Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_11.3345.708ON54854829730.0
YKR097W (PCK1)5.708ON54954828780.0
Smik_11.3615.708ON54954828750.0
Skud_11.3375.708ON54954828730.0
KNAG0C066405.708ON54754427050.0
CAGL0H06633g5.708ON54454626090.0
NCAS0A031605.708ON55253326050.0
NDAI0E050805.708ON55153626030.0
TDEL0B021205.708ON54854725930.0
SAKL0E15048g5.708ON54254825220.0
ZYRO0B16456g5.708ON54854825020.0
KAFR0H001605.708ON54954924890.0
KLLA0A00484g5.708ON54354924730.0
Ecym_40135.708ON54254824450.0
AFR292W5.708ON54154824010.0
KLTH0E00902g5.708ON54454723780.0
Kwal_55.196635.708ON54454623410.0
TBLA0E017005.708ON57655823090.0
TPHA0E001705.708ON57854323040.0
Kpol_1043.755.708ON55852422890.0
Suva_7.275singletonON961131731e-14
TPHA0J025406.239ON86667771.0
KLTH0B01100g1.527ON1298116732.9
TBLA0B001002.1ON171766706.7
NCAS0F00410singletonON1531143698.7
KAFR0C052205.500ON149939699.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_11.334
         (548 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097...  1149   0.0  
YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}  PCK1Phosp...  1113   0.0  
Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097...  1112   0.0  
Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097...  1111   0.0  
KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON} Anc_5...  1046   0.0  
CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly...  1009   0.0  
NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {O...  1008   0.0  
NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON} Anc_5...  1007   0.0  
TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {O...  1003   0.0  
SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} high...   976   0.0  
ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} high...   968   0.0  
KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}...   963   0.0  
KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON...   957   0.0  
Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON} s...   946   0.0  
AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic ho...   929   0.0  
KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON...   920   0.0  
Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON...   906   0.0  
TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {O...   894   0.0  
TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}...   892   0.0  
Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON} (1620...   886   0.0  
Suva_7.275 Chr7 complement(476201..476281,476285..476410,476414....    71   1e-14
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    34   1.0  
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...    33   2.9  
TBLA0B00100 Chr2 (2396..7549) [5154 bp, 1717 aa] {ON} Anc_2.1 YN...    32   6.7  
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                31   8.7  
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    31   9.9  

>Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097W
           (REAL)
          Length = 548

 Score = 1149 bits (2973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/548 (100%), Positives = 548/548 (100%)

Query: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60
           MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL
Sbjct: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
           IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI 240
           HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI 240

Query: 241 KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP 300
           KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP
Sbjct: 241 KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP 300

Query: 301 EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI
Sbjct: 301 EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 421 PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY 480
           PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY
Sbjct: 421 PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY 480

Query: 481 ESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPD 540
           ESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPD
Sbjct: 481 ESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPD 540

Query: 541 VLAAGPQF 548
           VLAAGPQF
Sbjct: 541 VLAAGPQF 548

>YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}
           PCK1Phosphoenolpyruvate carboxykinase, key enzyme in
           gluconeogenesis, catalyzes early reaction in
           carbohydrate biosynthesis, glucose represses
           transcription and accelerates mRNA degradation,
           regulated by Mcm1p and Cat8p, located in the cytosol
          Length = 549

 Score = 1113 bits (2878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/548 (95%), Positives = 538/548 (98%)

Query: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60
           MSPSKMNA  G+TS VEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKE KTVISSSGAL
Sbjct: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
           IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI 240
           HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 241 KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP 300
           +NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD+GVFNIEGGCYAKCINLSAEKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 301 EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EIFDAI+FG+VLENV YDE SHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI
Sbjct: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 421 PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY 480
           PIRYATMLATKMSQH+ANAYLINTGWTGSSYVSGG RC LKYTRAILDSIHDGSLA  +Y
Sbjct: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 481 ESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPD 540
           E+LPIFNLQVPTKVNGVPAELLNPAKNWSQGE+KY+GAVTNLANLFV+NFKIYQDRATPD
Sbjct: 481 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 540

Query: 541 VLAAGPQF 548
           VLAAGPQF
Sbjct: 541 VLAAGPQF 548

>Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score = 1112 bits (2875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/548 (96%), Positives = 535/548 (97%)

Query: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60
           MSPSKMN   G+TS VEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL
Sbjct: 1   MSPSKMNCTVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
           IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI 240
           HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 241 KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP 300
           +NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD+GVFNIEGGCYAKCINLSAEKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 301 EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EIFDAI+FGAVLENVKYDE SHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI
Sbjct: 301 EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 421 PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY 480
           PIRYATMLA KMSQH+ANAYLINTGWTGSSYVSGG RC LKYTRAILDSIHDGSLA  +Y
Sbjct: 421 PIRYATMLAAKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 481 ESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPD 540
           ESLPIFNLQVPTKV GVPAELLNPAKNWSQGE KYKGAVT+LA LFVENFKIYQDRATPD
Sbjct: 481 ESLPIFNLQVPTKVKGVPAELLNPAKNWSQGETKYKGAVTSLATLFVENFKIYQDRATPD 540

Query: 541 VLAAGPQF 548
           VLAAGPQF
Sbjct: 541 VLAAGPQF 548

>Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score = 1111 bits (2873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/548 (95%), Positives = 537/548 (97%)

