYELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFLQSNEETG 1009

Query: 1006 TAGTSSHIPLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEF 1065
                ++ +    +  T R++ E+RL   +    + LK+LG+EI   HE LAEE S+Y+  
Sbjct: 1010 NLSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDYVRM 1069

Query: 1066 RKACLDQRTIVAFAIKNISVLQE 1088
            +        +  F   N++ L+E
Sbjct: 1070 KSKFNSNLLVRKFVSLNLAHLKE 1092

>NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6.20
            YML002W
          Length = 1193

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/1191 (34%), Positives = 633/1191 (53%), Gaps = 116/1191 (9%)

Query: 1    MSIYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKL 60
            MS YHLPTLLNPL+NA+FNCP+P  SP KKLF  L+ ++FILL PP+  LLNY D   KL
Sbjct: 1    MSQYHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKL 60

Query: 61   PLHELCY-NADFINSHILLTT----ENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLN 115
             L+ELCY N+DF+ SHIL  +     N    TT  D+ ++ L+G   +++WK+N+I T  
Sbjct: 61   SLNELCYHNSDFLGSHILTWSNAIDSNKDSTTTNDDEEFDNLNGNKFIIKWKHNIIFTRG 120

Query: 116  GFPLRRRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGCE-FVPNDYLHCFNSYEETSK 174
             F   +R KIL    L NFNDYF G++ F +++ID+P+     + ND L C        K
Sbjct: 121  NFSNDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLK 180

Query: 175  TARNAPNLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKMFEELVE 234
            +      L+ D SQ  +SSFEN L+ + AW  + G L +NY+  +   +P+ K+F ELV 
Sbjct: 181  SQEKETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELEPNHKLFRELVN 240

Query: 235  QAFDGMKSDSLFKNF-----SNLYDLIHDYFELNLYEDIWSR----LTIHFKGYEVNTEN 285
            +AF  + S   F+         L+ L HDY E +LY++IWSR    +    K Y  + + 
Sbjct: 241  EAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYADDQKA 300

Query: 286  ---CEYFSVNQLLTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILV 342
                ++FS+ ++  ++Y    + F L  +  +E+ +  +     KL  + SY EKS IL+
Sbjct: 301  QHLIKHFSIVEIDPNFY----DIFPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKSTILI 356

Query: 343  ETLQHLSGTTDMGSHKPDLSNGFNNLTMDADTLISLFVLVVCRSE--QKHIRSHLYYLQN 400
            E+LQ ++ +   G    D +       +DAD L++L  LV+ +S      ++++LYYL+ 
Sbjct: 357  ESLQIITDSNTGGEESKDKNKS--GYLIDADNLLNLLTLVILQSNITLHDLKANLYYLKY 414

Query: 401  FXXXXXXXKFGILGYAISTLEAVVCYFEXXXXXXXXXXXXXLLCIKTRDLLDKLSCENPT 460
            F        FGIL Y I+T   V    E             L  I+   + D LS  + T
Sbjct: 415  FSTDESSSSFGILNYTIATFHMVSHVLENVIDWDRLKEKSDL--IEELIMTDDLSTLSST 472

Query: 461  NEVNDLATYKDILAYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDG 520
             E ND  T   +L YRN  G+S+L+L I N +N      L EYE +  ++ I  D+++D 
Sbjct: 473  FE-NDKKT---LLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISNDQSMDS 528

Query: 521  STLLIESIKVGNLEATKILIRIMLFNCTDE-ELVTYVNKTDKYARSVAHYLTHEMDILKS 579
            STLL+++I+  N EA  IL++++  NC ++ EL++Y+N+ D + R++ HYL   + ILK 
Sbjct: 529  STLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVINLTILKI 588

Query: 580  IGSYINWKQKNSSGQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDN 639
            IG +INWKQK+ +G+TPLF+IFRSYDQ NY+E+V   F IA  WY  +N  F  +DH D+
Sbjct: 589  IGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQMNDHDDS 648

