Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_11.3335.706ON1187118763340.0
Smik_11.3605.706ON1180119647900.0
YKR096W5.706ON1195119747190.0
Skud_11.3365.706ON118893941670.0
TDEL0B021405.706ON1147100530050.0
ZYRO0B16412g5.706ON137297829590.0
KAFR0H001805.706ON124197428700.0
CAGL0G02541g5.706ON1295102727900.0
SAKL0E15004g5.706ON1196105927040.0
Kpol_1043.735.706ON126095926870.0
NCAS0A031705.706ON1319104126760.0
Kwal_55.196785.706ON1178111426040.0
KLTH0E00968g5.706ON114897125800.0
AFR290W5.706ON121797325450.0
TPHA0E001905.706ON136198825440.0
Skud_9.175.706ON111894325150.0
Suva_9.375.706ON111795825140.0
YIL151C5.706ON111895024840.0
Ecym_40155.706ON1257100924820.0
KLLA0A00528g5.706ON122997724430.0
Smik_9.185.706ON111898124390.0
CAGL0H06611g5.706ON1282103824190.0
KNAG0C066305.706ON128181223630.0
TBLA0E017105.706ON152678517050.0
NDAI0E050705.706ON155638013591e-163
TPHA0D046405.706ON9629274115e-40
ZYRO0A05632g5.615ON32774810.61
KLTH0D08800g2.601ON91098763.3
ZYRO0F01826g1.261ON769144763.4
Smik_12.4504.202ON73641753.7
KNAG0A018908.555ON184061753.9
Kwal_56.24037singletonOFF14236705.2
YJL129C (TRK1)1.224ON123565737.1
YJL016W5.164ON561757110.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_11.333
         (1187 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...  2444   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...  1849   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...  1822   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...  1609   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1162   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1144   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...  1110   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...  1079   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...  1046   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...  1039   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...  1035   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...  1007   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...   998   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...   984   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   984   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   973   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   972   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   961   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...   960   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...   945   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   944   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   936   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...   914   0.0  
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   661   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   528   e-163
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...   162   5e-40
ZYRO0A05632g Chr1 (457286..458269) [984 bp, 327 aa] {ON} similar...    36   0.61 
KLTH0D08800g Chr4 complement(734724..737456) [2733 bp, 910 aa] {...    34   3.3  
ZYRO0F01826g Chr6 complement(149490..151799) [2310 bp, 769 aa] {...    34   3.4  
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    33   3.7  
KNAG0A01890 Chr1 complement(137589..143111) [5523 bp, 1840 aa] {...    33   3.9  
Kwal_56.24037 s56 complement(822878..823306) [429 bp, 142 aa] {O...    32   5.2  
YJL129C Chr10 complement(173599..177306) [3708 bp, 1235 aa] {ON}...    33   7.1  
YJL016W Chr10 (405588..407273) [1686 bp, 561 aa] {ON} Putative p...    32   10.0 

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score = 2444 bits (6334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1187/1187 (100%), Positives = 1187/1187 (100%)

Query: 1    MPEISVQNPLRLSENGNARSMFLSASQPQRPSTASSFPMSVHNAARLDLSNFQVLNSSAK 60
            MPEISVQNPLRLSENGNARSMFLSASQPQRPSTASSFPMSVHNAARLDLSNFQVLNSSAK
Sbjct: 1    MPEISVQNPLRLSENGNARSMFLSASQPQRPSTASSFPMSVHNAARLDLSNFQVLNSSAK 60

Query: 61   RQNSNSVNEDINSSKRRISRPNFLDIEYTNNASSQSEKTTLYNSRPNPSARYLGSPKRAL 120
            RQNSNSVNEDINSSKRRISRPNFLDIEYTNNASSQSEKTTLYNSRPNPSARYLGSPKRAL
Sbjct: 61   RQNSNSVNEDINSSKRRISRPNFLDIEYTNNASSQSEKTTLYNSRPNPSARYLGSPKRAL 120

Query: 121  QRENSVEVTRSSPLISKPASHNGKHIAYDKHTTGSNSLLNMSKSSLAYVEAEPDGQSSNE 180
            QRENSVEVTRSSPLISKPASHNGKHIAYDKHTTGSNSLLNMSKSSLAYVEAEPDGQSSNE
Sbjct: 121  QRENSVEVTRSSPLISKPASHNGKHIAYDKHTTGSNSLLNMSKSSLAYVEAEPDGQSSNE 180

Query: 181  IIENFQHKETESDDIHNEDGDDGADPNDLSNSENNNNYNNNNNNNINNNNNNNTNNNNIN 240
            IIENFQHKETESDDIHNEDGDDGADPNDLSNSENNNNYNNNNNNNINNNNNNNTNNNNIN
Sbjct: 181  IIENFQHKETESDDIHNEDGDDGADPNDLSNSENNNNYNNNNNNNINNNNNNNTNNNNIN 240

Query: 241  NNEDDDNNEQEESNVYRPANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTE 300
            NNEDDDNNEQEESNVYRPANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTE
Sbjct: 241  NNEDDDNNEQEESNVYRPANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTE 300

Query: 301  LKSLWTIYRINTELVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFL 360
            LKSLWTIYRINTELVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFL
Sbjct: 301  LKSLWTIYRINTELVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFL 360

Query: 361  DVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSF 420
            DVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSF
Sbjct: 361  DVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSF 420

Query: 421  IDWKLSAEHWYTEAMKYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQ 480
            IDWKLSAEHWYTEAMKYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQ
Sbjct: 421  IDWKLSAEHWYTEAMKYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQ 480

Query: 481  LVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGID 540
            LVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGID
Sbjct: 481  LVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGID 540

Query: 541  ANGCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKE 600
            ANGCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKE
Sbjct: 541  ANGCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKE 600

Query: 601  RKDKKERKKSSNNESSITESSTSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRR 660
            RKDKKERKKSSNNESSITESSTSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRR
Sbjct: 601  RKDKKERKKSSNNESSITESSTSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRR 660

Query: 661  PIVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKS 720
            PIVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKS
Sbjct: 661  PIVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKS 720

Query: 721  SQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAE 780
            SQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAE
Sbjct: 721  SQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAE 780

Query: 781  LLDVFKEKEELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIF 840
            LLDVFKEKEELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIF
Sbjct: 781  LLDVFKEKEELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIF 840

Query: 841  DVNDENGEKFWKRACRTIFLFRELSRSFQIGVIINNESSINRSSLQSNNILGNLSYKLEP 900
            DVNDENGEKFWKRACRTIFLFRELSRSFQIGVIINNESSINRSSLQSNNILGNLSYKLEP
Sbjct: 841  DVNDENGEKFWKRACRTIFLFRELSRSFQIGVIINNESSINRSSLQSNNILGNLSYKLEP 900

Query: 901  LSTLGSSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTC 960
            LSTLGSSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTC
Sbjct: 901  LSTLGSSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTC 960

Query: 961  FDKNGEFLSASLYTSWYVPNGSNNPETNINSNCEKENEGQFLECLKSDDREIDLNTTYFV 1020
            FDKNGEFLSASLYTSWYVPNGSNNPETNINSNCEKENEGQFLECLKSDDREIDLNTTYFV
Sbjct: 961  FDKNGEFLSASLYTSWYVPNGSNNPETNINSNCEKENEGQFLECLKSDDREIDLNTTYFV 1020

Query: 1021 FDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLY 1080
            FDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLY
Sbjct: 1021 FDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLY 1080

Query: 1081 YENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSC 1140
            YENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSC
Sbjct: 1081 YENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSC 1140

Query: 1141 RFNYVILISDDDTMKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD 1187
            RFNYVILISDDDTMKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD
Sbjct: 1141 RFNYVILISDDDTMKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD 1187

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score = 1849 bits (4790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 936/1196 (78%), Positives = 1046/1196 (87%), Gaps = 25/1196 (2%)

Query: 1    MPEISVQNPLRLSENGNARSMFLSASQPQRPSTASSFPMSVHNAA-RLDLSNFQVLNSSA 59
            MP+ SVQNP+RLSEN N RS+FLS SQPQRPS  SSFP  VHNA  RL+LS+FQVLN S 
Sbjct: 1    MPKTSVQNPIRLSENENTRSIFLSISQPQRPSNISSFPRLVHNATTRLELSDFQVLNPSF 60

Query: 60   KRQNSNSVNEDINSSKRRISRPNFLDIEYTNNASSQSEKTTLYNSRPNPSARYLGSPKRA 119
            KRQNSNSVN+DIN SKRRISR  F + E  N+ S+QSEKTT  +SR N S +++G  K +
Sbjct: 61   KRQNSNSVNDDINCSKRRISRSKFSNSEDRNDDSTQSEKTTTNHSRSNKSFKFMGRQKLS 120

Query: 120  LQRENSVEVTRSSPLISKPASHNGKHIAYDKHTTGSNSLL---NMSKSSLAYVEAEPDGQ 176
            +Q EN VEVT+SS L+SKP +   K+  Y+K   GS +++   N+SKSS A+V+ E DGQ
Sbjct: 121  MQEENLVEVTQSSALLSKPLNKQSKNTTYEKR--GSQNVVKPKNISKSSFAFVDGESDGQ 178

Query: 177  SSNEIIENFQHKETESDDIHNEDGDDGADPNDLSNSENNNNYNNNNNNNINNNNNNNTNN 236
            S+N I+ NFQ + + S+++ +E   +  D N+ + +++N++              +N  N
Sbjct: 179  SNNGIVSNFQRESSNSENVCDEYKGEKNDDNNENRNDDNDD--------------SNNGN 224

Query: 237  NNINNNEDDDNNEQEESNVYRPANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNS 296
            ++ N N +DD NE++E++  +PANNK+S IALIQKLQELY+VIVKQEIELQERCSQLTNS
Sbjct: 225  HDNNINNNDDENERDENDACKPANNKRSGIALIQKLQELYRVIVKQEIELQERCSQLTNS 284

Query: 297  QTTELKSLWTIYRINTELVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGT 356
            QTTELKSLWTIY+INTELVNNYVTFITTALLPSQP HDLVIGQEIVEIYRIERRLWVYGT
Sbjct: 285  QTTELKSLWTIYKINTELVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGT 344

Query: 357  ITFLDVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALY 416
            ITFLDVLKNFSNFMDPEVCCQFITHVF+SLSTMISDIPSKYSITWLQRLGDLSRMAIALY
Sbjct: 345  ITFLDVLKNFSNFMDPEVCCQFITHVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALY 404

Query: 417  PSSFIDWKLSAEHWYTEAMKYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSP 476
            PSSFIDWKLSAEHWYTEAMKY YNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSP
Sbjct: 405  PSSFIDWKLSAEHWYTEAMKYTYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSP 464

Query: 477  QYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEK 536
            QYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYF+EK
Sbjct: 465  QYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEK 524

Query: 537  FGIDANGCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPK 596
            FGIDANGCNIFN EDMFIQNPDFFKYFFRH PSFAQSHILQIVGFGEPKNPFAILFELPK
Sbjct: 525  FGIDANGCNIFNCEDMFIQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPK 584

Query: 597  HLKERKDKKERKKSSNNESSITESSTSNSRNENDDNDEIMSSTTSISERDSLIEFFNDID 656
            +LKERKDKKERKK+SNN+SS+TESST NSRN N+D+DE MSSTTS+S+ D L+EFFNDID
Sbjct: 585  YLKERKDKKERKKTSNNDSSVTESSTGNSRNGNEDDDETMSSTTSMSDPDLLVEFFNDID 644

Query: 657  TLRRPIVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISI 716
            TLRRPI+ SMLTNEAWLE+LKFLNMTSLKCGMIVLRKFLHGPLG+ALPH LPWIYFIISI
Sbjct: 645  TLRRPILPSMLTNEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISI 704