Query: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60
           MSPSKM+A  G+TS VEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL
Sbjct: 1   MSPSKMHATTGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
           IAYSGVKTGRSPKDKRIVEE TSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEESTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI 240
           HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 241 KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP 300
           +NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD+GVFNIEGGCYAKCINLSAEKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 301 EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EIFDAI+FGAVLENVKYDE SHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI
Sbjct: 301 EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 421 PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY 480
           PIRYATMLATKMS H++NAYLINTGW+GSSYVSGG RC LKYTRAILDSIHDGSLA  +Y
Sbjct: 421 PIRYATMLATKMSHHKSNAYLINTGWSGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 481 ESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPD 540
           ESLPIFNLQVPTKV GVPAELLNPAKNWSQGEAKYKG+VTNLANLFVENFKIYQDRATPD
Sbjct: 481 ESLPIFNLQVPTKVKGVPAELLNPAKNWSQGEAKYKGSVTNLANLFVENFKIYQDRATPD 540

Query: 541 VLAAGPQF 548
           VLAAGPQF
Sbjct: 541 VLAAGPQF 548

>KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON}
           Anc_5.708 YKR097W
          Length = 547

 Score = 1046 bits (2705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/544 (90%), Positives = 517/544 (95%)

Query: 3   PSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGALIA 62
           PSK N+ A     VEQKIR+EL LS EV TIRRNAPAAVLYED L E+KTVI+SSGALIA
Sbjct: 2   PSKSNSAATDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIA 61

Query: 63  YSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVD 122
           YSG KTGRSPKDKRIVEE TSKD +WWGPVNKPCSERTW INRERAADYLRTRDH+YIVD
Sbjct: 62  YSGEKTGRSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVD 121

Query: 123 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHT 182
           AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRP++EELA+FGEPDFTVWNAGQFPAN+HT
Sbjct: 122 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHT 181

Query: 183 QDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIKN 242
           QDMSSKSTIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSANQGIKN
Sbjct: 182 QDMSSKSTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKN 241

Query: 243 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEPEI 302
           GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLSAEKEPEI
Sbjct: 242 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEI 301

Query: 303 FDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIIL 362
           FDAIRFG+VLENV YDE SH VDYDDS+ITENTRCAYPI+YIPSAKIPCLADSHPKNIIL
Sbjct: 302 FDAIRFGSVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIIL 361

Query: 363 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 422
           LTCDASGVLPPV+KL+PEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI
Sbjct: 362 LTCDASGVLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 421

Query: 423 RYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASYES 482
           RYA MLA KMS+H+ANAYLINTGWTGSSYVSGG RC LKYTRAILD+IHDGSLA+A+YES
Sbjct: 422 RYAKMLAAKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYES 481

Query: 483 LPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPDVL 542
           LPIFNL+VPT VNGVP ELLNPAKNW+QGEAKY GAV+NLA+LFVENFKIYQD+ATPDVL
Sbjct: 482 LPIFNLEVPTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVL 541

Query: 543 AAGP 546
           AAGP
Sbjct: 542 AAGP 545

>CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097w PCK1
          Length = 544

 Score = 1009 bits (2609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/546 (86%), Positives = 509/546 (93%), Gaps = 3/546 (0%)

Query: 3   PSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGALIA 62
           PSK ++V+G +  VE++IR EL LS EVT IRRNAPAAVLY+D LKEKKTVISS+GALIA
Sbjct: 2   PSK-SSVSGNS--VEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIA 58

Query: 63  YSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVD 122
           YSG KTGRSPKDKRIVEE TS+D +WWGPVNKPCSERTW+INRERAADYLRTR+ +Y+VD
Sbjct: 59  YSGEKTGRSPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVD 118

Query: 123 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHT 182
           AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELA+FGEPDFTVWNAGQFPAN  T
Sbjct: 119 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANART 178

Query: 183 QDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIKN 242
           QDM+SK+TIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSS NQGIKN
Sbjct: 179 QDMTSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKN 238

Query: 243 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEPEI 302
           GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKEPEI
Sbjct: 239 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEI 298

Query: 303 FDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIIL 362
           FDAIRFG+VLENV YD  SH VDYDDSSITENTRCAYPID+IPSAKIPCLA +HPKNIIL
Sbjct: 299 FDAIRFGSVLENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIIL 358

Query: 363 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 422
           LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL+LHP+
Sbjct: 359 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPM 418

Query: 423 RYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASYES 482
           RYATMLA KM +H ANA+LINTGWTGSSYVSGG RCALKYTRAILD+IHDGSLAKA +ES
Sbjct: 419 RYATMLAEKMHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFES 478

Query: 483 LPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPDVL 542
           LPIFNLQVP  V GVP+ELLNPA+NWS+GEAKY+ AV+ LA LFVENFK YQD+AT DVL
Sbjct: 479 LPIFNLQVPKAVEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVL 538

Query: 543 AAGPQF 548
           AAGPQ 
Sbjct: 539 AAGPQL 544

>NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {ON}
           Anc_5.708 YKR097W
          Length = 552

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/533 (87%), Positives = 505/533 (94%)

Query: 16  VEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGALIAYSGVKTGRSPKDK 75
           VEQ IR+EL LS++VTTIRRNAPAAVLYED L E+KTVI+SSGALIAYSG KTGRSP+DK
Sbjct: 20  VEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIASSGALIAYSGSKTGRSPRDK 79

Query: 76  RIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYRIKV 135
           RIVEE TSKD +WWGPVNKPCSE+TW+INRERAADYLRTRDH+YIVDAFAGWDPKYRIKV
Sbjct: 80  RIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRDHLYIVDAFAGWDPKYRIKV 139

