Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_13.1565.526ON77277229890.0
Skud_13.1485.526ON77978321710.0
Smik_13.1455.526ON77478121500.0
YML006C (GIS4)5.526ON77478421340.0
NCAS0H025505.526ON7433346092e-67
NDAI0C010705.526ON7571585714e-62
TDEL0A039005.526ON6711375164e-55
CAGL0K07271g5.526ON7761445037e-53
KNAG0B037105.526ON7111334953e-52
KLTH0G03740g5.526ON6311364553e-47
SAKL0G04906g5.526ON6081334509e-47
Kwal_47.186465.526ON6351324361e-44
ZYRO0D12540g5.526ON5481424232e-43
KAFR0C053905.526ON4551334058e-42
TBLA0D016605.526ON8661403941e-38
KLLA0A01782g5.526ON5281343762e-37
Kpol_1023.995.526ON5511802342e-19
NCAS0F010805.526ON3791212016e-16
Ecym_40615.526ON6631092012e-15
NDAI0H015905.526ON3711181794e-13
ADR198C5.526ON5491041638e-11
TPHA0K005405.526ON675781611e-10
KNAG0C032405.526ON324571037e-04
TBLA0G009405.526ON782129940.014
Kpol_1056.112.560ON50047743.2
SAKL0E00616gsingletonON60233708.3
KLTH0F16698g5.405ON67633708.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_13.156
         (772 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {...  1155   0.0  
Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {...   840   0.0  
Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {...   832   0.0  
YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON} ...   826   0.0  
NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.5...   239   2e-67
NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {O...   224   4e-62
TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.5...   203   4e-55
CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa] ...   198   7e-53
KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {O...   195   3e-52
KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} simila...   179   3e-47
SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some s...   177   9e-47
Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {...   172   1e-44
ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some...   167   2e-43
KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON} Anc_5...   160   8e-42
TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {O...   156   1e-38
KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {...   149   2e-37
Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa] ...    95   2e-19
NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.5...    82   6e-16
Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar t...    82   2e-15
NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON}               74   4e-13
ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}...    67   8e-11
TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {...    67   1e-10
KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}      44   7e-04
TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {O...    41   0.014
Kpol_1056.11 s1056 (27423..28925) [1503 bp, 500 aa] {ON} (27423....    33   3.2  
SAKL0E00616g Chr5 complement(37586..39394) [1809 bp, 602 aa] {ON...    32   8.3  
KLTH0F16698g Chr6 (1354232..1356262) [2031 bp, 676 aa] {ON} weak...    32   8.9  

>Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {ON}
           YML006C (REAL)
          Length = 772

 Score = 1155 bits (2989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/772 (76%), Positives = 591/772 (76%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSI 60
           MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSI
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSI 60

Query: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDY 120
           RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDY
Sbjct: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDY 120

Query: 121 LNNFQDPSFLEFASTSWQVQKNPKSLXXXXXRHLIHASTASSSKPSNAQLKPNTLDDQLL 180
           LNNFQDPSFLEFASTSWQVQKNPKSL     RHLIHASTASSSKPSNAQLKPNTLDDQLL
Sbjct: 121 LNNFQDPSFLEFASTSWQVQKNPKSLNNNNNRHLIHASTASSSKPSNAQLKPNTLDDQLL 180

Query: 181 DIXXXXXXXXXXXXXXXXXXXXXXADPSLTQPECNNKGXXXXXXXXXXXXXXXXXXXXXX 240
           DI                      ADPSLTQPECNNKG                      
Sbjct: 181 DINTQTSMTARTNTNTKTLTYTDTADPSLTQPECNNKGDNDMPQNNENENEEEDAGDDAA 240

Query: 241 SSIVLNFSHPRTLASKANRAPKIFPSYTNEDYNPSHSEIVSIDSFAGEDVSSTYPGQDLS 300
           SSIVLNFSHPRTLASKANRAPKIFPSYTNEDYNPSHSEIVSIDSFAGEDVSSTYPGQDLS
Sbjct: 241 SSIVLNFSHPRTLASKANRAPKIFPSYTNEDYNPSHSEIVSIDSFAGEDVSSTYPGQDLS 300

Query: 301 LTTAXXXXXXXXXXSSNGFDDXXXXXXXXXXXXXXXXXXXXXXXXXXIVRYHFNSSSRGS 360
           LTTA          SSNGFDD                          IVRYHFNSSSRGS
Sbjct: 301 LTTARREDKDDEDRSSNGFDDESFEETSSSIESSVNYTNCSSSSNSSIVRYHFNSSSRGS 360

Query: 361 LGRGDVDHTNATYVSELSSITSSIENVTNSTTPEEEDHLVRNNYDTRXXXXXXXXXXXXX 420
           LGRGDVDHTNATYVSELSSITSSIENVTNSTTPEEEDHLVRNNYDTR             
Sbjct: 361 LGRGDVDHTNATYVSELSSITSSIENVTNSTTPEEEDHLVRNNYDTREYISGEEDEEEVD 420

Query: 421 XXXXXXXXXXXXXXXXXXXXXXXXLGYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVAS 480
                                   LGYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVAS
Sbjct: 421 DEEDISSSDYSILSILPSISICDSLGYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVAS 480

Query: 481 VTDDWLLYDSNFSMXXXXXXXXXXXXXXKRSFPKILLYTMVIVTNSGQQQIEEENTNLNQ 540
           VTDDWLLYDSNFSM              KRSFPKILLYTMVIVTNSGQQQIEEENTNLNQ
Sbjct: 481 VTDDWLLYDSNFSMNNLQILTLQDLLDIKRSFPKILLYTMVIVTNSGQQQIEEENTNLNQ 540

Query: 541 QHREVDLTEEKPPNSELSLSNDPQRYFPSTFXXXXXXXXXXXXXXXXASLSEQSGPQMYL 600
           QHREVDLTEEKPPNSELSLSNDPQRYFPSTF                ASLSEQSGPQMYL
Sbjct: 541 QHREVDLTEEKPPNSELSLSNDPQRYFPSTFDDDYDEYIDDDDGGDDASLSEQSGPQMYL 600

Query: 601 PTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSSSNESDNLKECGDRISPVEPYP 660
           PTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSSSNESDNLKECGDRISPVEPYP
Sbjct: 601 PTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSSSNESDNLKECGDRISPVEPYP 660

Query: 661 MTQLSNSNTVTSNFSHLLKNKNSYKRTXXXXXXXXXXXXXXXIKTSINAMSAVERXXXXX 720
           MTQLSNSNTVTSNFSHLLKNKNSYKRT               IKTSINAMSAVER     
Sbjct: 661 MTQLSNSNTVTSNFSHLLKNKNSYKRTSKGNNESNSKNELKKIKTSINAMSAVERSKSLP 720

Query: 721 XXXXXXXXXGMDNHTDSNNKDRKRWKFKMTRFRNNKNNGSTDIDKSQRCAIM 772
                    GMDNHTDSNNKDRKRWKFKMTRFRNNKNNGSTDIDKSQRCAIM
Sbjct: 721 LPTLLKSLSGMDNHTDSNNKDRKRWKFKMTRFRNNKNNGSTDIDKSQRCAIM 772

>Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {ON}
           YML006C (REAL)
          Length = 779

 Score =  840 bits (2171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/783 (62%), Positives = 525/783 (67%), Gaps = 15/783 (1%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSI 60
           MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGD NTS 
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSA 60

Query: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDY 120
           RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTD 
Sbjct: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120

Query: 121 LNNFQDPSFLEFASTSWQVQKNPKSLXXXXXRHLIHASTASSSKPSNAQLKPNTLDDQLL 180
           LNNFQDP+FLEFASTSWQVQKN K+L     R+L+H ST SSSK S  QLKPNTLDDQ  
Sbjct: 121 LNNFQDPTFLEFASTSWQVQKNSKTL-NNNNRYLMHGSTISSSKTSTGQLKPNTLDDQWS 179