Query: 717  CLKSSQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDL 776
            CLKS+QL+DPISKEFWIVI+KR+FPWDTMVTFMN+LIA +LDNE ++ IIG LC+EYS L
Sbjct: 705  CLKSNQLNDPISKEFWIVIIKRMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCNEYSKL 764

Query: 777  NLAELLDVFKEKEELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPID 836
            NL+ELL+ F E E+LPEIWGCWGTLWFD ICQKNT+SISS+D+F+E+GI+DYMALDSP D
Sbjct: 765  NLSELLNSFNENEDLPEIWGCWGTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTD 824

Query: 837  GIIFDVNDENGEKFWKRACRTIFLFRELSRSFQIGVIINNESSINRSSLQSNNILGNLSY 896
            GIIFD  DENGEKFWKRACR IFLFRE+SRSF +GVI+ ++  +N SSLQSNNIL +L Y
Sbjct: 825  GIIFDDKDENGEKFWKRACRIIFLFREVSRSFPLGVIVRHDPLVNCSSLQSNNILRDLVY 884

Query: 897  KLEPLSTLGSSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCP 956
            KLEPL+ + SS+P L+TLE I D+ E RSE N DLHAVPELSVI G +IF+Y GYKKL P
Sbjct: 885  KLEPLTNIRSSVPVLSTLESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRP 944

Query: 957  NYTCFDKNGEFLSASLYTSWYVPNGSNNPETNINSNCEKENEGQFLECLKSDD-----RE 1011
            +YTCFDKNGEFLSASLYTSWYVPN +NN ETNI+   E+ENE  FLEC+KS        E
Sbjct: 945  DYTCFDKNGEFLSASLYTSWYVPNCNNNLETNISYANERENEALFLECMKSVHPEIAYPE 1004

Query: 1012 IDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATR 1071
            ID  TTYFVFDATSWLRHSARIFKLAQNRLL+FAICLTTFQELRFLRKSKDENVMEAATR
Sbjct: 1005 IDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATR 1064

Query: 1072 GIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLEN 1131
            GIITIRQLY E+KVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLEN
Sbjct: 1065 GIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLEN 1124

Query: 1132 ANQLPVSSCRFNYVILISDDDTMKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD 1187
            A Q  +SS RFNYV+LISDDDTMKKKAEEKKI+TLSTRFVFSLCTKLGEQRHLCTD
Sbjct: 1125 AKQPNISSHRFNYVVLISDDDTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD 1180

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score = 1822 bits (4719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 959/1197 (80%), Positives = 1053/1197 (87%), Gaps = 12/1197 (1%)

Query: 1    MPEISVQNPLRLSENGNARSMFLSASQPQRPSTASSFPMSVHNA-ARLDLSNFQVLNSSA 59
            MPE SVQNPLRLSEN N RSMFLSASQ QRPS   SFP  V N  A L LS+FQVLN S+
Sbjct: 1    MPETSVQNPLRLSENENTRSMFLSASQQQRPSATPSFPRLVRNTTANLSLSDFQVLNPSS 60

Query: 60   KRQNSNSVNEDINSSKRRISRPNFLDIEYTNNASSQSEKTTLYNSRPNPSARYLGSPKRA 119
            KRQNSNSV +DINSSKRRISRP F DIE  NN  +  E+TT+  S  NPS RY+ S KRA
Sbjct: 61   KRQNSNSVYDDINSSKRRISRPRFSDIEGKNNDHTYPERTTVKESEKNPSPRYVSSSKRA 120

Query: 120  LQRENSVEVTRSSPLISKPASHNGKHIAYDKHTTGSN-SLLNMSKSSLAYVEAEPDGQSS 178
            L+RENSV +T+SS LISK  S NG  IA++K +  +    LN+S++SLA+V+A  D QS 
Sbjct: 121  LKRENSVGITQSSALISKSFSENGGSIAHEKWSPENMIKPLNVSQNSLAFVDAGSDEQSK 180

Query: 179  NEIIENFQHKETESDDIHNEDGDDGADPNDLSNSENNNNYNNNNNNNINNNNNNNTNNNN 238
            +EI+  FQ K   S +I+  D D+ A   D +NS NNNN NN+++NN +NNNNNN +NNN
Sbjct: 181  SEIVGGFQRKSNNSQEIN--DKDNSARDQDFNNSGNNNNNNNHSSNNNDNNNNNNDDNNN 238

Query: 239  INNNEDDDNN-------EQEESNVYRPANNKKSSIALIQKLQELYKVIVKQEIELQERCS 291
             NN+   DNN       E+EE++  +PA+NK+S IALIQKLQELYKVIVKQEIELQERCS
Sbjct: 239  NNNSNSRDNNNNSDDSNEREENDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCS 298

Query: 292  QLTNSQTTELKSLWTIYRINTELVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRL 351
            QLTNSQTTELKSLWTIY+INT+LVNNYVTFITTALLPSQP HDLVIGQEIVEIYRIERRL
Sbjct: 299  QLTNSQTTELKSLWTIYKINTDLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRL 358

Query: 352  WVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRM 411
            WVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRM
Sbjct: 359  WVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRM 418

Query: 412  AIALYPSSFIDWKLSAEHWYTEAMKYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQET 471
            AIALYPSSFIDWKLSAEHWYTEAMKY+YNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQET
Sbjct: 419  AIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQET 478

Query: 472  FTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLS 531
            FTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLS
Sbjct: 479  FTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLS 538

Query: 532  YFVEKFGIDANGCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAIL 591
            YF+EKFGIDANGCNIFN EDMF+QNPDFFKYFFRH PSFAQSHILQIVGFGEPKNPFAIL
Sbjct: 539  YFIEKFGIDANGCNIFNAEDMFVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAIL 598

Query: 592  FELPKHLKERKDKKERKKSSNNESSITESSTSNSRNENDDNDEIMSSTTSISERDSLIEF 651
            FELPK+LKERKDKKERKKSSNN+SS+TESST NSRN+N+D+DEIMSSTTSIS+ D L EF
Sbjct: 599  FELPKYLKERKDKKERKKSSNNDSSVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEF 658

Query: 652  FNDIDTLRRPIVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIY 711
            FNDIDTLRRPI+ SMLTNEAWLE+LKFLNMTSLKCG+IVLRKFLHGPLGIALPH LPWIY
Sbjct: 659  FNDIDTLRRPILPSMLTNEAWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIY 718

Query: 712  FIISICLKSSQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCD 771
            FIISICLKSSQLSDP+SKEFW++IVKR FPWDTMVTFMN+LI  +LDN+ ++ IIG LCD
Sbjct: 719  FIISICLKSSQLSDPVSKEFWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCD 778

Query: 772  EYSDLNLAELLDVFKEKEELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMAL 831
            +Y  L+L+ELL++F E EELPEI GCWGTLWFDTIC+KNT+SISS+D+F+E+GIKDYMAL
Sbjct: 779  DYDKLSLSELLELFNEGEELPEILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMAL 838

Query: 832  DSPIDGIIFDVNDENGEKFWKRACRTIFLFRELSRSFQIGVIINNESSINRSSLQSNNIL 891
            DSP DGIIFD  DENGEKFWKRACRTIFLFRELSRSF IGVII N+  I RSS Q+ NIL
Sbjct: 839  DSPTDGIIFDEKDENGEKFWKRACRTIFLFRELSRSFPIGVIIRNDPLIYRSSFQNTNIL 898

Query: 892  GNLSYKLEPLSTLGSSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGY 951
            G+L +KLEPL  + ++IP L  LE IID+ E RSENN DLHAVPELSV +G +IF+Y GY
Sbjct: 899  GSLVFKLEPLCNIHNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGY 958

Query: 952  KKLCPNYTCFDKNGEFLSASLYTSWYVPNGSN-NPETNINSNCEKENEGQFLECLKSDDR 1010
            KKL  +YTCFDKNGEFLSASLYT+WYVPN +N N E NIN N EKENEG FLEC+KSD  
Sbjct: 959  KKLRADYTCFDKNGEFLSASLYTTWYVPNSNNTNIEDNINYNSEKENEGLFLECIKSDYP 1018

Query: 1011 EIDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAAT 1070
            EID  TTYFVFDATSWLRHSARIFKLAQNRLL+FAICLTTFQELRFLRKSKDENVMEAAT
Sbjct: 1019 EIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAAT 1078

Query: 1071 RGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLE 1130
            RGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIES+MKAQEKLE
Sbjct: 1079 RGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLE 1138

Query: 1131 NANQLPVSSCRFNYVILISDDDTMKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD 1187
            +A++  +S  RFNYV+LISDDD MKKKAEEK+IKTLSTRFVFSLCTKLGEQRHLCTD
Sbjct: 1139 SASEPRLSPRRFNYVVLISDDDAMKKKAEEKEIKTLSTRFVFSLCTKLGEQRHLCTD 1195

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score = 1609 bits (4167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 799/939 (85%), Positives = 861/939 (91%)

Query: 249  EQEESNVYRPANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIY 308
            E EE +  R AN+K+SSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIY
Sbjct: 250  EAEEDDACRSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIY 309

Query: 309  RINTELVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSN 368
            RINTEL+NNYVTFITTALLPSQP HDL+IGQEIVEIYRIERRLWVYGTITFLDVLKNFSN
Sbjct: 310  RINTELINNYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSN 369

Query: 369  FMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAE 428
            FMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAE
Sbjct: 370  FMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAE 429

Query: 429  HWYTEAMKYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQ 488
            HWYTEAMKY+YNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQ
Sbjct: 430  HWYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQ 489

Query: 489  RAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFN 548
            RAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVV+SYFVEKFGIDANGCNIFN
Sbjct: 490  RAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFN 549

Query: 549  PEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERK 608
            PEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPK+LKERKDKKERK
Sbjct: 550  PEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERK 609

Query: 609  KSSNNESSITESSTSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLT 668
            KSSNN+SS+TESST NSRN+N+D+DEIMSST SIS+ D L EFFNDIDTLRRPI+ SMLT
Sbjct: 610  KSSNNDSSVTESSTGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPILPSMLT 669

Query: 669  NEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPIS 728
            +EAWLE+LKFLNMTSLKCGMIVLRKFLHGPLGIALPH LPWIYFII+ CLKS+QLSDP S
Sbjct: 670  SEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTS 729

Query: 729  KEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEK 788
            K+FW++IVKR+FPWDT+VTFMN+LIA +LDNE  +PIIG LC +Y  LNLA LL+ F E 
Sbjct: 730  KDFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNES 789

Query: 789  EELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGE 848
            EELPEIW CWGTLWFDTICQKN +SISSDD+F+E+GIKDYMALD+P DGIIFD  DE+GE
Sbjct: 790  EELPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGE 849

Query: 849  KFWKRACRTIFLFRELSRSFQIGVIINNESSINRSSLQSNNILGNLSYKLEPLSTLGSSI 908
            KFWKRACR IFLFRELSR+F IGVI++N+  I  SS QS+ IL NL YKLEPLS + S+ 
Sbjct: 850  KFWKRACRIIFLFRELSRTFPIGVIVSNDPLIKCSSSQSSIILRNLVYKLEPLSNIRSNT 909

Query: 909  PTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFL 968
            P L  LE  +D+ E RS+NNIDL+AVPELSV  G +IF+YTGYKKL P+YTCFD+NGEFL
Sbjct: 910  PILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFL 969

Query: 969  SASLYTSWYVPNGSNNPETNINSNCEKENEGQFLECLKSDDREIDLNTTYFVFDATSWLR 1028
            SASLYT WY+PNG+N  E  +NS+ EK +E  FLEC+K D   ID  TTYFVFDATSWLR
Sbjct: 970  SASLYTRWYLPNGNNISEALVNSDIEKGDEDLFLECMKPDCPGIDFETTYFVFDATSWLR 1029