Query: 136 RVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIEINF 195
           RVVCARAYHA+FMTNMLIRPT+EELA FGEPDFT+WNAGQFPAN +TQDMSSK+TIEINF
Sbjct: 140 RVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQFPANKNTQDMSSKTTIEINF 199

Query: 196 KAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIKNGDVTLFFGLSGTG 255
           KAMEMIILGTEYAGEMKKGIFTVMFYLMPV+HNILTLHSSANQGI+NGDVTLFFGLSGTG
Sbjct: 200 KAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSANQGIQNGDVTLFFGLSGTG 259

Query: 256 KTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGAVLENV 315
           KTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLSAEKEPEIF+AI++G++LENV
Sbjct: 260 KTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSAEKEPEIFNAIKYGSILENV 319

Query: 316 KYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLPPVS 375
            YD+N+ VVDYDD+SITENTRCAYPI+YIPSAKIPCLADSHPKNIILLTCDASGVLPPVS
Sbjct: 320 IYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPPVS 379

Query: 376 KLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKMSQH 435
           KLTPEQVMYHFISGYTSKMAGTE+GVTEPE TFSSCFGQPFLALHPIRYATMLA K+S H
Sbjct: 380 KLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPFLALHPIRYATMLAEKISHH 439

Query: 436 RANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASYESLPIFNLQVPTKVN 495
            A+A+LINTGWTGSSYV+GG RC LKYTRAILDSIHDGSLAK SYE+LPIFNL VPT VN
Sbjct: 440 SADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLAKQSYETLPIFNLSVPTAVN 499

Query: 496 GVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPDVLAAGPQF 548
           GVP E+LNPAKNWS+GEAKY  AV+ L +LFVENFK YQDRATPDVLAAGPQ 
Sbjct: 500 GVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDRATPDVLAAGPQI 552

>NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON}
           Anc_5.708 YKR097W
          Length = 551

 Score = 1007 bits (2603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/536 (86%), Positives = 505/536 (94%)

Query: 13  TSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGALIAYSGVKTGRSP 72
           ++ VEQKIRQEL LS +VTTIRRNAPAA+LYED L E+ T+ISS+GAL+AYSG KTGRSP
Sbjct: 16  SNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISSTGALVAYSGEKTGRSP 75

Query: 73  KDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYR 132
           +DKRIVEE TSKD+IWWGPVNKPCSERTWSINRERAADYLRTRDH+YIVDAFAGWDP+YR
Sbjct: 76  RDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDHLYIVDAFAGWDPEYR 135

Query: 133 IKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIE 192
           IKVRVVCARAYHALFMTNMLIRPT+EELA FGEPDFTVWNAGQFPAN HTQDMSSK+TIE
Sbjct: 136 IKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFPANFHTQDMSSKTTIE 195

Query: 193 INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIKNGDVTLFFGLS 252
           INFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI+NGDVTLFFGLS
Sbjct: 196 INFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIRNGDVTLFFGLS 255

Query: 253 GTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGAVL 312
           GTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKEPEIF+AI++G++L
Sbjct: 256 GTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHEKEPEIFEAIKYGSIL 315

Query: 313 ENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLP 372
           ENV YD  + VV YDDS++TENTRCAYPI++IPSAKIPCLAD+HP NIILLTCDASGVLP
Sbjct: 316 ENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHPSNIILLTCDASGVLP 375

Query: 373 PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKM 432
           PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLA K+
Sbjct: 376 PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLAKKI 435

Query: 433 SQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASYESLPIFNLQVPT 492
           S+H ANA+LINTGWTGSSYVSGG RC LKYTRAILDSIHDGSLAK  +E+LP+FNLQVPT
Sbjct: 436 SKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKQEFETLPVFNLQVPT 495

Query: 493 KVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPDVLAAGPQF 548
            VN VP ELLNPAKNW+QGEAKY  AV+NLA+LFVENFKIYQD+ATP+VLAA P+ 
Sbjct: 496 NVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKATPEVLAAAPRI 551

>TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {ON}
           Anc_5.708 YKR097W
          Length = 548

 Score = 1003 bits (2593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/547 (85%), Positives = 505/547 (92%)

Query: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60
           MSPSKMN      S VEQKIR EL+LS+EV TIRRNAPAA+LYED L EKKT I+SSGAL
Sbjct: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
           IAYSG KTGRSPKDKRI+EE TSKD IWWGPVNKP  E+TWSINRERAADYLRTR H+YI
Sbjct: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           VDAFAGWDP+YRIKVRVVCARAYHALFMTNMLIRPT+EELAHFGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI 240
           HTQ MSSK+T+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSANQGI
Sbjct: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 241 KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP 300
           +  DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSD+GVFNIEGGCYAKCI L+AEKEP
Sbjct: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300

Query: 301 EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EI++AI+FG++LENV YD  +  VDY+DSSITENTRCAYPI++IPSAKIPCLADSHP+N+
Sbjct: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           +LLTCDASGVLPP+SKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420

Query: 421 PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY 480
           PIRYATMLA KMS+HRANA+LINTGWTGSSYV+GG RC LKYTRAILD+IHDGSLAK SY
Sbjct: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480

Query: 481 ESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPD 540
           E+LP FNL +PTKVNGVP ELLNP+KNW +GEAKY  AV NLA LFVENFKIYQDRATP+
Sbjct: 481 ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE 540