Query: 640  KGNSLLHVLKTDVSILLQLTK-----LNINGENYKGLTPLMVYVKYKRLSNIDAITKDHR 694
             GNSLLH+L+ ++SILL   K     +N+N  N KG TPLM+Y KYKR  NI  I K+ +
Sbjct: 649  NGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMIIKEEK 708

Query: 695  LILEKVQNSTFFTCFDYAKDRLVLSKIGE-RGANDSIFGLIYLHSLRYHN---------- 743
            LI  K Q+  F  CFDY+ D  +++ IGE   +N  +FG I + SL+             
Sbjct: 709  LIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTVPSLPRGL 768

Query: 744  -LNATVNVTSVSKTEEPFVTAVINMKTIQGLLRSIVKDNPFTFLPID-------NYIDGI 795
             +N T+ +    K+    +T  +   ++   L+ + +    +FLP+D       +++D  
Sbjct: 769  YINYTILIDEADKST---LTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSFLDKK 825

Query: 796  SHLNRSDLTI----IGKADVRSLLHKLTNCFNVLLFL--KKVPQNLFTDEASVLYWMRIN 849
            S  N +  TI    I K  +R  L +L  C +VLL      +   L   E  +L W+ I 
Sbjct: 826  SKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPLLLSETELLEWISIE 885

Query: 850  TS--RRNQKPPSKDNP----------KTMEPEEINMIQSFLRFNFDEILSFKASLNILRK 897
             S  RR+   PS  +           K ++PE IN+IQ+FL+FN +E+ +   +L +L K
Sbjct: 886  ESKLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLKVLSK 945

Query: 898  ILIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFT---TIIKNHKMFSD--LSLDELLE 952
            ++IF++LK+ D  DA      +   + N +          +I + +   D  + L+ L E
Sbjct: 946  LVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGVLLESLHE 1005

Query: 953  HVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAV----------- 1001
             + F  ECT++L + ++ I+  +IPNWWK YGE L L+K Y K FP+ V           
Sbjct: 1006 DISFFNECTLKLIHDVENIIKIKIPNWWKLYGELLELNKYYHKNFPNCVVHARRTDLLSG 1065

Query: 1002 ----------------KPKSTAGTSSHIP------LGGFIETKREQSEQRLSVQIKASSK 1039
                             P+     S H            IE ++ + E++ S  I  +  
Sbjct: 1066 NNANTNTNTNTNTNTNSPQRLHHHSEHQNNSNNGVFANLIENQKNKLERKTSHHIDETIS 1125

Query: 1040 ILKELGSEIFSAHENLAEELSNYMEFRKACLDQRTIVAFAIKNISVLQECI 1090
            +L+ LGS + + HE+LAEEL+ YMEF+     +  +  F  ++I +L+E +
Sbjct: 1126 LLESLGSGLLNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDIKLLEEHV 1176

>YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative
           protein of unknown function
          Length = 290

 Score =  485 bits (1249), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 229/289 (79%), Positives = 255/289 (88%)

Query: 1   MSIYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKL 60
           MS+YHLPTLLNPL+NAIFNCPEPE+SPLKKLFANL+TRRFILLAPPS  LLNYHDVK+KL
Sbjct: 1   MSVYHLPTLLNPLVNAIFNCPEPERSPLKKLFANLKTRRFILLAPPSEYLLNYHDVKSKL 60

Query: 61  PLHELCYNADFINSHILLTTENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLR 120
           PLH+LCYNA+FINS+ILL TENSYINT  RD HYETLDGKTVV+QWKNNVIH LNGF +R
Sbjct: 61  PLHDLCYNAEFINSYILLMTENSYINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFHIR 120

Query: 121 RRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFNSYEETSKTARNAP 180
           RRLKIL+TKILPNFNDYF+GA  F IL+IDQPL CEFVPNDYL CF++YE+  K A   P
Sbjct: 121 RRLKILETKILPNFNDYFEGAADFIILFIDQPLNCEFVPNDYLQCFHNYEKIPKNAHAMP 180