Query: 1029 HSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPL 1088
            HSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYE+KVLPL
Sbjct: 1030 HSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYEDKVLPL 1089

Query: 1089 RFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSCRFNYVILI 1148
            RFTGNVATHIEENLEFEEQITWRTHVDEFVIESI KAQEKLENA Q  V+    NYV+LI
Sbjct: 1090 RFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENAGQPHVTPRHSNYVVLI 1149

Query: 1149 SDDDTMKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD 1187
            SDDDTMKKKAEEK+IKTLST+FVFSLCTKLGE+RHLCTD
Sbjct: 1150 SDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD 1188

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1162 bits (3005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 584/1005 (58%), Positives = 747/1005 (74%), Gaps = 42/1005 (4%)

Query: 202  DGADPNDLS-NSENNNNYNNNNNNNINNNNNNNTNNNNINNNEDDDNNEQEESNVYRPAN 260
            DG D   +S NS   N+ + +N+ N    ++NN N++  N N ++DN+   E+N     N
Sbjct: 166  DGQDTGTISINSGEVNDQSQDNSANDEGRDDNNENDSIRNKNSNNDNDNNRENNKDNNGN 225

Query: 261  -------NKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTE 313
                   +KKSS AL+QKLQ++YKVIVKQEIELQERCSQLTNSQTTELK LW IY++N++
Sbjct: 226  VPSVVVPSKKSSQALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSD 285

Query: 314  LVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPE 373
            L+NNYVTFITTALLP Q   DL IGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPE
Sbjct: 286  LINNYVTFITTALLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPE 345

Query: 374  VCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTE 433
            VC QFITHVF+S+S M++DIPS+Y+I W QRLGDLSRMAIALYPS FIDWKLSAEHWY E
Sbjct: 346  VCAQFITHVFISISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYME 405

Query: 434  AMKYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVE 493
            AMKY+Y HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQRAFVE
Sbjct: 406  AMKYIYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVE 465

Query: 494  RNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMF 553
            RNNGN RNS LIEYLKHSE MLLPSFLES DLQ VVL YF +KFG+D N  NIF+   MF
Sbjct: 466  RNNGNHRNSQLIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMF 525

Query: 554  IQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNN 613
             QNPD  KYFFRHAP+FA+SHILQ+VGFG+PKNPFA+LFELP+ LK+R+DKKE++K+ + 
Sbjct: 526  DQNPDQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRKTKS- 584

Query: 614  ESSITESSTSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWL 673
             S  TE+S++ + +E    +E + S+ S+  +  + +FF++ID+L  P +    + E W 
Sbjct: 585  -SVTTETSSAMAIDE----EEYIDSSFSLGAQ--VQQFFDNIDSLTSPYLFPP-SLEVWN 636

Query: 674  ESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWI 733
             SLK+LN+TSL C MIVL+KFL GP+ +ALPH LPW YFII++  K   ++D  S+EFW+
Sbjct: 637  CSLKYLNITSLHCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWL 696

Query: 734  VIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPE 793
             +V RIFPW+T+V F+N+LIA  LDN   S  I  LC+E S + L +L++ F   E+LPE
Sbjct: 697  ELVNRIFPWNTIVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPE 756

Query: 794  IWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKR 853
            +W CWG LWFD IC K+   +   D +E  GIKD+M LD PIDGI FD +DE+G KFWKR
Sbjct: 757  VWKCWGLLWFDAICDKDKVQM---DSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKR 813

Query: 854  ACRTIFLFRELSRSFQIGVIINNESSIN-RSSLQSNNILGNLSYKLEPLSTLGSSIPTLN 912
            ACR IFLF+ ++ +FQ  +++++++ ++ R +   N++L +  +KL       +S+    
Sbjct: 814  ACRVIFLFKRIAENFQTRLVVSSQAQVHCRRTDPMNHVLKSFCFKLRDTFYNSNSV---- 869

Query: 913  TLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASL 972
             L+  I+VFE  S+ N D+   P+LSV++  SIF Y GYK+L  + +C+D+ GEF+S SL
Sbjct: 870  -LQNTIEVFEEGSDANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSL 928

Query: 973  YTSWYVPNGSNNPETNINSNCEKENEGQ-FLECLKSDDREIDLN---------TTYFVFD 1022
            YTSW      N    +  +  +  NE   F+E + +   E +++          T+FV D
Sbjct: 929  YTSWGNETSKNEIPQSEPTQQQTANEADLFIEGINTSLTEFNIDFPECKMNGKDTFFVLD 988

Query: 1023 ATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYE 1082
            ATSWLRH A ++KLA N++L+FAICLTTFQELRFLRKSKDENV+EAATR +IT+RQLY E
Sbjct: 989  ATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTE 1048

Query: 1083 NKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSCRF 1142
            N++LPLRFTGNVATHIEE+LEFEEQITWR+HVDEFV E+I KAQ +L   N+       F
Sbjct: 1049 NRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQENR------DF 1102

Query: 1143 NYVILISDDDTMKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD 1187
            ++V+L++DD  M++KA++  I TLSTRFVF+ C  +G +  +CT+
Sbjct: 1103 HHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1144 bits (2959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/978 (59%), Positives = 721/978 (73%), Gaps = 66/978 (6%)

Query: 261  NKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVT 320
            +K+SS AL+QKLQ++YKVIVKQEIELQERCSQLT SQTTELK+LWTIY+IN++L+NNYVT
Sbjct: 410  SKRSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVT 469

Query: 321  FITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIT 380
            F+TTALLPSQ + D++IG+EIVEIYRIERRLWVYGTITFLD+ KNFSNFMDPEVCCQFIT
Sbjct: 470  FLTTALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCCQFIT 529

Query: 381  HVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYN 440
            HVF+S+S M+ DIP KY I WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+
Sbjct: 530  HVFISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 589

Query: 441  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLR 500
            HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TF PS QYMQLVIDNIYQRAFVERNNGN R
Sbjct: 590  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHR 649

Query: 501  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFF 560
            N+ LIEYLKHSE MLLPSFLES DLQ VVL YF  KFG D+N  NIF+   MF QNPD+ 
Sbjct: 650  NTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYL 709

Query: 561  KYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITES 620
            +YFFRHAP+FA+SHILQ+VGFG+PKNPFA+LFELP+ LK+RKDKKE++++ +   + T S
Sbjct: 710  RYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTKSTTVTETSS 769

Query: 621  STSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPI-VSSMLTNEAWLESLKFL 679
            + +    E++ +D  MS+            FF +I+TLR P  V S L  E W ESL ++
Sbjct: 770  TMAIDDLEDEQSDR-MSTPEG---------FFGNIETLRFPYSVPSNL--EIWNESLNYI 817

Query: 680  NMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRI 739
            NMTSLKC M+VL+KFL GPL +ALPHF+PW YFIIS+  K   L+   S++FW+  V RI
Sbjct: 818  NMTSLKCSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRI 877

Query: 740  FPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWG 799
            FPW+T+V+F+N+LIA +LDN   S ++ SLC +YS + L +LLD F   E LPE+W CWG
Sbjct: 878  FPWNTIVSFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWG 937

Query: 800  TLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIF 859
            TLWFDTIC K  + +   +D E VGIK++M LD+PIDGI FD NDE+GE FWKRACR IF
Sbjct: 938  TLWFDTICNKEQSHV---EDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIF 994

Query: 860  LFRELSRSFQIGVIINNESSI--NRSSLQSNNILGNLSYKLE-----PLSTLGSSIPT-- 910
            LF+ L+ +F IG+ ++  + +   R+ +   +IL + S+KL       L  +    P+  
Sbjct: 995  LFKGLAENFPIGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTT 1054

Query: 911  ---LNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEF 967
               L+ L+  +++FE  S  NI +  +P LSVI+G SIF+Y GY++L P+Y  +DKNGEF
Sbjct: 1055 AIDLDHLKNTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEF 1114

Query: 968  LSASLYTSWYVPNGSNNP---------------------ETNI-NSNCEKENEGQFLECL 1005
            LSASLYTSWY  N +NN                      E +I N   E    G F + L
Sbjct: 1115 LSASLYTSWYANNNTNNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDL 1174

Query: 1006 KSDD---REIDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKD 1062
               D   +    +TTYFV D T+WLRH   I+KLA + +LKFAICLTTF ELRFLRK KD
Sbjct: 1175 FLRDALYQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKD 1234

Query: 1063 ENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESI 1122
            ENV+EAATR IIT+RQLY E K+LPLRFTGNVATHIEE+LEFEE+ITWR+HVDEFVIE++
Sbjct: 1235 ENVVEAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAV 1294

Query: 1123 MKAQEKLENANQLPVSS-------------CRFNYVILISDDDTMKKKAEEKKIKTLSTR 1169
             KAQ K +  NQL +                   +V+L++DD  M+KKA+++ ++T ST+
Sbjct: 1295 YKAQSKFQEMNQLQLEQEEQQHQLRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTK 1354

Query: 1170 FVFSLCTKLGEQRHLCTD 1187
            FVFSLC  +G +  +CT+
Sbjct: 1355 FVFSLCNSIGLRSKICTN 1372

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score = 1110 bits (2870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/974 (57%), Positives = 705/974 (72%), Gaps = 58/974 (5%)

Query: 262  KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTF 321
            KK+S  LI+KLQ +YK+IVKQE+ELQ+RCSQLT SQTTELK+LW+IY++NT+L+NNY+TF
Sbjct: 278  KKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITF 337

Query: 322  ITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 381
            ITTALLPSQ   D+ IG+EIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFITH
Sbjct: 338  ITTALLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 397

Query: 382  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNH 441
            VF+SLSTM+ D+P K+SI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+H
Sbjct: 398  VFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 457

Query: 442  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN-NGNLR 500
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQR FV+RN NGN+R
Sbjct: 458  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVR 517

Query: 501  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFF 560
            NS LI+YLKHSE MLLPSFLE+ DLQ VVL+YF ++FG+D N  NIF  +DMF Q P   
Sbjct: 518  NSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPASL 577

Query: 561  KYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITES 620
            +++FRHAP+FA+SHILQ+VGFG PKNPFA+LF+LP  LKERKDKKE+ KS     S TE 
Sbjct: 578  RFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKS----KSSTEI 633

Query: 621  STSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKFLN 680
            ST  S + ND    I++++  ++E + + E+F++ID+LR PI    +    WL+SL+ LN
Sbjct: 634  STM-SIDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHPNIL--VWLKSLEHLN 690

Query: 681  MTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIF 740
            MTSLKC +IVLRKFL GPL IALPH LPW YFII+  LK+    +  S +FW ++++RI 
Sbjct: 691  MTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRIL 750

Query: 741  PWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDL-NLAELLDVFKEKEELPEIWGCWG 799
            PW+T+ +F+N+L+A +LDN   +  I  LC+ YS+  N  ELLD F   E LPEIW CWG
Sbjct: 751  PWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWG 810

Query: 800  TLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIF 859
            TLWFD I  K      + D F  +GI+D+M LD P+DGI FD  DE GE FW RA R +F
Sbjct: 811  TLWFDVISNKRA---LNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVF 867

Query: 860  LFRELSRSFQIGVIINNESSIN--RSSLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEGI 917
            LF+ ++ + Q G+ ++  + ++  R  +  N+IL + S+K+E       S    +T+  +
Sbjct: 868  LFKGIAENLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTINKL 927

Query: 918  IDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWY 977
            + +FE   E N+D  A P LSV+KG +IF Y GYKKL  N   FD+NGE +S+S+YT+W 
Sbjct: 928  LPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWV 987