Query: 541 VLAAGPQ 547
           VLAAGPQ
Sbjct: 541 VLAAGPQ 547

>SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 542

 Score =  976 bits (2522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/548 (83%), Positives = 496/548 (90%), Gaps = 6/548 (1%)

Query: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60
           MSPSK  A A      EQ+IR EL LSDEV TIRRNAPAA+LYED LKE+KT ISSSGAL
Sbjct: 1   MSPSKTYASA------EQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGAL 54

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
           IAYSG KTGRSP+DKRIV+E TS D +WWGPVNK CSERTW INRERAADYLRTRDH+YI
Sbjct: 55  IAYSGEKTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYI 114

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           VDA+AGWDP+YRIKVRVVCARAYHALFMTNMLIRPTE+ELA FGEPDFTVWNAGQFPAN 
Sbjct: 115 VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANT 174

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI 240
           HT  M+SK+T+EINFK MEMIILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSANQGI
Sbjct: 175 HTTGMTSKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234

Query: 241 KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP 300
            + DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD+GVFNIEGGCYAKCI LSAEKEP
Sbjct: 235 ADNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEP 294

Query: 301 EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EI++AI+FG+VLENV Y+  +  VDY+DSSITENTRCAYPIDYIPSAKIPCLAD+HP NI
Sbjct: 295 EIYNAIKFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNI 354

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           +LLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 355 VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414

Query: 421 PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY 480
           P++YATMLA KM++H ANA+LINTGWTGSSYVSGG RC LKYTRAILDSIHDGSLAK  Y
Sbjct: 415 PMKYATMLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKY 474

Query: 481 ESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPD 540
           E+LP FNL++PT+VN VP+ELLNPAKNW +GEAKY  AV NLA LFVENFK YQDRAT  
Sbjct: 475 ETLPTFNLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQ 534

Query: 541 VLAAGPQF 548
           VL+AGPQ 
Sbjct: 535 VLSAGPQL 542

>ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 548

 Score =  968 bits (2502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/548 (82%), Positives = 495/548 (90%)

Query: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60
           MSPSK+      T+ VE++IR+ELAL  EV TIR NAPAA LYEDGLKEKKT + SSGAL
Sbjct: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
            AYSG KTGRSPKDKRI+EE TSK+E+WWGPVNKP SE+TWSINRERAADYLRTRDH+YI
Sbjct: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           +DA+AGWDP+YRIKVRV+CARAYHALFMTNMLIRP+ EELA+FGEPDFTVWNAGQFPAN 
Sbjct: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI 240
           +T+ M+SK+T+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSANQGI
Sbjct: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 241 KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP 300
           + GDVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSD+GVFNIEGGCYAKCI+L+AEKEP
Sbjct: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300

Query: 301 EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EI++AI+FG+VLENV +D ++  VDY D+SITENTRCAYPIDYIPSAKIPCLAD HP NI
Sbjct: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           +LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420

Query: 421 PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY 480
           P+RYATMLA KM QH ANA+L+NTGWTGSSY +GG RC LKYTRAILDSIHDGSL+KA Y
Sbjct: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480

Query: 481 ESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPD 540
           E+LPIFNL  P KVNGVP  LLNPAK+W +G  KY  AV  LA  F ENFKIYQD+ATPD
Sbjct: 481 ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD 540

Query: 541 VLAAGPQF 548
           VLAAGPQF
Sbjct: 541 VLAAGPQF 548

>KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}
           Anc_5.708 YKR097W
          Length = 549

 Score =  963 bits (2489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/549 (81%), Positives = 497/549 (90%), Gaps = 1/549 (0%)

Query: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLK-EKKTVISSSGA 59
           MSPSK+       + VEQKIRQEL LS  VTTIRRNAP +VLYED LK EK T+ISS+GA
Sbjct: 1   MSPSKVTTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGA 60

Query: 60  LIAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIY 119
           LIAYSG KTGR PKDKRIVEE  SK++IWWGPVNKPCSERTW INRERAADYLRTR+HIY
Sbjct: 61  LIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIY 120

Query: 120 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPAN 179
           IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPT++EL +FG+PDFTVWNAGQFPAN
Sbjct: 121 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPAN 180

Query: 180 LHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQG 239
            HT+DMSSK+TIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP+HHN+LTLHSSAN+G
Sbjct: 181 FHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEG 240

Query: 240 IKNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKE 299
           I+  DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKE
Sbjct: 241 IEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKE 300

Query: 300 PEIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKN 359
           PEIF++I+FG++LENV YD  S  VDYDDSSITENTRCAYPI++IPSAKIPC+A+SHPKN
Sbjct: 301 PEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKN 360

Query: 360 IILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLAL 419
           IILLTCDASGVLPPVSKLT +QVMYHFISGYTSKMAGTEQGVTEP+PTFSSCFGQPFLAL
Sbjct: 361 IILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLAL 420

Query: 420 HPIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKAS 479
           HP++YATMLA KM +H+ANA+LINTGWTGSSY++GG RC L YTRAILD+IHDGSL K S
Sbjct: 421 HPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKES 480

Query: 480 YESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATP 539
           +E+LPIFNL+VP  VN VP +LLNP+KNW +GE KY GAV  L+ LF+ENFK Y+D+AT 
Sbjct: 481 FETLPIFNLKVPKNVNNVPTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATK 540

Query: 540 DVLAAGPQF 548
           +VLAAGP+ 
Sbjct: 541 EVLAAGPRL 549

>KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 543

 Score =  957 bits (2473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/549 (81%), Positives = 495/549 (90%), Gaps = 7/549 (1%)