Query: 181 DIXXXXXXXXXXXXXXXXXXXXXXADPSLTQPECNNKGXXXXXXXXXXXXXXXXXXXXXX 240
           +I                      AD SLT P   +                        
Sbjct: 180 NINTQTSTATRTNTNTRTLTSPDTADLSLT-PTNGDNNNNDVLQSNENENAEEDAGEDAT 238

Query: 241 SSIVLNFSHPRTLASKANRAPKIFPSYTNEDYNPSHSEIVSIDSFAGEDVSSTYPGQDLS 300
           SSIVLNFSH RTLASKANR PKI PSYTNEDY PSHSEIVSIDSF GED SSTYPGQDLS
Sbjct: 239 SSIVLNFSHSRTLASKANRLPKILPSYTNEDYTPSHSEIVSIDSFTGEDASSTYPGQDLS 298

Query: 301 LTTAXXXXXXXX----------XXSSNGFDDXXXXXXXXXXXXXXXXXXXXXXXXXXIVR 350
           LTTA                    +S+GF D                           VR
Sbjct: 299 LTTARREDANDENDENESEDHYNRNSDGFHDEGNEQVSLGIESCVSYSSCSSSSIGSSVR 358

Query: 351 YHFNSSSRGSLGRGDVDHTNATYVSELSSITSSIENVTNSTTPEEEDHLVRNNYDTRXXX 410
           Y  + + R SL  G+VDHTNATYVSELSSITSSI+N+T STTPEEE++LV+NNYD R   
Sbjct: 359 YSLSGNRRDSLRNGNVDHTNATYVSELSSITSSIDNLTTSTTPEEEENLVQNNYDAREYI 418

Query: 411 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGYFRLVLQSILIQNPDTKEIFTAIR 470
                                             LGYFRLVLQSILIQ+PDTKEIFTAIR
Sbjct: 419 SGEEDGEGADEDEDISSSDYSVLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIR 478

Query: 471 QSNNEPTVASVTDDWLLYDSNFSMXXXXXXXXXXXXXXKRSFPKILLYTMVIVTNSGQQQ 530
           QSNN+PT+ASVTDDWLLYDSNFSM              KRSFPKIL YTMVIVT+SG QQ
Sbjct: 479 QSNNKPTMASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRSFPKILFYTMVIVTDSGHQQ 538

Query: 531 IEEENTNLNQQHR-EVDLTEEKPPNSELSLSNDPQRYFPSTFXXXXXXXXXXXXXXXXAS 589
           IEEE+   +  HR  VD ++E+P NSELSLS+DPQ+YFP+ +                AS
Sbjct: 539 IEEEHK--SSSHRGTVDTSKEEPLNSELSLSHDPQQYFPTAYNIDYDEYTDDEDEGDDAS 596

Query: 590 LSEQSGPQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSSSNESDNLKEC 649
           LSEQSGPQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKS SNE DN KE 
Sbjct: 597 LSEQSGPQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSDSNELDNSKEG 656

Query: 650 GDRISPVEPYPMTQLSNSNTVTSNFSHLLKNKNSYKRTXXXXXXXXXXXXXXXIKTSINA 709
            +R S  EPYPM QLSNS+T TSNF+HLLK KNSYK                 IKTSINA
Sbjct: 657 VNRNSLGEPYPMAQLSNSSTTTSNFNHLLKKKNSYKLGSRDKNGSNSKNELKKIKTSINA 716

Query: 710 MSAVERXXXXXXXXXXXXXXGMDNHTDSNNKDRKRWKFKMTRFRNNKNNGSTDIDKSQRC 769
           MSAVER              G+DNHT   NKDRKRWKF+M RFRNNKNN ST+ DKS RC
Sbjct: 717 MSAVERSKSLPLPTLLKSLSGIDNHTHGANKDRKRWKFQMNRFRNNKNNNSTNTDKSPRC 776

Query: 770 AIM 772
           AIM
Sbjct: 777 AIM 779

>Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {ON}
           YML006C (REAL)
          Length = 774

 Score =  832 bits (2150), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/781 (59%), Positives = 509/781 (65%), Gaps = 16/781 (2%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSI 60
           MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDN+ S+
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISV 60

Query: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDY 120
           R NKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTD 
Sbjct: 61  RSNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120

Query: 121 LNNFQDPSFLEFASTSWQVQKNPKSLXXXXXRHLIHASTASSSKPSNAQLKPNTLDDQLL 180
           LNNFQDP+FLEFASTSWQVQKN K+L     R LIH  T SSSK SN QLK +T D+Q  
Sbjct: 121 LNNFQDPTFLEFASTSWQVQKNSKALNNNN-RSLIHPPTISSSKTSNGQLKSSTSDEQWS 179

Query: 181 DIXXXXXXXXXXXXXXXXXXXXXXADPSLTQP--ECNNKGXXXXXXXXXXXXXXXXXXXX 238
           +I                      AD  LT    + NN                      
Sbjct: 180 NINTQTPTGTRTNTNTRTITSPNTADICLTSANRQSNNYAVPQDSENRNDGEDAADDTT- 238

Query: 239 XXSSIVLNFSHPRTLASKANRAPKIFPSYTNEDYNPSHSEIVSIDSFAGEDVSSTYPGQD 298
             SSIVLNFSH R L  K +R PKIFP YTNE+Y PSHSEIVSIDSFAGEDVSSTYPGQD
Sbjct: 239 --SSIVLNFSHSRALEPKTSRLPKIFPPYTNEEYTPSHSEIVSIDSFAGEDVSSTYPGQD 296

Query: 299 LSLTTAXXXXXXXX-------XXSSNGFDDXXXXXXXXXXXXXXXXXXXXXXXXXXIVRY 351
           LSLTTA                 +SN  +D                          I   
Sbjct: 297 LSLTTARCEDDNDQDDVEGHYNRTSNDLNDKSTNQIRLNMESSVSCTSCSSSSSSSIRYS 356

Query: 352 HFNSSSRGSLGRGDVDHTNATYVSELSSITSSIENVTNSTTPEEEDHLVRNNYDTRXXXX 411
             +S+SR SL R   DHTNATYVSELSSITSSI+N+T STTPEEEDHL+ +NYD +    
Sbjct: 357 L-SSTSRASLKRESADHTNATYVSELSSITSSIDNLTTSTTPEEEDHLIHHNYDAQGYAS 415

Query: 412 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGYFRLVLQSILIQNPDTKEIFTAIRQ 471
                                            LGYFRLVLQSILIQ+PDTKEIFTAIRQ
Sbjct: 416 REDEVEEVDDDADLSSSDYSVLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQ 475

Query: 472 SNNEPTVASVTDDWLLYDSNFSMXXXXXXXXXXXXXXKRSFPKILLYTMVIVTNSGQQQI 531
           SNN PT+ASVTDDWLLYDSNFSM              KRSFPKIL YTMVIVT SGQQ I
Sbjct: 476 SNNRPTIASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRSFPKILFYTMVIVTESGQQ-I 534

Query: 532 EEENTNLNQQHREVDLTEEKPPNSELSLSNDPQRYFPSTFXXXXXXXXXXXXXXXXASLS 591
           EEE  N N   RE D+ +E+P NS+L LS+DP++YFP+ +                ASLS
Sbjct: 535 EEEPKNPNYGTRE-DMLKEQPLNSDLLLSHDPKQYFPNAYNNDYDEYIDDEDDDDDASLS 593

Query: 592 EQSGPQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSSSNESDNLKECGD 651
           EQSGPQMY+PTRM SNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKS+SNESD+ +   D
Sbjct: 594 EQSGPQMYIPTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSNSNESDDSENNDD 653