Query: 978  V-----------------------------PNGSNNPETNINSNCEKENEGQF------- 1001
            +                             P   N    N  SN + E++  F       
Sbjct: 988  IDNDNSLNNSQGNQYTSNMQMTQQQRQLLPPEQQNFQMRNFASNEDTEDDFNFELYMNPE 1047

Query: 1002 --------LECLKSDDREIDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQE 1053
                         + + EI+ N TYFVFDATSWLRH A I+KL+ N +L FA+CLTTFQE
Sbjct: 1048 KLNKNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQE 1107

Query: 1054 LRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTH 1113
            LRFLRKSKDENV+ AA R IIT+RQLY E K+LPLRFTGNVAT IEE+LEFEEQITWR+H
Sbjct: 1108 LRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSH 1167

Query: 1114 VDEFVIESIMKAQEKLENANQLPVSSCRFNYVILISDDDTMKKKAEEKKIKTLSTRFVFS 1173
            VDEFVIE+++KAQ K  +AN+       FN+V+L++DD  MK+KA+E+ IKT +T F+FS
Sbjct: 1168 VDEFVIEAVVKAQNKFISANESVTLRKGFNHVVLVTDDINMKRKAQEQGIKTFTTHFIFS 1227

Query: 1174 LCTKLGEQRHLCTD 1187
            +C KLG Q ++CT+
Sbjct: 1228 VCRKLGIQDNVCTN 1241

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score = 1079 bits (2790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/1027 (54%), Positives = 732/1027 (71%), Gaps = 69/1027 (6%)

Query: 197  NEDGDDGADPNDLSNSENNNNYNNNNNNNINNNNNNNTNNNNINNNEDDDNNEQEESNVY 256
            N D DDG  PN+  +  N  N ++ +  + N   NN  + ++   +ED  NN    SN  
Sbjct: 302  NIDDDDGQYPNEPEDCSNEFNNDDTDTTDTNQRKNNEESKDDEEEDEDQGNN----SNSN 357

Query: 257  RPANNK-KSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELV 315
              ANN  K + AL+QKLQ++YK IV+QE+ELQE+C+QLT+SQTT+L S+W+IYRIN ELV
Sbjct: 358  DKANNSNKPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELV 417

Query: 316  NNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVC 375
             NYVTFI+TALL SQ Q+DL+IGQEIVE YRI RRLWVYGTITFLDVLKNFS+FMDPEVC
Sbjct: 418  TNYVTFISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVC 477

Query: 376  CQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAM 435
             QFITHVF+S+STM++DIP+KYSI W+QRLGDLSRMAIALYPS FIDWKLS+E+WY +A+
Sbjct: 478  SQFITHVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQAL 537

Query: 436  KYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN 495
            KY Y +GKLYYHMST+QQNTLEAFVNLGKSVFCQ+TF PSPQYMQLVIDNIYQRAF+ER 
Sbjct: 538  KYTYGYGKLYYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERG 597

Query: 496  NGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQ 555
            + N RNS LIEYLKHSE MLLP+F+ + +LQ VV++YF  KFG D +  NIF P D+F+Q
Sbjct: 598  SNNTRNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQ 657

Query: 556  NPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNES 615
            NP+  KYFFRHAP+FA+SHILQ VGFG+ KNPFA+LF+LP             K    + 
Sbjct: 658  NPENLKYFFRHAPAFAESHILQTVGFGDSKNPFALLFDLP-------------KFLKEKK 704

Query: 616  SITESSTSNSRNENDDNDEIMS----STTSISERDSLIEFFNDIDTLRRPIVSSMLTNEA 671
               +   + S  E   N+ +MS    ST S+   D   ++F+++++++ P +      + 
Sbjct: 705  DKKDRKKTKSSGEPTSNESVMSLDNISTDSLISSD---QYFSNLESMQHPYLPPP-RYDI 760

Query: 672  WLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEF 731
            WL+SL +LN+T+++CG+IVLRKFLHGP  +ALPH + W YFIIS+CLKS  L D  S+ F
Sbjct: 761  WLKSLSYLNLTAVQCGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYF 820

Query: 732  WIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEEL 791
            W   ++R+ P +++V+F+N+LIA  LDN   S +I S+ +E   ++L ELL  F   EEL
Sbjct: 821  WSSFMRRLLPLNSIVSFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEEL 880

Query: 792  PEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFW 851
            PE+W CWGTLWFD I  K+    +S   +E++G+ D++  DSPIDGI+FD  DENGEKFW
Sbjct: 881  PEVWKCWGTLWFDAITDKSNTDTNS---YEKIGVSDHLFFDSPIDGIVFDSKDENGEKFW 937

Query: 852  KRACRTIFLFRELSRSFQIGVIINNESSI--NRSSLQSNNILGNLSYKLEPLSTLGSSIP 909
            KRA R IFLF++++ +F IG+ +++ + +   R  ++ N+ILG+ S+K+E     G+++ 
Sbjct: 938  KRALRIIFLFKKIAETFDIGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQ 997

Query: 910  T--LNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEF 967
                N L  II++ E  +E NI + A P +S+ +  +IF YTGYK++ P    FDKNGE 
Sbjct: 998  VEIENCLGAIIEMTEMPNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGEL 1057

Query: 968  LSASLYTSWY-----VPNGSNNPETNINSNC--------------------EKENEGQFL 1002
             SA+ YTSWY     VP  + +PE ++  +                     E+EN    L
Sbjct: 1058 RSAANYTSWYSAQEIVPKSAASPENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLL 1117

Query: 1003 ECLKSDDREIDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKD 1062
            + L       +L TT FV DATSWLRHSA I+KLA N  L F+ICLTTFQELRFLRKSKD
Sbjct: 1118 DGL-------NLETTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKD 1170

Query: 1063 ENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESI 1122
            ENVMEAA R II IRQLY + KV+PLRFTGN+ATHIEE+LEFEEQITWR+HVDEFVIESI
Sbjct: 1171 ENVMEAAARAIIIIRQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESI 1230

Query: 1123 MKAQEK-LENANQLPV-SSCRFNYVILISDDDTMKKKAEEKKIKTLSTRFVFSLCTKLGE 1180
             KAQ+K L+   Q PV +  RF   +L+SDD+ MK+KA EK+I+T +TRFVF+LC+++G+
Sbjct: 1231 SKAQKKFLQPFVQNPVDNDSRF--FVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGK 1288

Query: 1181 QRHLCTD 1187
             R +CT+
Sbjct: 1289 GRLICTN 1295

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score = 1046 bits (2704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/1059 (51%), Positives = 727/1059 (68%), Gaps = 94/1059 (8%)

Query: 184  NFQHKETESDDIHNEDGDDGADPNDLSNSENNNNYNNNNNNNINNNNNNNTNNNNINNNE 243
            N + KE+ +D++    G D       SN+  + N  ++ +N++   ++  +         
Sbjct: 173  NGEQKESITDELQ---GTDNTPHEQSSNTHADTNQQSDQHNSVQQGSSGGS--------- 220

Query: 244  DDDNNEQEESNVYRPANN---KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTE 300
            DD  N +E S +  P  N   K +S AL+QKLQ++Y+ IVKQEIELQERCSQLTNSQTT+
Sbjct: 221  DDGENNRENSGI--PIVNVPPKHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTD 278

Query: 301  LKSLWTIYRINTELVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFL 360
            +K+LW IY++N EL+NNY++FITTALLPSQP+ DL+IGQEIVEIYR+ERRLWVYGTITFL
Sbjct: 279  MKNLWVIYKVNAELINNYISFITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFL 338

Query: 361  DVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSF 420
            DVLKNFSNFMDPEVCCQFI+HVF+S+S M+ D+P +YSI WL+RLGDLSRMAIALYPS F
Sbjct: 339  DVLKNFSNFMDPEVCCQFISHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGF 398

Query: 421  IDWKLSAEHWYTEAMKYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQ 480
            IDWKLSAEHWY++A+ Y Y HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TF PS QYMQ
Sbjct: 399  IDWKLSAEHWYSQALIYTYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQ 458

Query: 481  LVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGID 540
            LVIDNIYQRAF ER+ G+ RN  ++EYLKHSE MLLPSFLESP+LQ VVL++F ++FG+ 
Sbjct: 459  LVIDNIYQRAFAERSGGSSRNFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVW 518

Query: 541  ANGCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKE 600
             N  + F+ + +FIQ+ +  +YFF HAP+FA+SHILQ+VGFG+P+NPFAILFELPK LKE
Sbjct: 519  PNNVDFFDHKQIFIQDGEKLRYFFSHAPAFAESHILQLVGFGDPRNPFAILFELPKFLKE 578

Query: 601  RKDKKERKKSSNNESSITESSTSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRR 660
            RK++KER++S ++    T        N +D N    SS+ S+        +F +ID+ R 
Sbjct: 579  RKERKERRRSKSSPPLPT--------NLDDGNG---SSSISVD------HYFENIDSHRV 621

Query: 661  PIVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKS 720
            P  S     + W +SL +LN+TS++C M VL+KFLH PL  ALPH LPW +F++S+ ++ 
Sbjct: 622  P-YSFPQDIQIWQQSLSYLNLTSMECSMSVLKKFLHAPLLTALPHLLPWAHFLVSVAIRI 680

Query: 721  SQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAE 780
            S LS    K+FW+V ++RIFPW+++V+F+N L+A +LDN      +  LC+EY+ ++L  
Sbjct: 681  SSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHT 740

Query: 781  LLDVFKEKEELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIF 840
            L++ F   EELPE+W CWGTLWFDTI  K+    SS    +  GI+D++ LD+PIDGI F
Sbjct: 741  LVEHFTNSEELPEVWKCWGTLWFDTISNKSELKASS---VQSTGIRDHLFLDAPIDGICF 797

Query: 841  DVNDENGEKFWKRACRTIFLFRELSRSFQIGVIINNESSINRSSLQSNNILGNLSYKLEP 900
            D +DE+G KFWKRACR IF+F+ +++ F  G+ +++     R  + + + L   S+K E 
Sbjct: 798  DQDDESGLKFWKRACRVIFMFKGMAKEFHYGIRVSDTPISTRRDVTTLHALKRFSFKFEE 857

Query: 901  LSTLGSSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTC 960
            L     +   L + +  I VFE  S  N +  AVP LS+I G SIF + GY+++ P+Y C
Sbjct: 858  LPQEWDNEVFLQS-DNFIKVFEPISPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYC 916

Query: 961  FDKNGEFLSASLYTSW-----------------YVPNG-------------SNNPETNIN 990
            F+KNG+ ++ SLYTS                  +V NG                PET + 
Sbjct: 917  FNKNGDLITGSLYTSGLLERVAIQGGDDFNVKRHVENGVLLAAHNSPVDCNERTPETMVE 976

Query: 991  SNCEKE----NEGQFLECLKSDDR--------EIDLNTTYFVFDATSWLRHSARIFKLAQ 1038
                K      +  F+E L+ D R          D N TYFV DATSWLRH A ++KLA 
Sbjct: 977  YAERKWLNMCMDPAFMESLR-DSRFPHGDLACNADSNVTYFVLDATSWLRHFAHVYKLAT 1035

Query: 1039 NRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHI 1098
            N +LKFAICLTTFQELRFLRKSKDE+V+EAATR +IT RQLYYE K+LPLRFTGN+ATH+
Sbjct: 1036 NNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQLYYERKLLPLRFTGNIATHL 1095

Query: 1099 EENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQL------------PVSSCRFNYVI 1146
            EE+LEFEEQITWR+HVDEFVIE++ K+Q K +  N              P    +FN+V+
Sbjct: 1096 EEHLEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNLQARDQGQEYIPTDPKDDDKFNFVV 1155