Query: 181 NLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKMFEELVEQAFDGM 240
           NL +D+ Q ERSSFENILHIHPA LTQLGQLFS+YR  A  DDPS+ +FE +V+QAFDGM
Sbjct: 181 NLSIDSFQQERSSFENILHIHPARLTQLGQLFSSYRTLAPGDDPSRSIFESIVQQAFDGM 240

Query: 241 KSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTENCEYF 289
           KSDSLFKNFSNLYDLIHDYFELNLY+DIWSRLT HFKG+EV+TE    F
Sbjct: 241 KSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLTTHFKGHEVDTEKINIF 289

>KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some
            similarities with uniprot|Q04257 Saccharomyces cerevisiae
            YML002W and some similarities with uniprot|Q04257
            Saccharomyces cerevisiae YML003W Hypothetical ORF
          Length = 1067

 Score =  509 bits (1310), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 352/1109 (31%), Positives = 586/1109 (52%), Gaps = 102/1109 (9%)

Query: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLH 63
            YHLP LLNPL+NAIFNCP P+ S LK++F+ L   RF +L P +  LL + D+++ L L 
Sbjct: 3    YHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLELA 62

Query: 64   ELCYNADFINSHILLT---TENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLR 120
            ELCY+ DF+ SHI++    T++     ++ +  + TL+G+ + ++++N+ I T +GF  R
Sbjct: 63   ELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFTER 122

Query: 121  RRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFNSYEETSKTARNAP 180
            R++ I +  +LP FNDY KG+ Y  IL+I  PL  + VP D L  F+       + +   
Sbjct: 123  RKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSKVAGNKYSKQEQA 182

Query: 181  NLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKMFEELVEQAFDGM 240
             L  D  Q +   FE           ++  +     R AL    +K   ++ +  +  G+
Sbjct: 183  PLPFDEEQKKVLYFEQ----------RIQSISDVAERVALTFHLTKARIKKAI--SVIGI 230

Query: 241  KSD------------SLFKNFSNLYDL---IHDYFELNLYEDIWSRLTIHFKGYEV---- 281
            +++            SL K  ++L DL   I+DY EL L+ DI  +L+   +  E+    
Sbjct: 231  RTEWLNTRDSIRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRF 290

Query: 282  NTENCEYFSVNQLLTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKIL 341
            + +     S+NQ+ T++Y KD +SF L+ +  +E+ V+ A ++ + + L  +++ K ++L
Sbjct: 291  DFKALRSISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVL 350

Query: 342  VETLQHLSGTTDMGSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNF 401
              T++              LS   N ++ DADTL+SLFVL++CRS+   +   L YL NF
Sbjct: 351  STTMRL-------------LSREINGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNF 397

Query: 402  XXXXXXXKFGILGYAISTLEAVVCYFEXXXXXXXXXXXXXLLCIKTRDLLDKLSCENPTN 461
                   KFG+ GY +ST EA + +F                C   + +   +   +   
Sbjct: 398  EISETSIKFGLQGYVLSTFEAALSFFHQDTVDSLTKK-----CASNKKIWASIQKHSKV- 451

Query: 462  EVNDLATYKDILAYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGS 521
            E   L++    L  R + G+S+LS+CI ++ N++L  +L+ +E+ FP+EDIL+D     S
Sbjct: 452  EAELLSSN---LRIRTDSGESLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALS 508

Query: 522  TLLIESIKVGNLEATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIG 581
            TLLI++++V N +A  IL  I+L +CT+ E+ +Y+N  + + R  AHY+  ++ +L+S+G
Sbjct: 509  TLLIQALQVQNSQAAAILSEIILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVG 568

Query: 582  SYINWKQKNSSGQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKG 641
             Y NW+ K+ +G TPLF++FRSYD  NY+E+V    +    WY  +N  F +  H D KG
Sbjct: 569  RYFNWEHKDINGHTPLFAVFRSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKG 628

Query: 642  NSLLHVLKTDVSILLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQ 701
            N+LLHV+K+ +  LL+L  +N+N  + KGLTPLM+Y +Y R++NI+ I KD RL+ + VQ
Sbjct: 629  NTLLHVMKSGIESLLKLPDVNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQ 688

Query: 702  NSTFFTCFDYAKDRLVLSKIGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFV 761
                 T  D+ K+  V   I +   N      + +HSLR+      + + S    E  F 
Sbjct: 689  QPLVMTSLDFTKNPKVTKTILDATFNREP---VVIHSLRFEERKWKIGIFS----EGIFK 741

Query: 762  TAVINMKTIQGLLRSIVKDNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLH----- 816
               +++  IQ  LR +    P +F P+         L  ++L ++G   V  +L      
Sbjct: 742  KYSLDL--IQYYLRYLKIMYPCSFHPV--------QLLTNELRLLGIYGVPGVLRLQSYH 791

Query: 817  ---KLTNCFNVLLFLKKVPQNLFTDEASVLYWMRINTSRRNQKPPSKDNPKTMEPEEINM 873
               KL   F+ +    K+   L  DE  +   + + T   ++     +    +EPEEIN 
Sbjct: 792  TFKKLDMLFSYVNTRGKLW--LGKDEEELKVLLDVPTPYLSE----SERFIKLEPEEING 845

Query: 874  IQSFLRFNFDEILSFKASLNILRKILIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFT 933
            IQ+FL++N  E    +  L IL+K+ I   +K  D      S L +G +++    A +F 
Sbjct: 846  IQTFLKYNLAEFQKLRNCLIILKKLAIVQQIKHRDVITMRNSFLSLGNQMSQKGVAKSFE 905

Query: 934  TIIKNHKMFSDLSLDELLEHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNY 993
                N     DLS  E   ++++LE   + L N+ +++L  +   WWKH+GE + L K +
Sbjct: 906  NT--NCAWSYDLSYYEFTRNLEYLEHSVVTLLNNFESLL-AKTTLWWKHFGELMELKKEW 962

Query: 994  RKAFPSAVKPKSTAGTSSHIPLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHE 1053
            +K FP+   P S+A  +    +  +IE KR +   +LS Q+K SS  LK++G EI + HE
Sbjct: 963  KKNFPNDKAPPSSANRNF---IDTYIEGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHE 1019

Query: 1054 NLAEELSNYMEFR---------KACLDQR 1073
            ++A  ++ ++EF+         K+ +DQR
Sbjct: 1020 SIAVGINLFIEFKEQFYHDHIVKSIVDQR 1048

>TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_6.20
            YML002W
          Length = 1204

 Score =  458 bits (1179), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 373/1221 (30%), Positives = 599/1221 (49%), Gaps = 180/1221 (14%)

Query: 9    LLNPLINAIFNCPEPE--KSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKT-------- 58
            +LNPLI  +F+    +    PLKKLF  L+  +F+LLAPP+ +LLNY D           
Sbjct: 5    ILNPLIEVLFHSEGTDTLNGPLKKLFEKLKLLKFVLLAPPTDILLNYLDSSNITPRNPYN 64

Query: 59   ---KLPLHELCYNA-DFINSHILLTTENSYINTTLRDDH--YETLDGKTVVVQWKNNVIH 112
                 PL +LC N+ DFI SHILL     Y +  +++D    E+++GKT+ ++       
Sbjct: 65   GSNAKPLEDLCMNSYDFIASHILL-----YDSKVIKNDQCVMESINGKTITIKRVTGNGA 119

Query: 113  TLNGFPL-----------RRRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPND 161
              NG  L           ++ LKI+   +  NFN Y +G E + I YID PL    + N+
Sbjct: 120  LNNGEMLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNE 179