Query: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60
           MSP+K      T +  E+ IR EL LS EV TIRRNAPAA+LYED LKE+ T IS++GAL
Sbjct: 1   MSPTK------TQNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGAL 54

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
           IAYSG KTGRSP+DKRIVEE TSKD +WWGPVNKPCSERTW INRERAADYLRTRDHIYI
Sbjct: 55  IAYSGDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYI 114

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           VDA+AGWDP+YRIKVRVVCARAYHALFMTNMLIRP++EEL +FGEPDFTVWNAGQFPAN 
Sbjct: 115 VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANT 174

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI 240
           HT  M+SK+T+EINFK MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSANQGI
Sbjct: 175 HTSGMTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234

Query: 241 KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP 300
           ++ DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD+GVFNIEGGCYAKC+ LSAEKEP
Sbjct: 235 QDNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEP 294

Query: 301 EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EIF+AI+FG+VLEN+ YD N+  VDY+DS+ITENTRCAYPI+YIPSAKIPCLAD HPKNI
Sbjct: 295 EIFNAIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNI 354

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           +LLTCDASGVLPPVSKLTP+QVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LH
Sbjct: 355 VLLTCDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLH 414

Query: 421 PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY 480
           P++YATMLA KM++H ANA+LINTGWTGSSYV+GG RC LKYTRAILD+IHDGSLAK  Y
Sbjct: 415 PMKYATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEY 474

Query: 481 ESLPIFNLQVPTKV-NGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATP 539
           E LPIFNLQ+P  V + VPA LLNP+KNW++GEAKY   V +LANLFVENFK YQD+AT 
Sbjct: 475 EVLPIFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATE 534

Query: 540 DVLAAGPQF 548
            VLAAGPQ 
Sbjct: 535 QVLAAGPQL 543

>Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AFR292W
          Length = 542

 Score =  946 bits (2445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/548 (80%), Positives = 488/548 (89%), Gaps = 6/548 (1%)

Query: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60
           MSPSK+          E+KIR EL LS  V  IRRNAPAA+LYED L E+ T ISS+GAL
Sbjct: 1   MSPSKV------FQSPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGAL 54

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
           IAYSG KTGRSPKDKRIV+EPTS +++WWGPVN+  SERTW INRERA DYLRTR+H+YI
Sbjct: 55  IAYSGEKTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYI 114

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           VDAFAGWDP+YRIK+R+VC RAYHALFMTNMLIRPTEEELA FGEPDFTVWNAGQFPAN 
Sbjct: 115 VDAFAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI 240
           HT+ MSSK+T+EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP++HN+LTLHSSANQGI
Sbjct: 175 HTEGMSSKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGI 234

Query: 241 KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP 300
             GDVTLFFGLSGTGKTTLSAD HRLLIGDDEHCWSD GVFNIEGGCYAKCI LSAEKEP
Sbjct: 235 AKGDVTLFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEP 294

Query: 301 EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EIF+AIR+G+VLENV Y+  S VVDYDDSSITENTRCAYPI+YIPSAKIPCL++SHP NI
Sbjct: 295 EIFNAIRYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNI 354

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           +LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 355 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414

Query: 421 PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY 480
           P++YATMLA KMSQH ANA+LINTGWTG+SYVSGG RC LKYTRAILD+IH GSLA A Y
Sbjct: 415 PMKYATMLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADY 474

Query: 481 ESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPD 540
           E+LP+F L +P  V GVP+ELLNP++NW +GE KY  AVT+LANLFV+NFKIYQD+AT +
Sbjct: 475 ETLPVFGLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKE 534

Query: 541 VLAAGPQF 548
           VL AGPQ 
Sbjct: 535 VLYAGPQL 542

>AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR097W (PCK1)
          Length = 541

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/548 (79%), Positives = 485/548 (88%), Gaps = 7/548 (1%)

Query: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60
           MSPSK+          E+KIR EL LS  V TIRRNAPAAVLYED L E+KT ISS+GAL
Sbjct: 1   MSPSKVYQTP------EEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGAL 54

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
           IAYSG KTGRSPKDKRIV+EPTS D IWWGPVN+  SE+TW INRERAAD+LRTR+H+YI
Sbjct: 55  IAYSGEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYI 114

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           VDA+AGWDP+YRIK+R+VC RAYHALFMTNMLIRPTEEELA FGEPDFTVWNAGQFPAN 
Sbjct: 115 VDAYAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI 240
           HT+ MSSK+T+EINF+AMEM+ILGTEYAGEMKKGIFTVMFYLMP++HN+LTLHSSANQG 
Sbjct: 175 HTEGMSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG- 233

Query: 241 KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP 300
            N DVTLFFGLSGTGKTTLSAD HR LIGDDEHCWSD GVFNIEGGCYAKCI LS EKEP
Sbjct: 234 PNNDVTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEP 293

Query: 301 EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EIF+AI++G+VLENV YD  + VVDY+DSSITENTRCAYPI+YIPSA+IPCL+++HP NI
Sbjct: 294 EIFNAIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNI 353

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           +LLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 354 VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 413

Query: 421 PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY 480
           P++YATMLA KMSQH A+A+LINTGWTGSSY +GG RC LKYTRAILDSIHDG+LA+A Y
Sbjct: 414 PMKYATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEY 473

Query: 481 ESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPD 540
           E+LP+F L +P  V GVPAELLNPAKNW +GE KY  AV+ LA+ F ENFKIYQD+AT +
Sbjct: 474 ETLPVFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEE 533