Query: 1147 LISDDDTMKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLC 1185
            L++DD  M+ KAE   I   S+RF+F+ C +LG  + +C
Sbjct: 1156 LVTDDLNMRTKAEAHDIHIFSSRFMFAFCNQLGYNQKVC 1194

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score = 1039 bits (2687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/959 (55%), Positives = 670/959 (69%), Gaps = 65/959 (6%)

Query: 262  KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTF 321
            +KSS AL+QKLQ++YK+I+KQE+ELQERCSQLTNSQTTE+K+LW IY++N +L+NNYVTF
Sbjct: 312  RKSSQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTF 371

Query: 322  ITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 381
            ITTAL PSQ + DL+IG+EIV+IY+IERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH
Sbjct: 372  ITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 431

Query: 382  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNH 441
            VF+S+S+M+ DIP KY+I WLQ+LGDLSRMA+AL+PS FIDWKLSAE WY  AM+Y Y +
Sbjct: 432  VFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGY 491

Query: 442  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN-NGNLR 500
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ TF PS QY+QLVIDNIYQRAF +RN + N R
Sbjct: 492  GKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSR 551

Query: 501  N-SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNI--FNPEDMFIQNP 557
            N  LL++YLKHSE MLLP+F+ESPDLQ VVL YF+EKFGID N  N+  F P  MFIQN 
Sbjct: 552  NCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNN 611

Query: 558  DFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSI 617
            D  K++FRHA +FA++ ILQ+VG+G PKNPFA+LF LPK+LKER+DKKE++K  N     
Sbjct: 612  DQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKRKPKNQIVGE 671

Query: 618  TESSTSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEA--WLES 675
              SST+ S     +    M +   +   D    FFN+ID L    +++ + N    W +S
Sbjct: 672  DGSSTTFSSVSGMEYMVNMETNVFLGSED----FFNNIDKLA---INNFMPNSISLWNDS 724

Query: 676  LKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVI 735
            LK+ N T+ KC MIVL+KFL+GPL +ALPH LPW+YF+ISI L+  +  D    EFW   
Sbjct: 725  LKYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAF 784

Query: 736  VKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIW 795
            +KRIFPW++MV F+N+L+A ++DN   +  +  LCD+Y  LNL ELL  F   E+LPE+W
Sbjct: 785  IKRIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVW 844

Query: 796  GCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRAC 855
             C G+LWFD I +K  +   + D + E GIKDY  LD P+DGI FD NDE G KFWKR+ 
Sbjct: 845  KCRGSLWFDIIDEKRNS--QNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSV 902

Query: 856  RTIFLFRELSRSFQ-IG--VIINNESSINRSSLQSNNILGNLSYKLEPLSTLGSSIPTLN 912
            R IFLFR +   F   G   I  N   INR  L  N+ L   S+KL   S        + 
Sbjct: 903  RVIFLFRGIVERFNGFGNLAISYNAPVINRRGLGVNSHLVGYSFKLMAKSD------DIM 956

Query: 913  TLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASL 972
              + ++  FE    NN D +A+P LS+I G +IF Y GYK++  +Y  FDKNG+ +S S 
Sbjct: 957  FDDMLVSNFEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSF 1016

Query: 973  YTSWYVPNGSNNPETNINSN-------------CEKENEGQ-FLECLKSDDREID----- 1013
            Y +W +     N +T +N                +  NE + F +C   +   +D     
Sbjct: 1017 YNTWSI-----NQDTGVNGGPLSNNSSSSNAASSDPMNEKELFNKCFDPEYDSVDEFWNK 1071

Query: 1014 --------------LNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRK 1059
                             TYF+ DATSWLRH A ++K+A N +LKF+ICLTTFQELRFLRK
Sbjct: 1072 EIYDDIGRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRK 1131

Query: 1060 SKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVI 1119
            SKDENV+EAATR IIT+RQL+ E K+LPLRFTGNVATHIEE+LEFEEQITWR+HVDEFVI
Sbjct: 1132 SKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVI 1191

Query: 1120 ESIMKAQEKLENANQLPVSSCRFNYVILISDDDTMKKKAEEKKIKTLSTRFVFSLCTKL 1178
            E+++KA+ K +      +   +   ++L++DD  MK KA EK  KT STRFVF++   L
Sbjct: 1192 EAVIKAETKRKEQEMHNMKGFQ---IVLVTDDSNMKNKALEKGSKTFSTRFVFAISNYL 1247

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score = 1035 bits (2676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/1041 (54%), Positives = 694/1041 (66%), Gaps = 130/1041 (12%)

Query: 262  KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTF 321
            KK+  AL++KLQ++YKVIVKQEIELQERCSQLT SQTT+LK+LWTIY++N +L+NNYVTF
Sbjct: 294  KKTGEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTF 353

Query: 322  ITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 381
            ITTALL SQ Q DL IG+EI+EIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH
Sbjct: 354  ITTALLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 413

Query: 382  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNH 441
            VF+SLSTM++DIP+KYSI WLQRLGDLSRMAIALYPS FIDWKLSAE WY EAMK+ YNH
Sbjct: 414  VFISLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNH 473

Query: 442  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 501
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNGN RN
Sbjct: 474  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRN 533

Query: 502  SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGI-------------------DAN 542
              LIEYLKHSE MLLP+FLE+ +LQ VVL YF EKFGI                   +  
Sbjct: 534  LQLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTR 593

Query: 543  GCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKER- 601
              ++F   DMFIQNP+  KYFFRHAP+FA+SHILQ+VGFG+PKNPFA+LFELPK+LKER 
Sbjct: 594  TIDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERK 653

Query: 602  ------------KDKKERKKSSNNESSITESSTSNSRNENDD-----NDEIMSSTTSISE 644
                                S+  + S+   S  NS    DD     +D +M+  TS   
Sbjct: 654  DKKEKKKSKSNSNSNNNNNASTAGDGSMM--SIDNSEMGEDDINNLFSDNVMNQVTS--- 708

Query: 645  RDSLIEFFNDIDTLRRP--IVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIA 702
                 EFF +I+ LR    I +S+   E W+ SL  +N+ SLKC MIVL+KFLHGPL IA
Sbjct: 709  ----EEFFQNIEQLRFDYFIPNSL---EIWMASLNHINLISLKCSMIVLKKFLHGPLLIA 761

Query: 703  LPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDN-EM 761
            LPH LPW YFIISI LK   L+   SK FWI I+K IFPW+ ++ F+N+L+   LDN  +
Sbjct: 762  LPHLLPWCYFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGL 821

Query: 762  TSP-------------IIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWGTLWFDTICQ 808
             +P              I  LC++YS +  A+LL  F E E+LPE+W CWGTLWFDTI  
Sbjct: 822  PTPSAVNDTKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISN 881

Query: 809  KNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFLFRELSRSF 868
            KN       D FE +GIKD+M LD PIDGI + + DE GE FWKR  R IFLF+ ++ +F
Sbjct: 882  KNG---MDADSFENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENF 938

Query: 869  Q---IGVIINNESSINRSSLQSNNILGNLSYKLEPL------STLGSSI-----PTLNTL 914
                + V  N  +    +++  +NIL   S+K          + LG  +       +N +
Sbjct: 939  DSLGLKVSYNAGTEYRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRI 998

Query: 915  EGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYT 974
               +D+ E   E N++    P  S+I    IF+YTGYKKL PN   FDKNGEF S S+YT
Sbjct: 999  TEFVDIKEPIHETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYT 1058

Query: 975  SWYV-------------PNGSNNPETNINSNCEKENEGQFLECLKSDDRE---------- 1011
            +W +                + +  T++ +     +E  F +  + + R+          
Sbjct: 1059 AWPMDYDQLILAQNNNNNTNATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTST 1118

Query: 1012 --IDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAA 1069
               +   TYFVFDATSWLRH A I+KLA N +LKFA+CLTTFQELRFLRKSKD NV+EA+
Sbjct: 1119 EPFNRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEAS 1178

Query: 1070 TRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEK- 1128
            TR IIT+RQLY +  +LPLRFTGNVAT IEE+LEFEEQITWR+HVDEFVIE++MKAQEK 
Sbjct: 1179 TRAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKF 1238

Query: 1129 -----LEN-----------ANQLPVS------SCRFNYVILISDDDTMKKKAEEKKIKTL 1166
                 +EN           A    VS      S  F YV+LI+DDD+M+ KA+ K I T 
Sbjct: 1239 VKSKTVENMEGTSNWGEIDATTTTVSAEEEEKSNLFKYVVLITDDDSMRMKAQLKGISTF 1298

Query: 1167 STRFVFSLCTKLGEQRHLCTD 1187
             T+ VFS+C+ +G    +CT+
Sbjct: 1299 GTQVVFSVCSMMGIDEGVCTN 1319

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score = 1007 bits (2604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/1114 (49%), Positives = 727/1114 (65%), Gaps = 119/1114 (10%)

Query: 124  NSVEVTRSSPLISKPASHNGKHIAYDKHTTGSNSLLNMSKSSLAYVEAEPDGQSSNEIIE 183
            +SV  TR+     +P SH  + ++  +H T  NS+   S S+       P G        
Sbjct: 134  HSVRYTRTEQGNVRPQSH--ESLSNHQHHTLPNSIQGGSSSA-----GLPTG-------- 178

Query: 184  NFQHKETESDDIHNEDGDDGADPNDLSNSENNNNYNNNNNNNINNNNNNNTNNNNINNNE 243
                         ++D  +G+ P + S S  +  ++N  +    N++  + NN+  NNN 
Sbjct: 179  -------------DQDFREGSTPENSSRSSRHGPHDNQESKGYANSDERSNNNHENNNN- 224

Query: 244  DDDNNEQEESNVYRPANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKS 303
                N  E S    P+++  S  AL+QKLQ++Y+ IVKQE+ELQERC+QLT SQTT+LK+
Sbjct: 225  ----NPNENSQAVSPSSSPTSQ-ALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKN 279

Query: 304  LWTIYRINTELVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVL 363
            LW IY+IN EL+NNYV FITTALLPSQP+ DL+IGQEIV IYRIERRLWV+GTITFLDVL
Sbjct: 280  LWIIYKINIELINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVL 339

Query: 364  KNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDW 423
            KNFSNFMDPEVCCQFITHVF+S+STM+ D+P K+S  W +RLGDLSRMAIALYPS FIDW
Sbjct: 340  KNFSNFMDPEVCCQFITHVFISISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDW 399

Query: 424  KLSAEHWYTEAMKYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVI 483
            KLSAEHWY++A+ +++ HGKLYYHMSTVQQNTLEAFVNLGKSVFC++TF PSPQYMQLVI
Sbjct: 400  KLSAEHWYSQALSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVI 459

Query: 484  DNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANG 543
            DNIYQRAF ERN GN RNSL++EYLKHSE MLL SFLESP+LQ VVLS+F  KFG+  + 
Sbjct: 460  DNIYQRAFAERNGGNHRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSN 519

Query: 544  CNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKD 603
             + FNP DMF+Q+ +  KYFFRHAP+FA+SHILQ VGFG+PKNPFA+LFELPK LKERK+
Sbjct: 520  TDFFNPRDMFLQDGERVKYFFRHAPAFAESHILQTVGFGDPKNPFALLFELPKFLKERKE 579

Query: 604  KKERKKSSNNESSITESSTSNSRNENDDNDEIMSSTTSISERDS---LIEFFNDIDTLRR 660
            +KER+KS ++ S  +  +TS+           +S +  +   DS     EF  D+     
Sbjct: 580  RKERRKSKSSHSFTSIETTSH-----------LSPSEYLENVDSPRYAYEFPEDL----- 623

Query: 661  PIVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKS 720
                       W ESL  +N+TS +C  IV +KFL GPL +A+ H LPW YF++S+ LK 
Sbjct: 624  ---------AIWRESLSHINITSARCSSIVFQKFLRGPLVVAVTHMLPWSYFLLSLALKI 674