Query: 652 RISPVEPYPMTQLSNSNTVTSNFSHLLKNKNSYKRTXXXXXXXXXXXXXXXIKTSINAMS 711
           R+S  EPYPMTQ+SN NT +SNFSH LK KN+ K                 IK SINAMS
Sbjct: 654 RLSSDEPYPMTQISNFNTSSSNFSHSLKKKNTSKVNSKINNESNSKSELKKIKNSINAMS 713

Query: 712 AVERXXXXXXXXXXXXXXGMDNHTDSNNKDRKRWKFKMTRFRNNKNNGSTDIDKSQRCAI 771
           AVER               +DN+T   NKDRKRWKF+M RFRN+KN+GS  +DKSQRC +
Sbjct: 714 AVERSKSLPLPTLLKSLSSIDNNTHGTNKDRKRWKFQMNRFRNHKNSGSASMDKSQRCVM 773

Query: 772 M 772
           M
Sbjct: 774 M 774

>YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON}
           GIS4CAAX box containing protein of unknown function,
           proposed to be involved in the RAS/cAMP signaling
           pathway
          Length = 774

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/784 (59%), Positives = 514/784 (65%), Gaps = 22/784 (2%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSI 60
           MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNN S 
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNISA 60

Query: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDY 120
           RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTD 
Sbjct: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120

Query: 121 LNNFQDPSFLEFASTSWQVQKNPKSLXXXXXRHLIHASTASSSKPSNAQLKPNTLDDQLL 180
           LNNFQDP+FLEFASTSWQVQKN K+L     R+ I   T SSSK SN +L+ N  DDQ  
Sbjct: 121 LNNFQDPTFLEFASTSWQVQKNSKALNNNN-RNSIPPPTISSSKASNGKLESNVSDDQWS 179

Query: 181 DIXXXXXXXXXXXXXXXXXXXXXXADPSLTQ--PECNNKGXXXXXXXXXXXXXXXXXXXX 238
           +I                       D ++T    + NN                      
Sbjct: 180 NINTQTSTATRTNTNTRTLTSPDTVDINVTSVNSQSNNNDTPQDNENEVDEEDAT----- 234

Query: 239 XXSSIVLNFSHPRTLASKANRAPKIFPSYTNEDYNPSHSEIVSIDSFAGEDVSSTYPGQD 298
             SSIVLNFSH RT+ SK NR PKIFPSYTNEDY PSHSEI+SIDSFAGEDVSSTYPGQD
Sbjct: 235 --SSIVLNFSHSRTVDSKPNRLPKIFPSYTNEDYTPSHSEIMSIDSFAGEDVSSTYPGQD 292

Query: 299 LSLTTAXXXXXXXX-------XXSSNGFDDXXXXXXXXXXXXXXXXXXXXXXXXXXIVRY 351
           LSLTTA                  S+   D                             Y
Sbjct: 293 LSLTTARREDESGQDEVEDHYSRVSHDLGDESIDQASYSMESSVSYTSYSSSSNSSSAHY 352

Query: 352 HFNSSSRGSLGRGDVDHTNATYVSELSSITSSIENVTNSTTPEEEDHLVRNNYDTRXXXX 411
             +SSSRG+  R ++DHTNATYVSELSSITSSI+N+T STTPEEED+L+ +NYD +    
Sbjct: 353 SLSSSSRGNPKRENIDHTNATYVSELSSITSSIDNLTTSTTPEEEDNLIHHNYDAQGYGS 412

Query: 412 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGYFRLVLQSILIQNPDTKEIFTAIRQ 471
                                            LGYFRLVLQSILIQ+PDTKEIFTAIRQ
Sbjct: 413 GEDDGEEVYDDEDLSSSDYSVLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQ 472

Query: 472 SNNEPTVASVTDDWLLYDSNFSMXXXXXXXXXXXXXXKRSFPKILLYTMVIVTNSGQQQI 531
           SNN+PT+ASVTDDWLLYDSNFSM              KRSFPKIL YTMVIVTNSG+Q +
Sbjct: 473 SNNKPTMASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRSFPKILFYTMVIVTNSGKQ-V 531

Query: 532 EEENTNLNQQHREVDLTEEKPPNSELSLSNDPQRYFPSTFXXXXX---XXXXXXXXXXXA 588
           EEE  N N  +RE  +++E+P +SELSL+NDPQ+YFP+ +                   A
Sbjct: 532 EEEFKNPNYDNRE-GISKEQPLDSELSLTNDPQQYFPTAYNNGYNDYIDDEDDEDDGDDA 590

Query: 589 SLSEQSGPQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSSSNESDNLKE 648
           SLSEQSGPQMY+PTRM SNVTTAHRSIRTVNSIGEWAFNRHNSVTKI+KS+SNE DN K 
Sbjct: 591 SLSEQSGPQMYIPTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKIDKSNSNELDNSKT 650

Query: 649 CGDRISPVEPYPMTQLSNSNTVTSNFSHLLKNKNSYKRTXXXXXXXXXXXXXXXIKTSIN 708
               +   EP+PMTQLSNSNT +SNFSH LK KNS+K                 IK+SIN
Sbjct: 651 GESTVLSSEPHPMTQLSNSNTTSSNFSHSLKTKNSHKPNSKGNNESNSKNELKKIKSSIN 710

Query: 709 AMSAVERXXXXXXXXXXXXXXGMDNHTDSNNKDRKRWKFKMTRFRNNKNNGSTDIDKSQR 768
           AMSAVER              G+DN T + NKDRKRWKF+M RF+N+KN+GS   DKSQR
Sbjct: 711 AMSAVERSKSLPLPTLLKSLSGIDNPTHATNKDRKRWKFQMNRFKNHKNSGSAGTDKSQR 770

Query: 769 CAIM 772
           CAIM
Sbjct: 771 CAIM 774

>NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.526
           YML006C
          Length = 743

 Score =  239 bits (609), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 151/334 (45%), Positives = 178/334 (53%), Gaps = 74/334 (22%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTS- 59
           MQKSVRV DYFDNDDNGLWSWYLTN+RLGDFEE+ GNQLKYTLLKRFLNSHFY +++ + 
Sbjct: 1   MQKSVRVTDYFDNDDNGLWSWYLTNIRLGDFEEVTGNQLKYTLLKRFLNSHFYSNSDVTA 60

Query: 60  --------------------IRPN-KKILLVSIPENVHEDISILEIFLKDYFHLEKLEHI 98
                               ++PN +KILLVSIP+ VH D+SILE FL+DYFHLE LE I
Sbjct: 61  TESPQQHNNNNNTNNNNTQQLKPNFRKILLVSIPDKVHRDLSILETFLRDYFHLEHLEGI 120

Query: 99  QISKLTHSHCYNHENHYLLTDYLNNFQDPSFLEFASTSWQVQKNPKSLXXXXXRHLIHAS 158
           QI +LT S CYNHENHYLLTD +NNF DP FLEFA ++WQ +KN          HL H  
Sbjct: 121 QIQRLTQSKCYNHENHYLLTDTINNFDDPVFLEFAGSNWQARKN-----LHLNNHLDHRD 175

Query: 159 TASSSKPS-NAQLKPNTLDDQLLDIXXXXXXXXXXXXXXXXXXXXXXADPSLTQPECNNK 217
               S  S +     N  DDQ+L                         D +L  PE   K
Sbjct: 176 DDRISPQSIDTHSALNKNDDQIL--------------------VTQPIDSTLVTPETREK 215

Query: 218 GXXXXXXXXXXXXXXXXXXXXXXSSIVLNFSH---------PRTLASKANRAPKIFPSYT 268
                                  SSIVLNFSH         P  +  +  ++ K  P   
Sbjct: 216 -------------ENLDDIDVGGSSIVLNFSHTREHRKDKDPLNMVKQEEQSNKFSP--- 259