Query: 541 VLAAGPQF 548
           V+ AGPQ 
Sbjct: 534 VVRAGPQI 541

>KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 544

 Score =  920 bits (2378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/547 (78%), Positives = 483/547 (88%), Gaps = 6/547 (1%)

Query: 1   MSPSKM-NAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGA 59
           MSP+K  N V+      +  IRQELAL +EV TIRRNAPAA+LYED LKE KT I+SSGA
Sbjct: 1   MSPTKTRNHVSA-----KDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGA 55

Query: 60  LIAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIY 119
           LIA+SG KTGRSPKDKRIV+EPTS   IWWGPVNK CSE+TW +NRERAADYLRTRDH+Y
Sbjct: 56  LIAFSGSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLY 115

Query: 120 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPAN 179
           IVDA+AGWDP+YRIK+RVVCARAYHALFMTNMLIRPT+EEL +FGEPDFTVWNAGQFPAN
Sbjct: 116 IVDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPAN 175

Query: 180 LHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQG 239
            HT  M+SK+T+EINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSANQG
Sbjct: 176 THTDGMTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQG 235

Query: 240 IKNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKE 299
           I++ DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSD+GVFNIEGGCYAKCI L+  KE
Sbjct: 236 IRDQDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKE 295

Query: 300 PEIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKN 359
           PEIF+AI+FG+VLENV YD  + VVDY+D  ITENTRCAYPI+YIPSAKIPCLA+SHPKN
Sbjct: 296 PEIFNAIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKN 355

Query: 360 IILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLAL 419
           I+LLTCDASGVLPPVSKLTP QVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLAL
Sbjct: 356 IVLLTCDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLAL 415

Query: 420 HPIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKAS 479
           HP++YATMLA KMSQHRANA+LINTGWTG+S+V GG+RC LKYTRAILD++HDGSLA+  
Sbjct: 416 HPLKYATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQED 475

Query: 480 YESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATP 539
           +E+LP F L VP  VN VP  +LNPAKNW +GE KYK  V  LA LF ENFK YQDRA+ 
Sbjct: 476 FETLPTFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASA 535

Query: 540 DVLAAGP 546
           DV++AGP
Sbjct: 536 DVISAGP 542

>Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON}
           YKR097W (PCK1) - phosphoenolpyruvate carboxylkinase
           [contig 159] FULL
          Length = 544

 Score =  906 bits (2341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/546 (76%), Positives = 478/546 (87%), Gaps = 4/546 (0%)

Query: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60
           MSPSK+  +      V+ +IR+ELAL +EV TIRRNAPAA+LYED LKE KT IS+SGAL
Sbjct: 1   MSPSKIRNLVS----VKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGAL 56

Query: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120
           IA+SG KTGRSPKDKRIV+EPTS   IWWGPVNK CSE+TW +NRERAAD+LRTRDH+YI
Sbjct: 57  IAFSGSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYI 116

Query: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180
           VDA+AGWDP+YRIK+RVVCARAYHALFMTNMLI+PT +EL  FGEPDFTVWNAGQFPAN 
Sbjct: 117 VDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANT 176

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI 240
           HT  M+SK+TIEINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMP++H +LTLHSSANQGI
Sbjct: 177 HTDGMTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGI 236

Query: 241 KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP 300
           ++ DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSD+GVFNIEGGCYAKCI L+  KEP
Sbjct: 237 RDNDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEP 296

Query: 301 EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360
           EIF+AIRFG+VLENV YD  +  VD+++  ITENTRCAYPI+YIPSAKIPCLAD HPKNI
Sbjct: 297 EIFNAIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNI 356

Query: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420
           +LLTCDASGVLPPVSKLTPEQVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLALH
Sbjct: 357 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALH 416

Query: 421 PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY 480
           P++YATMLA KMS H+A+A+LINTGWTG S+V GG RC LKYTRAILD+IHDG+LAK  Y
Sbjct: 417 PLKYATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEY 476

Query: 481 ESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPD 540
           E+LP FNL +P  VN VP+ +LNPA++W  GEAKYK  V  LANLFVENFK Y+  A+ +
Sbjct: 477 ETLPTFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTE 536

Query: 541 VLAAGP 546
           ++ AGP
Sbjct: 537 IMCAGP 542

>TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {ON}
           Anc_5.708 YKR097W
          Length = 576

 Score =  894 bits (2309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/558 (75%), Positives = 475/558 (85%), Gaps = 14/558 (2%)

Query: 4   SKMNAVAGTTSGVEQKIRQELALSDEVT----------TIRRNAPAAVLYEDGLKEKKTV 53
           + +N   G  S  +QK+  E  L  ++            I+ N  AA+LYED LKE KTV
Sbjct: 18  TNINNYNGNPSLKKQKLSMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTV 77

Query: 54  ISSSGALIAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLR 113
           ISSSGALIAYSG KTGRSPKDKRIV E  SKD +WWGPVNKPCSE+TW INRER  DYL 
Sbjct: 78  ISSSGALIAYSGAKTGRSPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLG 137

Query: 114 TRDHIYIVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNA 173
           TR ++Y++DA+ GWDP+YR+KVRVVCARAYHALFMTNMLIRPTEEEL +F EPDFTVWNA
Sbjct: 138 TRSNLYVIDAYVGWDPRYRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNA 197

Query: 174 GQFPANLHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLH 233
           G F AN +T DM+SK+++EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP+HHNILTLH
Sbjct: 198 GGFSANSYTADMTSKTSVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLH 257