Query: 721  SQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAE 780
              L     K FWI +V++IFPW+++V F+N+L+A VLDN   +  I +LC++   ++   
Sbjct: 675  DSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDNNWKTSPIDTLCEQLDSVDARS 734

Query: 781  LLDVFKEKEELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIF 840
            L++ F E E+LPEIW CWG LWFD I  K+      D D    G KD+   D P DGI F
Sbjct: 735  LVEHFSEHEDLPEIWRCWGALWFDVIADKSNG---EDGDVINSGSKDHPFWDLPGDGICF 791

Query: 841  DVNDENGEKFWKRACRTIFLFRELSRSFQIGVIINNESSINRSSLQSNNILGNLSYKLEP 900
            D +DE GEKFWKRACR IF+F+ +++ F +G+ ++  +  +R  + + + L N S+  E 
Sbjct: 792  DEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLSAFAPQSRRPMTAGHPLQNFSFNFE- 850

Query: 901  LSTLGSSIPTLNTLEGI----IDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCP 956
                   IP  + ++      I +FE  +  N+D +  P  S+++G SIF++ GY+++  
Sbjct: 851  ------EIPAQSQIQSFVRNQIPLFEEIATGNLDPNIRPGQSMLEGESIFDFPGYRQMYA 904

Query: 957  NYTCFDKNGEFLSASLYTSWYVPNG------------------SNNPETNINSNCEKENE 998
            +YTCF+K+G  +S SLYTS  +  G                  SN PE    +  E+   
Sbjct: 905  DYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNTERYGRSEDSNKPENAQITELERLER 964

Query: 999  GQFLECLKSDDRE---------------IDLNTTYFVFDATSWLRHSARIFKLAQNRLLK 1043
                 C+  +  E                D   +YFV DATSWLRH A +FKLA N +L+
Sbjct: 965  DWLDNCMNPEFIEQAYEMKFPFGDLSCNCDSGVSYFVLDATSWLRHFAHVFKLATNNVLR 1024

Query: 1044 FAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLE 1103
            F ICLTTFQELRFLRKSKDE+V+EAATR +IT+RQLY + K+LPLRFTGNVATH+EE+LE
Sbjct: 1025 FGICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHLEEHLE 1084

Query: 1104 FEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSCR----------FNYVILISDDDT 1153
            FEEQITWR+HVDEFVIE++ KAQ+K E  N     +            F++V L+SDD  
Sbjct: 1085 FEEQITWRSHVDEFVIEAVYKAQKKFEAINAQAKEAGHDFIATTDEEPFHFVALVSDDTN 1144

Query: 1154 MKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD 1187
            M+ KA  ++I+T STRF+F++C ++G     CT+
Sbjct: 1145 MRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN 1178

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score =  998 bits (2580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/971 (52%), Positives = 681/971 (70%), Gaps = 73/971 (7%)

Query: 261  NKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVT 320
            + ++S AL+QKLQ++Y+ IVKQE+ELQERCSQLT+SQTT+LK+LW IY++NTEL+NNYV 
Sbjct: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266

Query: 321  FITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIT 380
            FITTALLPSQP+ DL+IGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQFIT
Sbjct: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326

Query: 381  HVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYN 440
            HVF+S+S M+ D+P K++  WL+RLGDLSRMAIALYPS FIDWKLSAEHWYT+A+ +++ 
Sbjct: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386

Query: 441  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLR 500
            HGKLYYHMSTVQQNTLEAFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN GN R
Sbjct: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQR 446

Query: 501  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFF 560
            NSL++EYLKHSE MLL SFLESP+LQ VVLS+F  KFGI +N  + F+ + +F+Q+ +  
Sbjct: 447  NSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERT 506

Query: 561  KYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITES 620
            KYFFRHAP+FA+SHILQ+VGFG PKNPFA+LFELPK LKERK++KER+KS ++ S  +  
Sbjct: 507  KYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSFTSME 566

Query: 621  STSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEA-WLESLKFL 679
            + S +                     S IE+   +D+ R   V    T+ A W +SL  +
Sbjct: 567  APSPT---------------------SPIEYLESVDSPR--FVYEFPTDLAIWQQSLSHI 603

Query: 680  NMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRI 739
            N TS+KC  +VL+KFLHGPL  A  H LPW YF++S+ ++  +L  P  K+FWI + +++
Sbjct: 604  NTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQV 663

Query: 740  FPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWG 799
            FPW+++V F+N++IA  LDN   +  I +LC+++  +++  L+D F + E+LPE+W CWG
Sbjct: 664  FPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWG 723

Query: 800  TLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIF 859
             LWFD I  K   S   D+      ++D+M  D P+DGI FD +DE G +FWKRACR +F
Sbjct: 724  ALWFDVISDK---SDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVF 780

Query: 860  LFRELSRSFQIGVIINNESSINRSSLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEGIID 919
            +F+ +++ F +G+ + +    +R SL + + L N  +K E       S   ++T    + 
Sbjct: 781  IFKGIAQEFNMGLTLASVPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALISTQ---MP 837

Query: 920  VFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWYVP 979
             FE  SE N+D +A P  S+++G S+F   GY++L  ++TCF+K G  ++ SLYTS  + 
Sbjct: 838  AFENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLE 897

Query: 980  NGSNNPETNINSN-------CEKENEGQFLE-----------CLKSDDRE---------- 1011
             G  +   + N+          K +  Q  E           C+  +  E          
Sbjct: 898  KGPIHGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFG 957

Query: 1012 -----IDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVM 1066
                  D   +YFV DATSWLRH A ++KLA N +L+FAICLTTFQELRFLRKSKDE+V+
Sbjct: 958  DLSCNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVV 1017

Query: 1067 EAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQ 1126
            EAATR +IT+RQLY E ++LPLRFTGNVATH+EE+LEFEEQITWR+HVDEFVIE++ KAQ
Sbjct: 1018 EAATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQ 1077

Query: 1127 EKLENANQ---------LPVSSCR-FNYVILISDDDTMKKKAEEKKIKTLSTRFVFSLCT 1176
             K E  N          +P +    F+++ L+SDD  M+ KA  ++I+T S+RF+F++C 
Sbjct: 1078 NKFEALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCN 1137

Query: 1177 KLGEQRHLCTD 1187
            ++G   H CT+
Sbjct: 1138 QIGLAHHACTN 1148

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score =  984 bits (2545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/973 (51%), Positives = 668/973 (68%), Gaps = 81/973 (8%)

Query: 262  KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTF 321
            K+SS AL++KLQE+Y+ IV+QE ELQ+RCSQLT SQTT+LK+LW IY++N EL++NY  F
Sbjct: 279  KQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFMF 338

Query: 322  ITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 381
            ITTALLP+QP+ DL+IG+EI+E+YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +
Sbjct: 339  ITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIIY 398

Query: 382  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNH 441
            VF+S+S M+ DIP K+SI WL+RLGDLSRMAIALYPS FIDWKLSAEHWY EA+KY + H
Sbjct: 399  VFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFGH 458

Query: 442  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 501
            GKLYYHMSTVQQNTL AFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN+G+ RN
Sbjct: 459  GKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRN 518

Query: 502  SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFFK 561
            + L+EYLKH+E MLLPSFLES +LQ+VVL++F +KFG+ +N  + F+P  +F+Q+ +  K
Sbjct: 519  AHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSN-VDFFDPRLVFVQDSERLK 577

Query: 562  YFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITESS 621
            +FFRHA  +A+SH+LQ+VGFG+P+NPFA+LFELPKHLKERKD++E++KS        +SS
Sbjct: 578  HFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLKERKDRREKRKS--------KSS 629

Query: 622  TSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKFLNM 681
            TS   + + D+D   ++ +         EFF  ID+ +  I         W ESL + N+
Sbjct: 630  TSTQYDTSIDDDCAFAAPS---------EFFETIDSTKY-IYKFPDDINIWKESLSYANV 679

Query: 682  TSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIFP 741
            T++KC MIVLRKFLHGPL  ALPH LPW YF+ +   +   +     + FW+ +V+++FP
Sbjct: 680  TAMKCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFP 739

Query: 742  WDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWGTL 801
            ++T++TF+N+L+  + +    +       +++ D++LA+L+  F E EELPE+W CWGTL
Sbjct: 740  FNTIITFLNVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTL 799

Query: 802  WFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFLF 861
            WFD +   NT  I++  D    G+KD+M +DSPIDGI FD NDE+GEKFWKR  R I LF
Sbjct: 800  WFDAL---NTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLF 856

Query: 862  RELSRSFQIGVIINNESSINRSSLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEGIIDVF 921
            R L+    +G+    E S  R+         +L +K E   +    +  L     + D F
Sbjct: 857  RALALECPVGL---REISGGRN-------WRSLVFKFEEPPSEWCDM-YLEPFTLVFDTF 905

Query: 922  ETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWYVPNG 981
            E  S  N+D  A P   +     I    GY+ L P+Y CF++NG+ ++ SLYT   + + 
Sbjct: 906  EQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESS 965

Query: 982  SNNPETNINSNCEKENEGQFLECLKSD-----DRE------------------------- 1011
              +   + N     EN G+ +   + D     DRE                         
Sbjct: 966  GIHGGDDFNGKRLLEN-GELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQMLP 1024

Query: 1012 -------IDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDEN 1064
                    D + TYFV DAT+WLRH   ++KLA N +LKFAICLTTFQELRFLRKSKDE+
Sbjct: 1025 RGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDES 1084

Query: 1065 VMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMK 1124
            V+EAATR +IT+RQLYYE K+LPLRFTGNVA H+EE+LE EEQ+TWR+HVDEFVIE+I K
Sbjct: 1085 VLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHK 1144

Query: 1125 AQEKLENANQ---------LPVSS-CRFNYVILISDDDTMKKKAEEKKIKTLSTRFVFSL 1174
            AQ+K    N          +P  +  RFN++ L++DD  M+ KA  + IK  STRF+FS+
Sbjct: 1145 AQDKFNALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSV 1204

Query: 1175 CTKLGEQRHLCTD 1187
            C +LG  +++CT+
Sbjct: 1205 CNELGHAKNVCTN 1217

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  984 bits (2544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/988 (52%), Positives = 675/988 (68%), Gaps = 94/988 (9%)

Query: 262  KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTF 321
            +KSS  L+QKLQ++YK IVKQEIELQERC +LTNSQTTELK+LWTIYR+N+ELV+NY+TF
Sbjct: 378  RKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITF 437

Query: 322  ITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 381
            ITTA+ P+QP+ D  IG+EI+EIY+IERRLWVYGTITFLD+LKNFSNFMDPEVCCQFI H
Sbjct: 438  ITTAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFH 497

Query: 382  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNH 441
            VF+S+S M++DIP KY ++W Q+LGDLSRMAIALYPS+FIDWKLSAE WY  AM++ Y H
Sbjct: 498  VFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGH 557

Query: 442  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGN--L 499
            GKLYYHMSTVQQNTLEAFVNLGKS+FC+ TF PS QY+QLVI NIYQRA+ + NN N   
Sbjct: 558  GKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGR 617

Query: 500  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGC--NIFNPEDMFIQNP 557
             + LL++Y+KH E  LLP+F ES +LQ VVL YF++KFG+D N    N+F    MF+QN 
Sbjct: 618  NDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNN 677

Query: 558  DFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSN----- 612
            D FK F+R++ +FA+S ILQIVG+G  K+PF++LFELPK+LK+RK+KKE++K        
Sbjct: 678  DQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKPKTMLILK 737