Query: 162  YLHCF-----------------NSYEETSKTA----RNAPNLLMDTSQLERSSFENILHI 200
            +L  F                 N  E T+K      RN   L  D SQ +R  F  ++  
Sbjct: 180  FLTAFDRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKLIKD 239

Query: 201  HPA-WLTQLGQLFSNYRRA------------ALND---DPSKKMFEELVEQAFDGMKSDS 244
                W      L ++YR              A+++   D + +M  ++    F+ +K + 
Sbjct: 240  DRVIW----QPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEK 295

Query: 245  LFKNFS--NLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTENCEYFSVNQLLTDYYS-K 301
             +   S  NL +LI+++ E+ L++DIW R++  F   + +       SVN+LL ++YS  
Sbjct: 296  RYNFLSHDNLMELIYEFIEIKLHDDIWGRISFKFTESDFDFSKLSNISVNKLLLNFYSTN 355

Query: 302  DFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTTDMGSHKPDL 361
            +F++FKL DI  +E+++S A  +FQK     ++ EKS  L++TLQ L+            
Sbjct: 356  NFKNFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILT------------ 403

Query: 362  SNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFXXXXXXXKFGILGYAISTLE 421
                N LT DADTLI L  +V+CR + ++++SHL+YLQNF       KFGILGY+ISTLE
Sbjct: 404  ---INKLT-DADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLE 459

Query: 422  AVVCYFEXXXXXXXXXXXXXLLCIKTRDLLDKLSCENPTNEVNDLATYKDILAYRNEQGQ 481
            A+  YF+               C K  +L D +      N +  L    DIL+YR++ G+
Sbjct: 460  AITYYFDHISHSHKADLIA--FCDKLHNLYDTI-----LNNIKSLDN--DILSYRSQNGE 510

Query: 482  SILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVGNLEATKILIR 541
            S+LSLCI NNK DI L++L+ YE  FPIEDIL+D  ++GS+LL+++ K  N  A++IL+ 
Sbjct: 511  SLLSLCIINNKMDIFLELLTTYEHSFPIEDILDDSDLNGSSLLMQACKYNNYVASEILVT 570

Query: 542  IMLFNCTDEELVTYVNKTDKYARSVAHY--LTHEMDILKSIGSYINWKQKNSSGQTPLFS 599
            I+  +C +EEL  ++NKTDK+ RSVAHY  + + + IL   G+ I+W+ K+    TPL +
Sbjct: 571  ILKNSCNEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLT 630

Query: 600  IFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDVSILLQLT 659
            IF+ +     E  +K+ F +  +WY+ HN  F    H D  GN+LLHV+K  ++ L++  
Sbjct: 631  IFKVHKVNYNESFIKILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENP 690

Query: 660  KL----NINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDYAKDR 715
            +L    NIN  N KGL+P MVY K  R  NI  I K+  LI  + Q       F      
Sbjct: 691  ELCETININANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQ-----LPFLITSTN 745

Query: 716  LVLSKIGERGANDSI----FGLIYLHSLRYHNLNATVNVTSVS--------------KTE 757
            L  SK+    A   +    F  I LHSLR+++ +++ + TS++               T 
Sbjct: 746  LYNSKVNHLLATHFLRTLDFAYICLHSLRFNDPSSSTSGTSLAWLVDISILEKESEFPTS 805

Query: 758  EPFV--TAVINMKTIQGLLRSIVKDNPFTFLPIDNYIDGISHLNRSDLTI---------- 805
             P +  T  + +KTI+ LL   ++   ++ LP+ + ++  + L +S+ +I          
Sbjct: 806  HPSICRTKTLKLKTIKSLLHHFIRKYKYSSLPLKSALEFCNDLIKSNNSISWTSNRHFLP 865

Query: 806  ----IGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEASVLYWMRINT----------- 850
                I K +++  L  ++NC N L         L  DE  +  +++IN            
Sbjct: 866  LSLLIDKLEIQYNLKLISNCLNFLFITTDFDFTLLFDELKLQAFLKINNKKLKESNSSNK 925