Query: 269 NEDYNPSHSEIVSIDSFAGEDVSSTYPGQDLSLT 302
           N  + P  SE+VSI+SF   D S  Y G  L LT
Sbjct: 260 NMMFTPPQSELVSINSFDDGD-SMNYNGHPLKLT 292

 Score =  179 bits (454), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 131/343 (38%), Positives = 167/343 (48%), Gaps = 49/343 (14%)

Query: 446 GYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMXXXXXXXXXXX 505
           G+FRLVLQSILIQ+P TKEI+TAIRQSNNEPT+A + DDWLLYDS FSM           
Sbjct: 434 GHFRLVLQSILIQHPVTKEIYTAIRQSNNEPTIADIMDDWLLYDSQFSMDNLQILTLQDL 493

Query: 506 XXXKRSFPKILLYTMVIVTNSGQQQIEEENTN---------LNQQHREV--DLTEEKPPN 554
               RSFPKIL Y+MVIVT++  Q I+   +          L+ +   +  D T ++  N
Sbjct: 494 LDTNRSFPKILFYSMVIVTDAHHQPIQGPTSTAGPDLTTSYLSNKLESIAGDETNQRFEN 553

Query: 555 SELSLSND-----PQRYFPSTFXXXXXXXXXXXXXXXXASLSEQSGPQMYLPTRMASNVT 609
               +++D     PQ++FP                    SL E++GP+MYLPTRM +N T
Sbjct: 554 RYYPMADDQVEDQPQQFFPQ-----EDDHDDDNMYDTDDSLMEEAGPEMYLPTRMETNNT 608

Query: 610 TAHRSIRTVNSIGEWAFNRHNSVTKINKSSSNESDNLKECGDRISPVEPYPMTQLSNSNT 669
           TAHRSIRTVNSIGEWAFNR+N+    N SSS  +      G      +    T   N   
Sbjct: 609 TAHRSIRTVNSIGEWAFNRNNT----NGSSSKSA-----IGREDEDGDEEEETNHHNDGQ 659

Query: 670 VTSNFSHLLKNKNSYKRTXXXXXXXXXXXXXXXIKTSINAMSAVERXXXXXXXXXXXXXX 729
              N  H   NK + K+                   +I AM AVER              
Sbjct: 660 THDNNHH--HNKKTGKKGSYGGAKNKRSG-------NIEAMKAVERTKSTPLPTLLKSIS 710

Query: 730 GMDNHTDSNNKDRKRWKFKMTRFRNNKNNGSTDIDKSQRCAIM 772
           G          D+KRWK ++   +  K N S+  D S  C IM
Sbjct: 711 G-------TGTDKKRWKDRLKEMK--KKNKSSQEDHS-LCNIM 743

>NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {ON}
           Anc_5.526 YML006C
          Length = 757

 Score =  224 bits (571), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 109/158 (68%), Positives = 124/158 (78%), Gaps = 16/158 (10%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYG------ 54
           MQ SVRV DY++NDDNGLWSWYL N+RLGDFEEL GNQLKYTLLKRFLNSHFY       
Sbjct: 1   MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSNATTTD 60

Query: 55  ----DNNTS-----IRPN-KKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLT 104
               DNN +     I+P  KKILLVSIP+ VH DIS+LE+FL+DYFHLE LE+IQI+KLT
Sbjct: 61  TAIDDNNNTNSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLT 120

Query: 105 HSHCYNHENHYLLTDYLNNFQDPSFLEFASTSWQVQKN 142
            S CYNHENHYLLTD +NNF DP FLEFA ++WQ + N
Sbjct: 121 QSECYNHENHYLLTDKVNNFDDPMFLEFAGSTWQGRPN 158

 Score =  164 bits (416), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 96/214 (44%), Positives = 118/214 (55%), Gaps = 32/214 (14%)

Query: 446 GYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMXXXXXXXXXXX 505
           G+FRLVLQS LIQNP TKEIFTAIRQSNNEPT+A +TDDWLLYDS F+M           
Sbjct: 473 GHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDL 532

Query: 506 XXXKRSFPKILLYTMVIVTNSGQQQIEEENTNLN----------------------QQHR 543
               R+FPKIL Y+MVIV N     I ++  N N                      ++ +
Sbjct: 533 LDSNRTFPKILFYSMVIV-NESSPPINDDQHNYNGMTALNSEYLSNKLESLEKTSSEEGK 591

Query: 544 EVDLTEEKP--PNSELSLSND------PQRYFPS-TFXXXXXXXXXXXXXXXXASLSEQS 594
            ++  +  P  P + ++  N       P+++FP                     SL EQ 
Sbjct: 592 SINRYKYYPTLPKAGITAKNGEMIADVPEQFFPGPPSDDENGKGEDYDDDYDDESLMEQH 651

Query: 595 GPQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNR 628
           GP+MYLPTRM +NVTTAHRSIRT NSIGEWAFNR
Sbjct: 652 GPEMYLPTRMQTNVTTAHRSIRTANSIGEWAFNR 685

 Score = 38.5 bits (88), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 36/71 (50%), Gaps = 13/71 (18%)

Query: 241 SSIVLNFSHPRTLASKANRAPKIF--------PSYTNEDYNPSHSEIVSIDSFAGEDVSS 292
           SSIVLNF H R    K ++ PK          P   N+ Y P  SE+VSI+SF  +D +S
Sbjct: 251 SSIVLNFPHLR----KHSKDPKQTIINEQQEEPLANNQYYTPPQSELVSINSFGDDDTNS 306

Query: 293 -TYPGQDLSLT 302
             Y G  L L 
Sbjct: 307 MAYQGHPLHLV 317

>TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.526
           YML006C
          Length = 671

 Score =  203 bits (516), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 93/137 (67%), Positives = 110/137 (80%), Gaps = 1/137 (0%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSI 60
           MQKS++V DYFDNDDNGLWSWYL+++R GDFEE   N+LK TLL+RFLNSHF   N +  
Sbjct: 1   MQKSIKVDDYFDNDDNGLWSWYLSHIRSGDFEEFSRNKLKVTLLRRFLNSHF-DSNRSHY 59

Query: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDY 120
             N KIL VSIP+ VH D+S+LE FL+DYFHLE LEHI+I+KLT S  YNHENHY+L D 
Sbjct: 60  GQNTKILFVSIPDKVHRDLSLLENFLRDYFHLEHLEHIEITKLTQSPVYNHENHYILIDK 119

Query: 121 LNNFQDPSFLEFASTSW 137
           LNNF DP+FL+FAST W
Sbjct: 120 LNNFDDPTFLQFASTRW 136

 Score =  172 bits (437), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 89/190 (46%), Positives = 120/190 (63%), Gaps = 15/190 (7%)

Query: 446 GYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMXXXXXXXXXXX 505
           G++RLV+QS L+Q+P+TKEI+TAIRQSNN+PTVA V DDWLLYDS FSM           
Sbjct: 397 GHYRLVMQSSLLQDPETKEIYTAIRQSNNQPTVADVDDDWLLYDSQFSMNNLQMLTLQEL 456

Query: 506 XXXKRSFPKILLYTMVIVTNSGQQQIEEENTNLNQQHREVDLTEEKP-PNSELSLSNDPQ 564
               RSFPKI+ Y+M++V++  QQ++ + +  + Q+    D +   P  +S  S+S DPQ
Sbjct: 457 LDMNRSFPKIIFYSMIVVSDE-QQELLQWSNGMTQKEDTADASSSIPRADSYASMSRDPQ 515

Query: 565 RYFPSTFXXXXXXXXXXXXXXXXASLSEQSGPQMYLPTRMASNVTTAHRSIRTVNSIGEW 624
           +++ +                   SLSEQSGP MY PTR+ SN +TAHRSIRTVNSIG+W
Sbjct: 516 QFYANM-------------DDDDTSLSEQSGPMMYAPTRLQSNTSTAHRSIRTVNSIGDW 562