Query: 234 SSANQGIKNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCIN 293
           SSAN+GI+  DVT+FFGLSGTGKTTLSADP+RLLIGDDEHCWSD+GVFNIEGGCYAKCI 
Sbjct: 258 SSANEGIEKKDVTVFFGLSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIG 317

Query: 294 LSAEKEPEIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLA 353
           L+ EKEPEIFDAIRFG+VLENV Y+E +H VDY+D +ITENTRCAYPIDYI SAKIPCLA
Sbjct: 318 LTREKEPEIFDAIRFGSVLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLA 377

Query: 354 DSHPKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFG 413
           +SHPKN+ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFG
Sbjct: 378 NSHPKNLILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFG 437

Query: 414 QPFLALHPIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDG 473
           QPFLALHPI YATMLA KM Q+++NA+LINTGWTGSSY +GGSRC LKYTRAILD+IHDG
Sbjct: 438 QPFLALHPITYATMLAKKMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDG 497

Query: 474 SLAKASYESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAK----YKGAVTNLANLFVEN 529
           +LA  +YE+LP+FNLQ+PT VNGVP E+LNP  +W+    K    Y  AV  LA LFVEN
Sbjct: 498 TLANENYETLPVFNLQIPTHVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVEN 557

Query: 530 FKIYQDRATPDVLAAGPQ 547
           FKIYQD+AT DVLAAGPQ
Sbjct: 558 FKIYQDKATDDVLAAGPQ 575

>TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}
           Anc_5.708 YKR097W
          Length = 578

 Score =  892 bits (2304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/543 (76%), Positives = 466/543 (85%), Gaps = 1/543 (0%)

Query: 4   SKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGALIAY 63
           +K+     T   +E+ I   L+ + ++  I+RN P A LYEDGLKE KT +SS+GALIAY
Sbjct: 35  TKIKNKNDTIKLLEEFISDNLS-NHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAY 93

Query: 64  SGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDA 123
           SGVKTGRSPKDKRIVEE  SKD IWWGPVNK CSERTW+INRERA DYL TRD +Y++DA
Sbjct: 94  SGVKTGRSPKDKRIVEEELSKDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDA 153

Query: 124 FAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQ 183
           F GWDP+YRIK+RVVCARAYHALFM NMLIRPT+EEL +FG+PDFTVWNAGQF AN  T 
Sbjct: 154 FVGWDPRYRIKIRVVCARAYHALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTN 213

Query: 184 DMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIKNG 243
           DMSSK+++EINFK MEM ILGTEYAGEMKKGIFTVMFYLMP++HN+LTLHSSANQ   NG
Sbjct: 214 DMSSKTSVEINFKEMEMTILGTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNG 273

Query: 244 DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEPEIF 303
           DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDNGVFNIEGGCYAKCI LS EKEP+IF
Sbjct: 274 DVTLFFGLSGTGKTTLSADPHRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIF 333

Query: 304 DAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILL 363
           +AI+FG+VLEN  YDE +H VDYD+S+ITENTRCAYPIDYI +AKIPCLAD HP N+ILL
Sbjct: 334 NAIKFGSVLENCIYDEETHEVDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILL 393

Query: 364 TCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIR 423
           TCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTE GVTEP+PTFSSCFGQPFLALHP++
Sbjct: 394 TCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMK 453

Query: 424 YATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASYESL 483
           YA+MLA KM +H+ANA+L+NTGWTGSSYVSGGSRC LKYTRAILD+IHDGSL    YE+L
Sbjct: 454 YASMLAEKMDKHKANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETL 513

Query: 484 PIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPDVLA 543
           PIFNLQ+P   NGVP+ELLNPA +W+     Y  AV  L  LF ENFK Y+D+AT +V+ 
Sbjct: 514 PIFNLQIPKNANGVPSELLNPAGSWTDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIK 573

Query: 544 AGP 546
           AGP
Sbjct: 574 AGP 576

>Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON}
           (162051..163727) [1677 nt, 559 aa]
          Length = 558

 Score =  886 bits (2289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/524 (77%), Positives = 459/524 (87%)

Query: 25  ALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGALIAYSGVKTGRSPKDKRIVEEPTSK 84
            L ++  TI+RN P A LYEDGLKE  T +SS+GAL+AYSGVKTGRSPKDKRIVEEP+SK
Sbjct: 35  CLYNKDITIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSK 94

Query: 85  DEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYRIKVRVVCARAYH 144
           D IWWGPVNKPCSE TWSINRERA DYL TR  +Y++DA+AGWD  YRIK+RVVCAR YH
Sbjct: 95  DNIWWGPVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYH 154

Query: 145 ALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIEINFKAMEMIILG 204
           ALFM NMLIRPT EEL +FGEPDFT+WNAG F AN  T+DM+SK++IEINFK+MEM+ILG
Sbjct: 155 ALFMNNMLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILG 214

Query: 205 TEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIKNGDVTLFFGLSGTGKTTLSADPH 264
           TEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSANQG+ NGDVTLFFGLSGTGKTTLSADPH
Sbjct: 215 TEYAGEMKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPH 274

Query: 265 RLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGAVLENVKYDENSHVV 324
           R LIGDDEHCWSD+GVFNIEGGCYAKCI L+ EKEPEIF+AI+FG+VLEN  YDEN+HVV
Sbjct: 275 RELIGDDEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVV 334

Query: 325 DYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLPPVSKLTPEQVMY 384
           DYDDS ITENTRCAYPID+I SAKIPCL D HP N+ILLTCDASGVLPPVSKLTPEQVMY
Sbjct: 335 DYDDSRITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMY 394