Query: 851  -SRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKASLNILRKILIFLSLKSSDF 909
             S +N    + +  K  +PE+IN IQ+F++FN  E+ +FK ++  ++ + I +  K  D 
Sbjct: 926  FSHKNNSDQTTELSKAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDL 985

Query: 910  EDA----YASLLKMGTK---------------VTNGKAADAFTTIIKNHKMFSDLSLDEL 950
              +      + LK+G                 +TN   +  F     N   +    L++L
Sbjct: 986  NSSQFFFQKNTLKIGINNLSEILKYYSTQKPLITNAYTSRKFYDY--NSYDYKVEFLNKL 1043

Query: 951  LEHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGTS 1010
            LE++ F E+   +L+   + +    I  WW HYG  L     Y K +P+     +    S
Sbjct: 1044 LENLIFFEKLVCKLYYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPNRKIDINNNFES 1103

Query: 1011 SHIPLGGFIETKR-EQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKAC 1069
             +      +        E+ + + IK +S +L+   ++I   HENLA EL+N+M F+   
Sbjct: 1104 FNTMFDKRVNFDSITHFERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKF 1163

Query: 1070 LDQRTIVAFAIKNISVLQECI 1090
            + +  I    I+ I +L++ I
Sbjct: 1164 IREYIIKFSTIEVIKILKDNI 1184

>KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20
            YML002W
          Length = 942

 Score =  335 bits (859), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 280/849 (32%), Positives = 432/849 (50%), Gaps = 112/849 (13%)

Query: 260  FELNLYEDIWSRLTIHFKGYEVNTE---NCEYFSVNQL-LTDYYSKDFESFKLSDITFIE 315
            FE  LY  IW++L +H      N +    C Y S ++L + DYYS  F  F L D+ FIE
Sbjct: 178  FEARLYSSIWNKL-VHQTSEPQNIDKFYGC-YISFHELNINDYYSLPFNKFSLRDVVFIE 235

Query: 316  RRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTTDMGSHKPDLSNGFNNLTMDADTL 375
              V +A K F KL  S S+ EK  IL+ T   L+      S  P L        +DAD L
Sbjct: 236  NVVDLACKEFVKLRESLSFDEKIDILLSTFNILT------SKLPQLE-------IDADNL 282

Query: 376  ISLFVLVVCRSEQKHIRSHLYYLQNFXXXXXXXKFGILGYAISTLEAVVCYFEXXXXXXX 435
            ++  ++++ R +  ++  H +YLQNF        FGIL YAISTL AV+ Y +       
Sbjct: 283  LNFMLIIINRVKLNNLNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYYIDNN----- 336

Query: 436  XXXXXXLLCIKTRDLLDKLSCENPTNEVNDLATYKDILAYRNEQGQSILSLCITNNKNDI 495
                           LDK   +  T+ + D    ++ L YRNE G+S L  CI    ND 
Sbjct: 337  ---------------LDKF--KRYTDAIQDSKISEEKLKYRNENGESYLCHCIITKDNDT 379

Query: 496  LLDVL--SEYEALFPIEDILEDETIDGSTLLIESIKVGNLEATKILIRIMLFNCTDEELV 553
            L ++L  SEY   FP+EDIL+D+TIDGSTLL+ ++K  N  A  ILI I++ N T +E+ 
Sbjct: 380  LRELLFSSEYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASILINIIINNGTPDEIR 439

Query: 554  TYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNS-SGQTPLFSIFRSYDQP--NYE 610
            TYVN  D+  R+V H++T++  +L  IG Y+NW  K+  +GQTPLF+IFRSYDQ   +Y+
Sbjct: 440  TYVNSVDENNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYK 499

Query: 611  EMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDVSILLQLTKLNINGENYKG 670
            +M + +F  A       +  F    H DN  N+LLH+LKT++ ++L    L IN  N  G
Sbjct: 500  KMSRRSFRFAMD-----SGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPNSLG 554