Query: 625 AFNRHNSVTK 634
           AF   N   +
Sbjct: 563 AFVHKNETKR 572

>CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa]
           {ON} similar to uniprot|Q04233 Saccharomyces cerevisiae
           YML006c
          Length = 776

 Score =  198 bits (503), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 116/144 (80%), Gaps = 5/144 (3%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSI 60
           M KSVRVGDY+ ND+NG+WSWYL+NLR GDFEE+I N+LKYTLLKRFLNS+  G N +  
Sbjct: 1   MSKSVRVGDYYGNDENGVWSWYLSNLRSGDFEEIIENKLKYTLLKRFLNSNLLG-NFSPE 59

Query: 61  RP----NKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYL 116
            P    NKK++ VSIPE+VH+DISILE+FL+DYFHL+ L++ QI KLT    Y+HENHY 
Sbjct: 60  SPTRFINKKLIFVSIPEDVHQDISILELFLRDYFHLKVLDNNQIHKLTQDKVYHHENHYF 119

Query: 117 LTDYLNNFQDPSFLEFASTSWQVQ 140
           L D LNNF+DP+FLEF  ++W+++
Sbjct: 120 LMDELNNFEDPTFLEFGKSNWKME 143

 Score =  138 bits (347), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 103/194 (53%), Gaps = 26/194 (13%)

Query: 445 LGYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMXXXXXXXXXX 504
           LGYFRLVLQSILIQ+P TKE+FTA+RQSNN+PT+A +TDDWLLYD+ FSM          
Sbjct: 464 LGYFRLVLQSILIQDPQTKEVFTAVRQSNNKPTIADITDDWLLYDAEFSMHNLQILTLQD 523

Query: 505 XXXXKRSFPKILLYTMVIVTN----------SGQQQIEEENTNLNQQHREVDLTEEKPPN 554
               K+ +PKIL YTMV++ +          +G Q  +  +   N+ H EV+  E   P 
Sbjct: 524 IMTIKKDYPKILFYTMVVINDRSEIACEFPYNGAQFTKAPSPITNKSH-EVEKEELDQP- 581

Query: 555 SELSLSNDPQRYFPSTFXXXXXXXXXXXXXXXXASLSEQSGPQMYLPTRMASNVTTAHRS 614
                  + Q YFP                     L +          R  SN+TT HRS
Sbjct: 582 ------TEVQAYFPGNGQAIKDSIKPNNRDSLTFDLCQAE--------RTKSNMTTTHRS 627

Query: 615 IRTVNSIGEWAFNR 628
           IRTVNSIG+W+ +R
Sbjct: 628 IRTVNSIGDWSISR 641

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 4/62 (6%)

Query: 241 SSIVLNFSHPRTLASKANRAPKIFPS-YTNEDYNPSHSEIVSIDSFAGEDVSSTYPGQDL 299
           SSIVLNFSH R    +  +   +    Y ++ Y P  SE+VSI+S      +  Y GQ L
Sbjct: 306 SSIVLNFSHNRNAHKRKTKIDSLLGERYPSDFYTPPQSELVSINSCGS---AEDYTGQSL 362

Query: 300 SL 301
            L
Sbjct: 363 RL 364

>KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {ON}
           Anc_5.526 YML006C
          Length = 711

 Score =  195 bits (495), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 106/133 (79%), Gaps = 6/133 (4%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSI 60
           MQKS+RV DY+DNDDNGLWSWYL N+R GDFEEL  N+LKYTLLKRFL +HF     TS+
Sbjct: 1   MQKSIRVNDYYDNDDNGLWSWYLQNIRSGDFEELTHNELKYTLLKRFLKNHF-----TSL 55

Query: 61  RP-NKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTD 119
              N KIL +SIP+ VH DIS+LE FLKDYFHLE L++I+I KLT S+CYNHENHYLLTD
Sbjct: 56  EGINSKILFISIPDKVHSDISVLETFLKDYFHLEDLQNIKIQKLTTSNCYNHENHYLLTD 115

Query: 120 YLNNFQDPSFLEF 132
            LNNF D  FL +
Sbjct: 116 TLNNFNDRKFLRY 128

 Score =  121 bits (303), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 75/188 (39%), Positives = 97/188 (51%), Gaps = 33/188 (17%)

Query: 446 GYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMXXXXXXXXXXX 505
           G+FRLVLQS+L+Q  D K IFTAIRQSNN+   A+V DDW+LYDS+FSM           
Sbjct: 472 GHFRLVLQSVLLQRED-KAIFTAIRQSNNKVDRATVQDDWILYDSDFSMNNLMMMTLRGL 530

Query: 506 XXXKRSFPKILLYTMVIVTNSGQQQIEEENTNLNQQHREVDLTEEKPPNSELSLSNDPQR 565
                +  KIL Y+M+IV ++                   D+ +E+  +S       PQ 
Sbjct: 531 FNFSENMSKILFYSMIIVDDAETAD---------------DMLDEEATHSGDVSDTQPQL 575

Query: 566 YFPSTFXXXXXXXXXXXXXXXXASLSEQSGPQMYLPTRMASNVTTAHRSIRTVNSIGEWA 625
            F                     S S    PQMYLP + AS+ TTAHRSIRTVNSIGEWA
Sbjct: 576 MF-----------------DEEDSDSGVQEPQMYLPQKTASHATTAHRSIRTVNSIGEWA 618

Query: 626 FNRHNSVT 633
           + + ++ T
Sbjct: 619 YKKKSNAT 626

>KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q04233 Saccharomyces cerevisiae YML006C GIS4
           CAAX box containing protein of unknown function proposed
           to be involved in the RAS/cAMP signaling pathway
          Length = 631

 Score =  179 bits (455), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 105/136 (77%), Gaps = 3/136 (2%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSI 60
           ++ SV+V DYFDND+NGLWSWYL NLR G+FEEL  NQLK+ LL+RFLN     D   S+
Sbjct: 2   LESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSD---SV 58

Query: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDY 120
             NKK+LLVSIP+ +HE+ ++LE FL+DYF+L+ L+ IQI KLT   CYNHENHYL++D 
Sbjct: 59  LFNKKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDS 118

Query: 121 LNNFQDPSFLEFASTS 136
           L+NF D SFLEF + S
Sbjct: 119 LSNFNDKSFLEFGAKS 134

 Score =  116 bits (291), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 107/225 (47%), Gaps = 32/225 (14%)

Query: 445 LGYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMXXXXXXXXXX 504
            G FRLVLQSIL+  PDT+++FTA+RQSNN+PTVA V DDWLLYD  FSM          
Sbjct: 330 FGRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHD 389

Query: 505 XXXXKRSFPKILLYTMVIVTNSGQQQIEEENTNLNQQHREVDLTEEKPPNSELSLSNDPQ 564
                + FPKIL Y++V+++       EE   +    +        +P  S  ++S +  
Sbjct: 390 VLEMNKFFPKILFYSLVMIS-------EEVAADAQDYYPSKPSKSPQPTASNSTISENTL 442

Query: 565 RYFPSTFXXXXXXXXXXXXXXXXASLS----------EQSGPQ---------------MY 599
           +  P+                  +SLS          EQ                   +Y
Sbjct: 443 KVQPTLTHSLTNTNSYLSTGAYNSSLSPFYSSVQHNHEQGEEDDYYDDDKNSEGVVVPLY 502

Query: 600 LPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSSSNESD 644
             TR  SN +TAHRSIRT+ SIG+WAF+  +S  K++ + S   D
Sbjct: 503 SATRTNSNKSTAHRSIRTIKSIGDWAFHHDSSSRKLSPNDSTLED 547

>SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 608

 Score =  177 bits (450), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 85/133 (63%), Positives = 102/133 (76%), Gaps = 3/133 (2%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSI 60
           M   V+V DYF+ND NGLWSWYL+NLR G FEEL  N LK+TLLKRFLN H   D    +
Sbjct: 1   MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQD---IV 57