Query: 613  -NESSITESSTSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTN-- 669
              +  +       +     +N+  +++           EFF +IDT+  P   S + N  
Sbjct: 738  ITQPRLYHRWVGTTLPTMPNNNVFLTAE----------EFFENIDTINYP---SFMPNSV 784

Query: 670  EAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISK 729
            + W  SL++ N  S+KC MIV +KFLH P  IALPH LPW YFIISI L+  +  +    
Sbjct: 785  DIWNHSLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMN 844

Query: 730  EFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKE 789
            EFW+  V+RIFPW+++V F+N+L+A ++DN     I+  LC  Y+ ++L ELL  F E E
Sbjct: 845  EFWVEFVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENE 904

Query: 790  ELPEIWGCWGTLWFDTICQK-------NTNSISSDD----DFEEVGIKDYMALDSPIDGI 838
            ELPE+W C G+LWFDTI +K       N   I+  D    D++  G+KDY   D PIDG 
Sbjct: 905  ELPEVWKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGT 964

Query: 839  IFDVNDENGEKFWKRACRTIFLFRELSRSFQI--GVIINNESSI---NRSSLQSNNILGN 893
             FD +DE GE+FWKRA R IFLF++L+ S+    G+I++ E+ +    +   + N +   
Sbjct: 965  DFDESDEIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQE 1024

Query: 894  L---SYKLEPLSTLGSSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTG 950
            L   S+KL       SS   +  L+ II+ FET  E N D H  P LS++ G SIF+Y G
Sbjct: 1025 LLEFSFKLN-----ASSDGVM--LDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVG 1077

Query: 951  YKKLCPNYTCFDKNGEFLSASLYTSWYVPN--------------------GSNNPETNIN 990
            YK++CPN+  FDKNG+F+S S + SW + N                    GS N     +
Sbjct: 1078 YKRVCPNFYSFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITDDAISSGSGNDSAAAS 1137

Query: 991  SNCEKENEG-QFLECLKSDDREID-----------------LNTTYFVFDATSWLRHSAR 1032
            +N +  NE   F EC     + ++                    TYF+ DATSWLRH A 
Sbjct: 1138 TNNDPMNELLVFNECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAH 1197

Query: 1033 IFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTG 1092
            I+K+A +++LKFAICLTTFQELR+LRKSKD NV+EAATR IIT+RQLY+EN +LPLRFTG
Sbjct: 1198 IYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTG 1257

Query: 1093 NVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEK----LENANQLPVSSCRFNY-VIL 1147
            NVATHIEE+LEFEEQITWR+HVDEFVIE+++KA+EK    L + N       +  + +IL
Sbjct: 1258 NVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFGIIL 1317

Query: 1148 ISDDDTMKKKAEEKKIKTLSTRFVFSLC 1175
            ++DD TMK KA ++KIKT STRF+FS+ 
Sbjct: 1318 VTDDITMKNKAMDRKIKTFSTRFIFSMA 1345

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  973 bits (2515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/943 (52%), Positives = 653/943 (69%), Gaps = 52/943 (5%)

Query: 267  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTFITTAL 326
              I+KLQE+Y++IV QE ELQ+RC  LT SQTTELKSLW IYR+NTEL+ NY+ FI TAL
Sbjct: 206  TFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITAL 265

Query: 327  LPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 386
            L +QP +DL++GQEI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + F+S+
Sbjct: 266  LTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISV 325

Query: 387  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHGKLYY 446
            S+M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKY+Y  GKLYY
Sbjct: 326  SSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYY 385

Query: 447  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNL------- 499
            H++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++          
Sbjct: 386  HIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNNETAH 445

Query: 500  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDF 559
            RNS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF +KFG D NG +IF+ +DMF QNP+ 
Sbjct: 446  RNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMFCQNPES 505

Query: 560  FKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITE 619
             +Y+FRHAP+FA+S +LQ++GFG PKNPFA+LF+LPK+LK ++ K+E+KKS   E     
Sbjct: 506  LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKRHKREKKKSGATE----- 560

Query: 620  SSTSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKFL 679
                  R+  DD    +SS +     DSL   F+DI T              WL+SL  +
Sbjct: 561  --VPQYRDPFDDQ---ISSESYFQNIDSLTSNFDDIPT----------NLNIWLDSLNHI 605

Query: 680  NMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRI 739
            NMTS++C + VL KFLH PL +ALPHFL W++FI++I  K   ++      FWI  ++R 
Sbjct: 606  NMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRT 665

Query: 740  FPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWG 799
             PW++MV   N+L+  +LDN    P +    + +  L L +L++ F E E LPEIW CWG
Sbjct: 666  MPWNSMVNLANVLVCYMLDN--IHPFLERELERFYSLELDDLIEYFNENENLPEIWKCWG 723

Query: 800  TLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIF 859
            +LWFD        +I   D  E  G++D++  DSP+DGI+FD  DE GE+FW R+ RTI 
Sbjct: 724  SLWFD--------AIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTIL 775

Query: 860  LFRELSRSF-QIGVIINNESSI--NRSSLQSNNILGNLSYKLEPLSTLGSSIPT-LNTLE 915
            + + +++ F  +G+ +N ++ +   R+ +  +  L N ++KL+       +    L+ L 
Sbjct: 776  ILKGVAKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKLDEYEENDHNDNNELDELY 835

Query: 916  GIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTS 975
              I++ E     N DL A P LSV+ G +IF YTGY +L P+Y CFDKNG F SA +Y+ 
Sbjct: 836  DTIEINEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQ 895

Query: 976  WY-VPNG------SNNPETNINSNCEKENEGQFLECLKSDDREIDLN---TTYFVFDATS 1025
            W  V NG      S +     N+N     E  F + + +     D N   + YFV DATS
Sbjct: 896  WSNVGNGMVLDVSSESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNCSVYFVIDATS 955

Query: 1026 WLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKV 1085
            WLRH A IFKLA+N +LKFAICLTTFQELR+LR SKD+NV+EAATR +ITIRQLY E K+
Sbjct: 956  WLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKI 1015

Query: 1086 LPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSCRFN-Y 1144
            +PLRFTGN+AT++EENLEFEEQITW THVDEFVI++I K  +  +    +  +  + N Y
Sbjct: 1016 IPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKNKNNAY 1075

Query: 1145 VILISDDDTMKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD 1187
             +L++DDD M  KA++K IKT +T+++FSL +K+G    LCT+
Sbjct: 1076 AVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  972 bits (2514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/958 (51%), Positives = 665/958 (69%), Gaps = 56/958 (5%)

Query: 254  NVYRPANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTE 313
            +V R   + + +   I+KLQE+YK+IV QE ELQ+RC  LT SQTTELKSLW IY++NTE
Sbjct: 192  SVTRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTE 251

Query: 314  LVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPE 373
            L+ NY+ FI TALL +QP +DL++GQEI++IYRIE+RLWVYG ITFLDVLK+FSNFMDPE
Sbjct: 252  LIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPE 311

Query: 374  VCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTE 433
            VCCQFIT+ F+ +S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE
Sbjct: 312  VCCQFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTE 371

Query: 434  AMKYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVE 493
            +MKY+Y  GKLYYH++T+QQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++
Sbjct: 372  SMKYIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFID 431

Query: 494  RNNGNL-------RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNI 546
            R++GN        RNS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF +KFG D NG ++
Sbjct: 432  RSSGNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDV 491

Query: 547  FNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKE 606
            F+ +DMF QNP+  +Y+FRHAP+FA+S ILQ++GFG PKNPFA+LF+LPKHLK +KDK+E
Sbjct: 492  FSTKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHLKFKKDKRE 551

Query: 607  RKKSSNNESSITESSTSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSM 666
            +KKS   E         + R+  DD             + S   +F +IDTL        
Sbjct: 552  KKKSGAAE-------IPHYRDPFDD-------------QGSSESYFQNIDTLNSDFNDPP 591

Query: 667  LTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDP 726
                 WL+SL ++NMTS++C + VL KFLH PL +ALPHFL W++FII++  K   ++  
Sbjct: 592  TNIGIWLDSLNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSE 651

Query: 727  ISKEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFK 786
                FWI  ++R  PW++MVTF N+L+  +LDN    P +    +++  L L +L++ F 
Sbjct: 652  QVTAFWIHFLRRTMPWNSMVTFSNVLVCYMLDN--LHPFLEKQLEKFYSLELDDLIEYFN 709

Query: 787  EKEELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDEN 846
            E E LPE+W CWG+LWFD        ++   D  E  G++D++  DSP+DGI+FD  DE 
Sbjct: 710  ENENLPEVWKCWGSLWFD--------AVKKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEI 761

Query: 847  GEKFWKRACRTIFLFRELSRSF-QIGVIINNESSI--NRSSLQSNNILGNLSYKLEPLST 903
            GEKFW R+ RTI   + +++ F  +G+ +N ++S+   R+ +  +  L NL++KL+P   
Sbjct: 762  GEKFWIRSVRTILTLKGIAKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEE 821

Query: 904  LG-SSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFD 962
               +    L+ L   I++ E     NIDL A P+LSV+ G SIF YTGY +L  +Y CFD
Sbjct: 822  DAFNDNNELDELYDTIEINELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFD 881

Query: 963  KNGEFLSASLYTSWYVPNGSNNPETNINSNCEKENEG-----QFLECLKSDDREIDLNT- 1016
            KNG F SA +YT W   N  N    +++S    ++        + + L      I  NT 
Sbjct: 882  KNGGFNSAFIYTQW--SNVGNGVTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIGKNTD 939

Query: 1017 ------TYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAAT 1070
                   YFV DATSWLRH A IFKLA+N +LKFAICLTTFQELR+LR SKD+NV+EAAT
Sbjct: 940  DDGSCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAAT 999

Query: 1071 RGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLE 1130
            R +ITIRQLY E K++P+RFTGN+ATHIEENLEFEEQITW+THVDEFVI++I K  +  +
Sbjct: 1000 RSVITIRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQ 1059

Query: 1131 NANQLPVSSCRFN-YVILISDDDTMKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD 1187
                +  +  R   + +L++DDD M +KA++K IKT +T+++FSL +KLG    LCT+
Sbjct: 1060 TERTIDKNKGRSKEFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score =  961 bits (2484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/950 (52%), Positives = 659/950 (69%), Gaps = 68/950 (7%)

Query: 268  LIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTFITTALL 327
             I+KLQE+YK+IV QE ELQ+RC  LT SQTTELKSLW IYR+NTEL+ NY+ FI TALL
Sbjct: 207  FIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITALL 266

Query: 328  PSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLS 387
             +QP +DL++GQEI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + F+S+S
Sbjct: 267  TTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISVS 326

Query: 388  TMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHGKLYYH 447
             M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKY+Y  GKLYYH
Sbjct: 327  NMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYH 386

Query: 448  MSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNL-------R 500
            ++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++G+        R
Sbjct: 387  IATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNNEIAHR 446

Query: 501  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFF 560
            NS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF +KFG D NG ++F+ +DMF QNP+  
Sbjct: 447  NSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFCQNPESL 506

Query: 561  KYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITES 620
            +Y+FRHAP+FA+S +LQ++GFG PKNPFA+LF+LPK+LK +KDK+E+K+S   E+S    
Sbjct: 507  RYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSEATETS---- 562

Query: 621  STSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKFLN 680
                  +  D  D  +SS +     D+L   FNDI T              WL+SL  +N
Sbjct: 563  ------SYTDPFDVQISSESYFQNIDALNSSFNDIPT----------NLNIWLDSLNHIN 606

Query: 681  MTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIF 740
            MTS++C + VL KFLH PL +ALPHFL W++FI++I  K   ++      FWI  ++R  
Sbjct: 607  MTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTM 666

Query: 741  PWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWGT 800
            PW+++VT  N+L+  +LDN    P +    +++  L L +L++ + E E LPEIW CWGT
Sbjct: 667  PWNSIVTLGNVLVCYMLDN--LHPFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWGT 724