Query: 385 HFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKMSQHRANAYLINT 444
           HFISGYTSKMAGTEQGVTEPEPTFS+CFGQPFLALHP++YA MLA KM+ H+A+A+LINT
Sbjct: 395 HFISGYTSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINT 454

Query: 445 GWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASYESLPIFNLQVPTKVNGVPAELLNP 504
           GWTG+SY +GG RC LKYTRAILD+IH+GSLA   YE+LP+FNL +P  V  VP+ELLNP
Sbjct: 455 GWTGASYTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNP 514

Query: 505 AKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPDVLAAGPQF 548
           +K WS  +  Y  AV  L +LFV+NF IYQD+AT DV+AAGP  
Sbjct: 515 SKTWSDPDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558

>Suva_7.275 Chr7
           complement(476201..476281,476285..476410,476414..476494)
           [288 bp, 96 aa] {ON} YKR097W (REAL)
          Length = 96

 Score = 71.2 bits (173), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 60/113 (53%), Gaps = 22/113 (19%)

Query: 377 LTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKMSQHR 436
           LT E+VMYHF SG+ S   G                 +PFLALHPI Y T++ATKM  H 
Sbjct: 1   LTSEEVMYHFNSGHASN--GRNWAGCHLTSNVLLVLVKPFLALHPISYITVIATKMFAH- 57

Query: 437 ANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKA-----SYESLP 484
            +AYLINTG+            ALK TR   DSIHD SLAK      +Y+ LP
Sbjct: 58  -SAYLINTGY------------ALK-TRVNFDSIHDDSLAKELFRAPTYKCLP 96

>TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {ON}
           Anc_6.239 YGL137W
          Length = 866

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 6/67 (8%)

Query: 213 KGIFTVMFYLMPVHHNILTLHSSANQGIKNGDVTLFFGLSGTGKTTLSADPHRLLIGDDE 272
           K    VM + +P+++NI  L++ +  G+K+     FF           A   R+ I  DE
Sbjct: 420 KNFKEVMSWSIPLNYNIENLYTGSLLGVKSDGFVYFFDWES------GALIRRIDIDADE 473

Query: 273 HCWSDNG 279
             WSDNG
Sbjct: 474 VVWSDNG 480

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 50/116 (43%), Gaps = 9/116 (7%)

Query: 232  LHSSANQGIKNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDN-GVFNIEGGCYAK 290
            ++   N  +K G+     GLSG+GK+TL     RL        W D   V   E     K
Sbjct: 1077 VYRGLNLSVKAGETVALVGLSGSGKSTLWHLITRLYRVPSGSIWFDGLDVNEWEEWALRK 1136

Query: 291  CINLSAEKEPEIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPS 346
             I +  E+ P +F     G++ +N+ Y  ++ V   D+  I E       +D++ S
Sbjct: 1137 RIAV-VEQRPSLFR----GSIFDNLTYGLSTSV---DEREIRELLELVGMMDFVNS 1184

>TBLA0B00100 Chr2 (2396..7549) [5154 bp, 1717 aa] {ON} Anc_2.1 YNL242W
          Length = 1717

 Score = 31.6 bits (70), Expect = 6.7,   Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 10/66 (15%)

Query: 334  NTRCAYPIDYI------PSAKIPCLADSHPKNIILLTCDASGVLPPVSKLTPEQVMYHFI 387
            +T  A  +DY+       S K+ CL  S     ILLT +AS    P S     +++YH+I
Sbjct: 952  HTALALILDYLIINGSLSSLKVKCLLKS---GTILLTDNASTSSKPPSNKQSNRMLYHYI 1008

Query: 388  S-GYTS 392
            S GYT+
Sbjct: 1009 SQGYTT 1014

>NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON} 
          Length = 1531

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 60/143 (41%), Gaps = 17/143 (11%)

Query: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIF--TVMFYLMPVHHNILTLHSSANQ 238
           +T + S  ++  IN+  ME     +E      + IF    + Y +P+   I  + ++ + 
Sbjct: 837 NTTEKSILNSSSINYDDME-----SEVGLSKSEAIFHWRNLCYEIPIKKEIRHILNNIDG 891

Query: 239 GIKNGDVTLFFGLSGTGKTT-LSADPHRLLIGDD------EHCWSDNGVFNIEGGCYAKC 291
            +K G +T   G SG GKTT L     R+ +G          C  D       G C  + 
Sbjct: 892 WVKPGTLTALMGASGAGKTTLLDCLAQRVTVGTITGDVFVNGCLRDESFPRSIGYCQQQD 951

Query: 292 INLSAEKEPEIFDAIRFGAVLEN 314
           ++L   K   + +++RF A L  
Sbjct: 952 LHL---KTSTVRESLRFSAYLRQ 971

>KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON}
           Anc_5.500 YDR406W
          Length = 1499

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 221 YLMPVHHNILTLHSSANQGIKNGDVTLFFGLSGTGKTTL 259
           Y +P+ H    L  + +  +K G +T   G SG GKTTL
Sbjct: 858 YDIPIKHGTRRLLDNVDGWVKPGTLTALMGASGAGKTTL 896

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,977,914
Number of extensions: 2617891
Number of successful extensions: 6698
Number of sequences better than 10.0: 32
Number of HSP's gapped: 6844
Number of HSP's successfully gapped: 32
Length of query: 548
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 433
Effective length of database: 40,294,809
Effective search space: 17447652297
Effective search space used: 17447652297
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)