Query: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDY 120
           + NKK+LLVSIP+N+H+DI+ILE FL+ YFHL+ L++IQI KLT S  YNHENHYL++D 
Sbjct: 58  QFNKKMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDN 117

Query: 121 LNNFQDPSFLEFA 133
           LNNF D SFL F 
Sbjct: 118 LNNFHDRSFLGFG 130

 Score =  136 bits (343), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 115/356 (32%), Positives = 147/356 (41%), Gaps = 84/356 (23%)

Query: 445 LGYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMXXXXXXXXXX 504
            G FRLVLQSILIQNPDT+EIFTA+RQSNN+P VA + DDWLLYD  FSM          
Sbjct: 309 FGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKFSMHNLQMLSLHD 368

Query: 505 XXXXKRSFPKILLYTMVIVTNSGQQQIEEENTNLNQQHREVDLTEEKPPNSE-----LSL 559
                R FPKIL YTMV++     ++I +E       H  +      PP S+      +L
Sbjct: 369 VLEINRFFPKILFYTMVML---DTEEIADE------AHAYIPNDPHLPPPSQGIASTSTL 419

Query: 560 SNDPQRYFPSTFXXXXXXXXXXXXXXXXASL--SEQSGPQ----------------MYLP 601
           S +  R  P+                   S   +E   P+                +Y P
Sbjct: 420 SQNTLRLLPTATSNVTYTRHNELLNAAATSAQDAENYFPEDNHDDEDDQEVNGVMPLYAP 479

Query: 602 TRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSSSNESDNLKECGDRISPVEPYPM 661
           TR  SN TTAHRSI TVNSIGEWAF+ HN                          EPYP 
Sbjct: 480 TRTNSNSTTAHRSILTVNSIGEWAFH-HN--------------------------EPYPQ 512

Query: 662 TQLSN-----SNTVTSNFSHLLKNKNSYKRTXXXXXXXXXXXXXXXIKTSINAMSAVERX 716
              SN      NT T+     + +K S K T                 T++ ++SAVER 
Sbjct: 513 NNHSNISFADQNTSTAGKMKRVSSKGSSKNTLQKT-------------TTVGSLSAVERS 559

Query: 717 XXXXXXXXXXXXXGMDNHTDSNNKDRKRWKFKMTRFRNNKNNGSTDIDKSQRCAIM 772
                        G+D+ T         WK K+ +F+  +            C +M
Sbjct: 560 KSTPLPTLLRTLSGLDDET-------MMWKRKVEKFKRKRRAKKEGKKLDNNCVVM 608

>Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {ON}
           YML006C (GIS4) - CAAX box containing protein [contig
           191] FULL
          Length = 635

 Score =  172 bits (436), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 80/132 (60%), Positives = 100/132 (75%), Gaps = 3/132 (2%)

Query: 2   QKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSIR 61
           + SV+V DYF ND+NGLWSWYL NLR G+FEEL  NQLK  LL+RFLN     +   ++ 
Sbjct: 3   ENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSE---TVP 59

Query: 62  PNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDYL 121
            NKK+LLVSIP+ +HE+ ++LE FL+DYFHL+ L++IQI KLT   CYNHENHYL+ D L
Sbjct: 60  FNKKLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNL 119

Query: 122 NNFQDPSFLEFA 133
           +NF D SFLEF 
Sbjct: 120 SNFNDKSFLEFG 131

 Score =  117 bits (293), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 109/220 (49%), Gaps = 27/220 (12%)

Query: 445 LGYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMXXXXXXXXXX 504
            G FRLVLQSILIQ  DT++++TA+RQSNN+PTVA V DDWLLYD  FSM          
Sbjct: 330 FGRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHD 389

Query: 505 XXXXKRSFPKILLYTMVIVTNSGQQQIEEENTNLNQQHRE------------VDLTEEKP 552
                + FPK+L Y++++VT+      +E   + + Q  E            + L     
Sbjct: 390 VLEINKFFPKVLFYSLIVVTDEVAIDAQEYYPSASHQSPERTVSTSLLSENTLKLQTTLT 449

Query: 553 P-----NSELSLSNDPQRYFPSTFXXXXXXXXXXXXXXXXASLSEQSGP-------QMYL 600
           P     NS LS+  +     P  F                    E+ G        Q+Y 
Sbjct: 450 PSLTNTNSFLSMGVNSSSLTP--FYATAQGSPDRANDEDDYFDDERDGKTDDGEVFQLYS 507

Query: 601 PTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSSS 640
            TR  SN +TAHRSIRT+ SIG+WAF+ H+S ++   S++
Sbjct: 508 ATRTNSNKSTAHRSIRTIKSIGDWAFH-HDSTSRRTSSAA 546

>ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 548

 Score =  167 bits (423), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 105/142 (73%), Gaps = 5/142 (3%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSI 60
           M KSVRVGDYF NDDNGLWSWYLTN+R GDFEEL  NQLK++L KRFL +  Y +   + 
Sbjct: 1   MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRT--YLEPTLNE 58

Query: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDY 120
           R + K+L+VSIPE+V  DI++LE FL DY +L+ +E   I+KLT S  YNHENHY++ D 
Sbjct: 59  RKDTKVLIVSIPEDVRRDITLLEYFLGDYLNLDNME---ITKLTTSRIYNHENHYVVMDK 115

Query: 121 LNNFQDPSFLEFASTSWQVQKN 142
            NNF++ +FL FAST+ Q  K 
Sbjct: 116 ENNFKNSNFLHFASTNIQTGKG 137

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 88/180 (48%), Gaps = 23/180 (12%)

Query: 445 LGYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMXXXXXXXXXX 504
            G+FRLVLQS+L  NP + EIFTAIRQSNN+PT A V DDWLLYDS FSM          
Sbjct: 308 FGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQFSMHNLQMLTLQD 367

Query: 505 XXXXKRSFPKILLYTMVIVTNSGQQQIEEENTNLNQQHREVDLTEEKPPNSELSLSNDPQ 564
                +  PK+L Y++V V ++    +E+ +T           +    P S  S+S +P+
Sbjct: 368 LSELNKGCPKVLFYSLVEVVDT--PSLEDADTECATISNTASTSLSSAPTS-TSVSCEPR 424

Query: 565 RYFPSTFXXXXXXXXXXXXXXXXASLSEQSGPQMYLPTRMASNVTTAHRSIRTVNSIGEW 624
            +FPS                      + SG ++      +S  T  HRSI T NS  +W
Sbjct: 425 VFFPSNVN------------------GDNSGCRLAKGNTNSS--TLGHRSIVTTNSAADW 464

>KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON}
           Anc_5.526 YML006C
          Length = 455

 Score =  160 bits (405), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 81/133 (60%), Positives = 101/133 (75%), Gaps = 5/133 (3%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSI 60
           M  SV++ DYFDND+NGLWSWYLTNLR G+FEELI N+LK +LLKRFL +    D N  I
Sbjct: 1   MPNSVQIHDYFDNDENGLWSWYLTNLRSGNFEELINNKLKDSLLKRFLRNQV--DINDQI 58

Query: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDY 120
              KKILL+SIP+++  DI++LEIFL DYFHL  L +I+I KLT  + YNHENHYLL D 
Sbjct: 59  ---KKILLISIPDHIFSDINVLEIFLSDYFHLNDLSNIKIIKLTKFNVYNHENHYLLIDS 115

Query: 121 LNNFQDPSFLEFA 133
           +NNF+D +FL + 
Sbjct: 116 VNNFKDETFLNYV 128

 Score = 60.5 bits (145), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 445 LGYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMXXXXXXXXXX 504
           +G++RLVLQS+LI N +  ++ T +RQSNN    A++ DDW+LYD  FSM          
Sbjct: 263 IGHYRLVLQSMLICNKENLDLQTGVRQSNNLINYANINDDWMLYDEKFSMRNLNILSLKD 322