Query: 671  LTPLMVYVKYKRLSNIDAIT----KDHRLILEKVQ-NSTFFTCFDYAKDRLVLSKIGERG 725
            +TPLMV+ KY+RL NI  +     KD   I E  Q ++ +  CF    D  +L+ +G+  
Sbjct: 555  MTPLMVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFA 614

Query: 726  -ANDSIFGLIYLHSLRY------HNLNATVNVTSVSKTEEPFVTAVINMKTIQGLLRSIV 778
              N SIFG  + HSL+       H      +V    K E+ + T   N+KTI+ L+  ++
Sbjct: 615  IKNYSIFGNCFTHSLKQFLHKSKHGNKNQYSVKITLKFEKKYKTIRFNIKTIKALINMVL 674

Query: 779  KDNPF--TFLP---IDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQ 833
              N    +FLP   + N ++GI+ +  +   I+        ++ L    + +LFL+ VP+
Sbjct: 675  TSNSHVSSFLPLYKVFNELNGIASMISTKSKIL-------FINNLNVILDTILFLELVPR 727

Query: 834  NLFTDEASVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKASLN 893
              F  EA +  ++R    R+ +   +K   K ++ E+INMI +FL+FN +E+ +FK  + 
Sbjct: 728  EGFILEARLKDYLR--NQRKIKTVATK--SKKLQIEDINMISNFLKFNLNELNAFKNGVK 783

Query: 894  ILRKILIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHKMFSDLSLDELLEH 953
             + + +  ++LK  D   +Y  LL     V +            N+ ++ +L+ + L+ +
Sbjct: 784  KILRQMNSINLKLFDQRISYMDLLHCPDVVVH-----------LNNPLW-NLNYNILISN 831

Query: 954  VQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGTSSHI 1013
             Q LE       + ++    ++I  WWK   E + L K               A  S   
Sbjct: 832  FQILENSIDNTLHFLKVFQNEKIRKWWKLNNELINLTK--------------LASNSDDD 877

Query: 1014 PLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACLDQR 1073
             L  F   K     ++LS++I    + + EL  +IF +HE LA E++N+M+F K     R
Sbjct: 878  LLRSFFNRK-----EKLSIEIDDKIRSINELNCDIFVSHELLAVEINNFMKF-KPLFITR 931

Query: 1074 TIVAFAIKN 1082
            T+V +A +N
Sbjct: 932  TLVVWAHRN 940

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {ON}
           Anc_2.15 YNL227C
          Length = 626

 Score = 35.8 bits (81), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 7/77 (9%)

Query: 545 FNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNSSGQTPL------- 597
           +N T +  V++V K DK  ++ A    +E  + K      N K++ +SG TP        
Sbjct: 243 YNKTVKRFVSFVKKLDKRMKAGAQRQENERKMQKEAAKNGNDKKQRASGHTPSNTQTDFE 302

Query: 598 FSIFRSYDQPNYEEMVK 614
           +  ++  D+PN++E+ K
Sbjct: 303 WQSWQMADEPNWDELEK 319

>Ecym_3251 Chr3 (476367..479696) [3330 bp, 1109 aa] {ON} similar to
            Ashbya gossypii AER073C
          Length = 1109

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 41/61 (67%), Gaps = 5/61 (8%)

Query: 504  EALFPIEDILEDETIDGSTLLIESIK--VGNLEATKI--LIRIML-FNCTDEELVTYVNK 558
            +A+ PIE++  + + D S++  E  +  +  L+ATK+  L+R++L +NCT +E + YVN+
Sbjct: 1011 DAVLPIEEMQNEYSTDLSSVYSEKKQQTIRMLQATKMRKLLRLILTYNCTVKEFLDYVNR 1070