Query: 505 XXXXKR-SFPKILLYTMVIVTN 525
                     KIL Y+M+ V N
Sbjct: 323 LSIIGNVDSIKILFYSMIDVNN 344

>TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {ON}
           Anc_5.526 YML006C
          Length = 866

 Score =  156 bits (394), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 100/140 (71%), Gaps = 3/140 (2%)

Query: 3   KSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSIRP 62
           K V+V DY+DND+NGLWSWYL+N+R G FEEL  N LK TLLKRFL  +F  D N++ + 
Sbjct: 7   KPVQVNDYYDNDNNGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQH 66

Query: 63  NK---KILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTD 119
           +    KIL  SIP+N+H+D+ ILE  LKDYF L+ L++IQI KLT + CYNHENHY+L D
Sbjct: 67  STNCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILKD 126

Query: 120 YLNNFQDPSFLEFASTSWQV 139
            L+NF + SF     T  ++
Sbjct: 127 ILDNFGNTSFFIHDGTKQKI 146

 Score =  112 bits (280), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 76/201 (37%), Positives = 99/201 (49%), Gaps = 17/201 (8%)

Query: 445 LGYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMXXXXXXXXXX 504
           LG+FRLVLQ ILI +P  ++ +TAIRQS++   VA + DDWLLYD  FSM          
Sbjct: 509 LGHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQE 568

Query: 505 XXXXKRSFPKILLYTMV--------IVTNSGQQQIEEENTNL-NQQHREVDLTEEKPPNS 555
                R +PKIL YT+V        I TN    +I E   NL N   +       K  N 
Sbjct: 569 LLDFNRDYPKILFYTLVAINDNSSYIRTNKNISEINELTNNLKNLNCKPSGDDRNKKDNQ 628

Query: 556 ELSLSNDPQRYFPSTFXXXXXXXXXXXXXXXXASLSEQ-------SGPQMYLPTRMASNV 608
           +++   +  R   +                   S  E+        G +MY P+++ SN 
Sbjct: 629 KINTEFNTTRIHSNHLIDHSSSEDIPRQLYTTLSSDEEYGEIEYPEGLEMYEPSKIKSNT 688

Query: 609 TT-AHRSIRTVNSIGEWAFNR 628
           TT AHRSIRTVNSIGEWAF+R
Sbjct: 689 TTIAHRSIRTVNSIGEWAFHR 709

>KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {ON}
           some similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 528

 Score =  149 bits (376), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 92/134 (68%), Gaps = 7/134 (5%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSI 60
           M  SV+V DY++ND NGLWSWYL+NLR G+FEEL GN+LK+ LLKRFL   F        
Sbjct: 1   MPTSVQVKDYYENDYNGLWSWYLSNLRNGEFEELTGNELKHGLLKRFLRDQFQATGPL-- 58

Query: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEH--IQISKLTHSHCYNHENHYLLT 118
             NKK+LLVSIP+ +H+DI +LE FL +YFHL K +H  I I KLT    Y HENHYL+ 
Sbjct: 59  --NKKLLLVSIPDEIHQDIKVLEEFLSEYFHL-KDDHTNIVIDKLTRGTVYKHENHYLIQ 115

Query: 119 DYLNNFQDPSFLEF 132
           D L NF D  FLE 
Sbjct: 116 DKLTNFNDEWFLEM 129

 Score =  102 bits (255), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 99/203 (48%), Gaps = 45/203 (22%)

Query: 445 LGYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMXXXXXXXXXX 504
            G FRLVLQSILI N +T++IFT IRQS N+ + A + DDWLLYD++F++          
Sbjct: 286 FGTFRLVLQSILITNKETEQIFTGIRQSENDRSNADINDDWLLYDTDFNLGNLQMLSLYD 345

Query: 505 XXXXKRSFPKILLYTMVIVTNSGQQQIEEENTNLNQQH----------------REVDLT 548
                +  PKIL Y+M+ V +S      ++NT L+ QH                 EVD  
Sbjct: 346 ILDFSKFLPKILFYSMIHVKDS-----VDDNTELSLQHLITVNNTLTNGNMYSPHEVD-- 398

Query: 549 EEKPPNSELSLSNDPQRYFPSTFXXXXXXXXXXXXXXXXASLSEQSGPQMYLPTRMASNV 608
                 SELS  N  + Y  ++                  S++++    +Y P   A+  
Sbjct: 399 ---DSMSELSSDNSIECYTGNS----------------NDSIADEPVIGLYSP---ATAA 436

Query: 609 TTAHRSIRTVNSIGEWAFNRHNS 631
           T  HRSIRTV SIG WA NR N+
Sbjct: 437 TAGHRSIRTVESIGAWALNRSNT 459

>Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa]
           {ON} complement(232194..233849) [1656 nt, 552 aa]
          Length = 551

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 89/180 (49%), Gaps = 14/180 (7%)

Query: 448 FRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMXXXXXXXXXXXXX 507
           F+LVLQSILI N D+ E+ TAIRQSNNE   A + DDWLLYDS FSM             
Sbjct: 260 FQLVLQSILIYNSDSDELITAIRQSNNEQDSADIDDDWLLYDSKFSMTNLQILSLNELLH 319

Query: 508 XKRSFPKILLYTMVIVTNSGQQQIEEENTNLNQQHREVDLTEEKPPNSELSLSNDPQRYF 567
             + +PKIL Y++V + N        EN++       ++ +++      LS+ + PQ+++
Sbjct: 320 INKDYPKILFYSLVSIPNVTVNISNYENSSNPHLEDYINHSDD-----SLSIHDTPQQFY 374

Query: 568 PSTFXXXXXXXXXXXXXXXXAS---LSEQSGPQ------MYLPTRMASNVTTAHRSIRTV 618
           P                    S     + S PQ      M +PT++ +N T AHRS RT+
Sbjct: 375 PMIVNDNNNNININNHNNTRRSSVDYYDDSIPQQFYPDDMNIPTKVNTNTTIAHRSYRTI 434

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 23/31 (74%)

Query: 18 LWSWYLTNLRLGDFEELIGNQLKYTLLKRFL 48
          +W+WYL ++R G FEE++GN+  Y LLK  L
Sbjct: 15 VWTWYLCHVRNGSFEEILGNEDYYKLLKNNL 45

>NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.526
           YML006C
          Length = 379

 Score = 82.0 bits (201), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 73/121 (60%), Gaps = 5/121 (4%)

Query: 11  FDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSIRPNKKILLVS 70
           + +D + +WSWYL+NL+ G+FE L+   ++   L+ +  S F   N  S    KKILL S
Sbjct: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGNEGS----KKILL-S 63

Query: 71  IPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDYLNNFQDPSFL 130
           +P  + +++SI  +FL   F+ E+L++I + + + S     + HYLLTD L+ F + +F+
Sbjct: 64  VPSMLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEAAFI 123

Query: 131 E 131
           E
Sbjct: 124 E 124

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%)

Query: 446 GYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMXXXXXXXXXXX 505
           G  R VL S+LIQN  +KE FTAIRQ +++P  A++ D+WLLYDS FS+           
Sbjct: 300 GQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQDI 359

Query: 506 XXXKRSFPKILLYTMVIVT 524
               +    +LLY  ++++
Sbjct: 360 LLSNKGNSMLLLYKTILIS 378

>Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar to
           Ashbya gossypii ADR198C
          Length = 663

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 67/109 (61%), Gaps = 6/109 (5%)

Query: 13  NDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSIRPNKKILLVSIP 72
           +D NGLWSWYL NLR G+FEEL  + +K  L+KR +  +  G    ++  + ++LLVS+P
Sbjct: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGG----TMSASNRVLLVSVP 65

Query: 73  ENVHEDISILEIFLKDYF-HLEKLEHIQISKLT-HSHCYNHENHYLLTD 119
           +++ +  SILE FL+     + ++    I+KLT      N E+HYL+ D
Sbjct: 66  DDIRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLIND 114

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/78 (48%), Positives = 47/78 (60%)

Query: 446 GYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMXXXXXXXXXXX 505
           G FR+VLQSILI N    ++ TA+RQSNN+ TVA + DDWLLYD  FSM           
Sbjct: 339 GDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSMNNIQMVSLIDI 398

Query: 506 XXXKRSFPKILLYTMVIV 523
                 FPKIL Y++V +
Sbjct: 399 FEMNGVFPKILFYSVVAI 416

>NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON} 
          Length = 371

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 66/118 (55%), Gaps = 3/118 (2%)

Query: 9   DYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSIRPNKKILL 68
           D    DDN + SWYL NLR G FE +I ++ K   L   L+   + DN      NK  +L
Sbjct: 4   DNIKKDDNEVLSWYLRNLREGRFENIIEDRAKNYHLNTILDRQLF-DNKQYGATNK--IL 60

Query: 69  VSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDYLNNFQD 126
           VS   ++ E +SI +IFL   F  E+L++I++ +L      N E HY LTD+LN+F D
Sbjct: 61  VSTLTSIDEIVSIKDIFLGQLFDHERLQYIEVEELKSLKGDNKETHYFLTDHLNSFND 118

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 47/79 (59%)

Query: 446 GYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMXXXXXXXXXXX 505
           G  R VLQSI+ ++  T E+ TAIRQS+ +  VA+ +D+WLLYDS+FS+           
Sbjct: 293 GQIRFVLQSIVFKSVRTAELLTAIRQSSADRIVATSSDEWLLYDSDFSLNNLEISTLQDI 352

Query: 506 XXXKRSFPKILLYTMVIVT 524
                  P+IL YTM +V+
Sbjct: 353 LYPNYENPRILFYTMSVVS 371

>ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML006C
           (GIS4)
          Length = 549

 Score = 67.4 bits (163), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 58/104 (55%), Gaps = 11/104 (10%)

Query: 14  DDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSIRPNKKILLVSIPE 73
           D +GLWSWYL NLR G FE+L+G++ +Y+ LK FL   F      S    +++ L+S P 
Sbjct: 4   DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCF----AHSTGQERRLQLLSFPA 59

Query: 74  NVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLL 117
           +V  D  ILE F++   ++     + I ++   H    E HYL+
Sbjct: 60  SVPCDYKILEEFIRQQGNIS----VAIPRV---HATGTEKHYLV 96

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%)

Query: 448 FRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMXXXXXXXXXXXXX 507
           FR+VLQSIL+ + +   I TA+RQ NN P +A+ +DD LLYD+  S+             
Sbjct: 249 FRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKISLITFRILSLVDLME 308

Query: 508 XKRSFPKILLYTMVIVTNS 526
             R+ PK+L Y++  + NS
Sbjct: 309 LNRAHPKMLFYSVAEIFNS 327

>TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {ON}
           Anc_5.526 YML006C
          Length = 675

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 46/78 (58%)

Query: 446 GYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMXXXXXXXXXXX 505
           G F+LVLQS+++ N ++ E FTA+RQSN+    A+  D+WLLYDS FSM           
Sbjct: 337 GEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSKFSMDNLEIVTLNYL 396

Query: 506 XXXKRSFPKILLYTMVIV 523
                 F KI  Y+MVI+
Sbjct: 397 MDIYADFVKIFFYSMVII 414

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 66/133 (49%), Gaps = 19/133 (14%)

Query: 17  GLWSWYLTNLRLGDFEELIGNQLKY-TLLKRF---LNSHFYG------DNNTSIRPNKKI 66
            LW+WYL  +R G+FEEL+  + KY ++L +    L +H         D N S   +  I
Sbjct: 14  SLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANIS---DGNI 70

Query: 67  LLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHC------YNHENHYLLTDY 120
           L +S+   + +D  I++ FL D F    L +I I ++ +++        +HE +Y++ D 
Sbjct: 71  LFLSLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKDHETYYMVIDS 130

Query: 121 LNNFQDPSFLEFA 133
           LN     S  E +
Sbjct: 131 LNKLLTTSIEEVS 143

>KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}
          
          Length = 324

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 16 NGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSIRPNKKILLVSIP 72
          N  W WY+ NL  G+FEEL  N +K   L  FL +H++G   T+ +  +++LLV+ P
Sbjct: 18 NNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFL-AHYFGGKQTT-KLQRRLLLVTSP 72

>TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {ON} 
          Length = 782

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 65/129 (50%), Gaps = 13/129 (10%)

Query: 12  DND-DNGLWSWYLTNLRLGDFEEL--IGNQLKYTLLKRFLNSHFYGDNNTSIRPNKKILL 68
           DND +  LW+WYL N+    F E   I N+ KY+ LK+ ++   +   N + +  K I+ 
Sbjct: 14  DNDIEYNLWTWYLNNIEEKTFHEFNEIENKEKYSKLKKLIDKKLFTVTNINTKKVKNIIF 73

Query: 69  VSIPENVHEDISILEIFLKDYFHL-EKLEHIQISKL-----THSHCYNHENHYLLTDYLN 122
           +++P+  +        +L+ Y  L   ++ + I+KL     T   C    N+ L+ D + 
Sbjct: 74  LTLPKTKNFQTRDSYFYLQKYLELIFSVQQLYITKLQNNTSTTPSC----NYCLIMDPIL 129

Query: 123 NFQDPSFLE 131
           NFQ+ +F E
Sbjct: 130 NFQNTTFKE 138

>Kpol_1056.11 s1056 (27423..28925) [1503 bp, 500 aa] {ON}
           (27423..28925) [1503 nt, 501 aa]
          Length = 500

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 6   RVGDY--FDNDDNGLWSWYLTNLR-LGDFEELIGNQLKYTLLKRFLN 49
           ++GDY  FDN D  L+S +LTNL  L D +ELI N L   L+   +N
Sbjct: 169 KIGDYKSFDNIDCNLFSIFLTNLLFLNDSKELIYNNLFKALMFSLIN 215

>SAKL0E00616g Chr5 complement(37586..39394) [1809 bp, 602 aa] {ON}
           similar to uniprot|P29029 Saccharomyces cerevisiae
           YLR286C CTS1 Endochitinase required for cell separation
           after mitosis transcriptional activation during late G
           and early M cell cycle phases is mediated by
           transcription factor Ace2p
          Length = 602

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 106 SHCYNHENHYLLTDYLNNFQDPSFLEFASTSWQ 138
           ++C + +   ++  +LNNF DP  L FAS  W+
Sbjct: 47  TYCQSQDADIVILSFLNNFPDPLNLNFASHCWE 79

>KLTH0F16698g Chr6 (1354232..1356262) [2031 bp, 676 aa] {ON} weakly
           similar to uniprot|P50273 YDR350C Saccharomyces
           cerevisiae CM10 Mitochondrial inner membrane protein
           required for assembly of the F0 sector of mitochondrial
           F1F0 ATP synthase
          Length = 676

 Score = 31.6 bits (70), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 22/33 (66%)

Query: 606 SNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKS 638
           + V T+ +++R +N +G W+  RHNSV  +N +
Sbjct: 379 TTVYTSPKTLRLLNELGIWSLLRHNSVNVLNAT 411

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,824,191
Number of extensions: 2792572
Number of successful extensions: 9218
Number of sequences better than 10.0: 40
Number of HSP's gapped: 9414
Number of HSP's successfully gapped: 69
Length of query: 772
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 655
Effective length of database: 40,065,477
Effective search space: 26242887435
Effective search space used: 26242887435
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)