Query: 559  T 559
            +
Sbjct: 1071 S 1071

>KNAG0C05780 Chr3 (1124591..1125133) [543 bp, 180 aa] {ON} Anc_2.536
           YMR073C
          Length = 180

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 46/104 (44%), Gaps = 22/104 (21%)

Query: 85  INTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLRRRLKILDTKILPNFNDY------- 137
           ++T ++D  ++ L+  TV+    N V H +  + +R  L  +++KIL N  DY       
Sbjct: 63  LDTLVQDSEFQRLNAGTVM----NQVAHRIPTYKIRP-LMAINSKILKNHQDYLSKHDFW 117

Query: 138 --FKGAEYFAILYID-QPLGCEFV-------PNDYLHCFNSYEE 171
             +KG  Y    Y+D  P G E +       P D    F+ Y  
Sbjct: 118 AVYKGKVYCLSYYLDFHPGGIEIIIDHATRDPPDIRGAFDRYHR 161

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
           Ashbya gossypii AFR007W
          Length = 851

 Score = 33.5 bits (75), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 38/67 (56%), Gaps = 7/67 (10%)

Query: 108 NNVIHTLNGFPLRRRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFN 167
           N++  +   FPL+++ K+   K  P+F DYFKG+   + L +++  G   VP  + + F 
Sbjct: 342 NDITRSPLHFPLQQQSKL---KRTPSFKDYFKGSN--STLTLNERPGS--VPPQFQNGFA 394

Query: 168 SYEETSK 174
           +Y ET K
Sbjct: 395 NYPETPK 401

>SAKL0G09988g Chr7 complement(847730..848386) [657 bp, 218 aa] {ON}
           similar to uniprot|Q06630 Saccharomyces cerevisiae
           YDR296W MHR1 Protein involved in homologous
           recombination in mitochondria and in transcription
           regulation in nucleus binds to activation domains of
           acidic activators required for recombination-dependent
           mtDNA partitioning
          Length = 218

 Score = 32.0 bits (71), Expect = 7.3,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 21/42 (50%)

Query: 585 NWKQKNSSGQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQR 626
           NW+ K  S +  ++      D P+YEE VKV  N+    Y R
Sbjct: 59  NWENKKPSTRRDIWRCMAVVDLPSYEESVKVYLNLCRLRYLR 100

>KNAG0G03330 Chr7 (717383..720769) [3387 bp, 1128 aa] {ON} Anc_8.824
            YML104C
          Length = 1128

 Score = 32.7 bits (73), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 11/61 (18%)

Query: 974  DRIPNWW--KHYGEFLTLHKNYRKAFPSAVK---------PKSTAGTSSHIPLGGFIETK 1022
            D++ +W   + Y +F  LHK+ +  +PSA+K          KS+   +   P   FIE++
Sbjct: 814  DQVSSWEVPRRYSDFYELHKHLKAKYPSAMKEIKHIASFPSKSSVSWTLKSPQASFIESR 873

Query: 1023 R 1023
            +
Sbjct: 874  Q 874

>TDEL0A06780 Chr1 complement(1182697..1183299) [603 bp, 200 aa] {ON}
           Anc_6.265 YPL239W
          Length = 200

 Score = 31.6 bits (70), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 521 STLLIESIKVGNLEATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHY--LTHEMDILK 578
           ST L  +   G+ +  K L+ ++  N T EEL  YVNK ++   +  H+  L  ++D++K
Sbjct: 51  STALHMACANGHTDVVKYLLTLVKENATSEELKDYVNKQNETGNTALHWASLNGKLDVVK 110

Query: 579 SI-GSY 583
            + G Y
Sbjct: 111 LMCGEY 116

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 118,541,330
Number of extensions: 5502352
Number of successful extensions: 17992
Number of sequences better than 10.0: 52
Number of HSP's gapped: 18340
Number of HSP's successfully gapped: 56
Length of query: 1090
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 970
Effective length of database: 39,721,479
Effective search space: 38529834630
Effective search space used: 38529834630
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)