Query: 801  LWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFL 860
            LWFD        +I   D  E  G++D++  DSP+DGI+FD  DE GEKFW R+ R + L
Sbjct: 725  LWFD--------AIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLL 776

Query: 861  FRELSRSF-QIGVIINNESSI--NRSSLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEGI 917
             + +++ F  +G+ ++ ++S+   R+ +  +  L NL++KL+       +    N L+ +
Sbjct: 777  LKGIAKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDE--DNYNDNNELDDL 834

Query: 918  IDVFETRSE---NNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYT 974
             D  E   E    N+D  A P LSV+ G SIF YTGY +L P+Y CFDKNG F SA +Y+
Sbjct: 835  YDTIEINEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYS 894

Query: 975  SWY-VPNGSNNPETN------INSNCEKENEGQFLECLKSDDREIDLN---TTYFVFDAT 1024
             W  V NG     +        N+N     E  F + + +  +  D N   T YFV DAT
Sbjct: 895  QWSNVGNGVTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTLYFVIDAT 954

Query: 1025 SWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENK 1084
            SWLRH A IFKLA+N  LKFAICLTTFQELR+LR SKD+ V+EAATR +ITIRQLY E K
Sbjct: 955  SWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKK 1014

Query: 1085 VLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKL-------ENANQLPV 1137
            ++P+RFTGN+ATH+EENLEFEEQITW+THVDEFVI++I K  ++        EN N+   
Sbjct: 1015 IIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKNKGK- 1073

Query: 1138 SSCRFNYVILISDDDTMKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD 1187
                  + +L++DDD M +KA+++ IKT +T+++FSL +KLG    LCT+
Sbjct: 1074 -----EFAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score =  960 bits (2482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/1009 (49%), Positives = 668/1009 (66%), Gaps = 85/1009 (8%)

Query: 229  NNNNNTNNNNINNNEDDDNNEQEESNVYRPANNKKSSIALIQKLQELYKVIVKQEIELQE 288
             NNN   N++  +NED DN +   +       +K SS  L++KLQE+YK IVKQE ELQE
Sbjct: 284  GNNNVGINSSSESNEDGDNGDNNHNVSTVAVPSKPSSQTLVEKLQEIYKNIVKQETELQE 343

Query: 289  RCSQLTNSQTTELKSLWTIYRINTELVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIE 348
            RCSQLT SQTT+LK+LW IY++N EL++NY TFITTALLP+QP+ DL+IGQEI+E+YRIE
Sbjct: 344  RCSQLTTSQTTDLKNLWVIYKLNAELIDNYFTFITTALLPTQPKADLLIGQEIIEVYRIE 403

Query: 349  RRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDL 408
            RRLW+YGTITFLDVLKNFSNFMDPEVCCQFI +VF+S+S ++ +IP  +S+ WL+RLGDL
Sbjct: 404  RRLWLYGTITFLDVLKNFSNFMDPEVCCQFIVYVFISISNILGNIPPTFSVIWLERLGDL 463

Query: 409  SRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFC 468
            SRMAIALYPS FIDWKLSAEHWY EA+KY + HGKLYYHMSTVQQNTL AFVNLGKSVFC
Sbjct: 464  SRMAIALYPSGFIDWKLSAEHWYQEALKYNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFC 523

Query: 469  QETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNV 528
            ++TF PS QYMQLVIDNIYQRAF ERN+G+ R S ++EYLKH+E MLLPSFLE+ + Q V
Sbjct: 524  RDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRYSHIVEYLKHTEVMLLPSFLENVESQGV 583

Query: 529  VLSYFVEKFGIDANGCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPF 588
            VL++F +KFG   +  N F+P  +F+Q+ +  K+FFRHA  +A+SHILQ+VGFG+P+NPF
Sbjct: 584  VLAFFDQKFGATGSA-NFFDPSLIFVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPF 642

Query: 589  AILFELPKHLKERKDKKERKKSSNNESSITESSTSNSRNENDDNDEIMSSTTSISERDSL 648
            A+LFELPK +         K+    +      ST++++++   +D  +            
Sbjct: 643  ALLFELPKCI---------KERKERKEKRKSKSTASNQSDMSIDDTFLGDP--------- 684

Query: 649  IEFFNDIDTLRRPIVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLP 708
            ++FF  +++ +     S   N  W ESL ++N TS++C M+VLRKFL+  L  ALPH LP
Sbjct: 685  VQFFETLNSTKTAYRFSQDLN-IWKESLNYVNKTSMRCSMVVLRKFLNSSLLTALPHLLP 743

Query: 709  WIYFIISICLKSSQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGS 768
            W YF++++ L+   + +  SK FWIV +++IFPW+++  F+N+L+  + D + T   I  
Sbjct: 744  WAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFLNVLLLYINDQKPTKFPIDE 803

Query: 769  LCDEYSDLNLAELLDVFKEKEELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDY 828
                Y ++ L ELL+ F E E+LPE+W CWGTLWFD I   N+  +S+  D    G+KD+
Sbjct: 804  YMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVI---NSKHVSNLVDIHSTGVKDH 860

Query: 829  MALDSPIDGIIFDVNDENGEKFWKRACRTIFLFRELSRSFQIGVIINNESSINRSSLQSN 888
            M LD+P+DGI FD +DE+GEKFWKR  R I LFR ++  F  G    N S   +S     
Sbjct: 861  MFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQFPFGFTEFNGSDDWKS----- 915

Query: 889  NILGNLSYKL-EPLSTLGSSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFN 947
                 L +K  EP +        L +       FE+ S  N DL + P   ++ G  I  
Sbjct: 916  -----LVFKFNEPPAEWKEQY--LGSFSKEYGEFESISFVNTDLQSPPHKGMVLGTDIRT 968

Query: 948  YTGYKKLCPNYTCFDKNGEFLSASLYTSWYVPNGSNNPETNINSNCEK---ENE------ 998
              GYK+L P+Y CF+KNG+ ++ SLYTS     GS  P  + +    K   ENE      
Sbjct: 969  LQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGVPNDSEDFGSTKRLLENELLVTSE 1028

Query: 999  ----------------GQFL------------ECLKSDDRE--IDLNTTYFVFDATSWLR 1028
                             +FL            +CL   D +   D + TYFV DAT+WLR
Sbjct: 1029 RRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPRGDLQYFTDTHVTYFVLDATTWLR 1088

Query: 1029 HSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPL 1088
            H   ++KLA + LLKFAICLTTFQELRFLRKSKDE+V+EAATR +IT+RQLYYE K+LPL
Sbjct: 1089 HFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPL 1148

Query: 1089 RFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSCR------- 1141
            RFTGNVA H+EE+LE EEQ+TWR+HVDEFVIE+I KAQ K    N+   +S R       
Sbjct: 1149 RFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKFNQLNKDAKASGRESITTID 1208

Query: 1142 ---FNYVILISDDDTMKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD 1187
               FN++ L++DD  M+ KA  + I+  ST+F+F++C ++G  + +CTD
Sbjct: 1209 DGKFNFIALVTDDINMRNKARAQSIRAFSTKFMFAICHEIGLSKKVCTD 1257

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score =  945 bits (2443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/977 (51%), Positives = 658/977 (67%), Gaps = 88/977 (9%)

Query: 268  LIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTFITTALL 327
            L++KLQE+YK IVKQE ELQERCS LT  QTT+LK+LW  Y+IN EL++NY+ FITTALL
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 328  PSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLS 387
            PSQ +  L IGQEIV++YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +VF++LS
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 388  TMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHGKLYYH 447
             M+ D+P KYSI WL+RLGDLSRMAIALYPS F+DWKLSAEHWY E++K+ + HGKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 448  MSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEY 507
            MSTVQQNTLEAFVNLGKSVFC++ F PSPQYMQLVIDNIYQRAF ER++   R + +++Y
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY 523

Query: 508  LKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFFKYFFRHA 567
            LKH+E MLLPSFLES +LQNVV+ YF  KFG+ ++G N F+P  +FIQ+ +  K+FFRH+
Sbjct: 524  LKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLKHFFRHS 582

Query: 568  PSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITESSTSNSRN 627
              F+QSHILQ+ GFG+PKNPFA+LFEL KHLK RK++KERKKS       T+S++  S +
Sbjct: 583  SLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKS-------TKSTSEGSLD 635

Query: 628  ENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKFLNMTSLKCG 687
              + + +  +ST          +FF+ ID+ + P     L    W  SL ++N+TS+KCG
Sbjct: 636  PVEFSSQQQASTE---------DFFSTIDSPKVP-YEFPLDLGVWKRSLHYINVTSMKCG 685

Query: 688  MIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIFPWDTMVT 747
            MIVLR+FL+GP+  ALPH LPW+ FIISI ++  Q++D   K+FWIV ++RIFPWD+++T
Sbjct: 686  MIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLIT 745

Query: 748  FMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWGTLWFDTIC 807
            FMN LI   +     +  I +    Y  +N  ELL    E E LPE W CWG+LWF+TI 
Sbjct: 746  FMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTIS 805

Query: 808  QKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFLFRELSRS 867
            +K+   +++    E  G+ D + LDSP +GI FD +DE G K+W+R CRT+ LF  ++  
Sbjct: 806  KKSDLDVTT---LESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEW 862

Query: 868  FQIGVIINNESSINRSSLQSNNIL--------GNLSYKLEPLSTLGSSIPTLNTLEGIID 919
                   +    +N  +    N++          LS +L P      S P         +
Sbjct: 863  EACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVELYPEE--NESFP--------FE 912

Query: 920  VFETRSENNI-DLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWYV 978
             FE  S  N  D       S+I G SI N  G+K + P+Y CF+KNG+ ++ASLYT   +
Sbjct: 913  KFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPL 972

Query: 979  PNGSNNPETNINSNCEKEN------------------EGQFLECLKSDD---REI----- 1012
               +     + N+N   +N                  E  +LE   + D   RE+     
Sbjct: 973  ETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSF 1032

Query: 1013 --------DLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDEN 1064
                    D N T+FV DAT+WLRH A I+KLA + +LKFAICLTTFQELRFLRKSKDE+
Sbjct: 1033 LGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDES 1092

Query: 1065 VMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMK 1124
            V+EAATR +I +RQLYYE K+L LRFTGNVA H+EE+LE EEQ+TW++HVDEFVI++I K
Sbjct: 1093 VLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAK 1152

Query: 1125 AQEKL---------ENANQLPV-----SSCRFNYVILISDDDTMKKKAEEKKIKTLSTRF 1170
            AQ+K          +  + +P+     S+ RFN+V L++DD  M+ KA++  I+T STRF
Sbjct: 1153 AQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRF 1212

Query: 1171 VFSLCTKLGEQRHLCTD 1187
            VF++C +LG +  +CT+
Sbjct: 1213 VFAICRELGRETGVCTN 1229

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  944 bits (2439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/981 (50%), Positives = 660/981 (67%), Gaps = 70/981 (7%)

Query: 247  NNEQEESNVYRPANNKKSSIA------------------LIQKLQELYKVIVKQEIELQE 288
            NN Q +S V  P   K   +A                   I+KLQE+YK+IV QE ELQ+
Sbjct: 168  NNSQPQSQVTLPDIRKAPVVASSPPPVVRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQ 227

Query: 289  RCSQLTNSQTTELKSLWTIYRINTELVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIE 348
            RC  LT SQTTELKSLW IYR+NTEL+ NY+ FI TALL +QP +DL++GQEI++IY +E
Sbjct: 228  RCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYGME 287

Query: 349  RRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDL 408
            +RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + F+S+S M+ DIP KYSI W QRLGDL
Sbjct: 288  KRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDL 347

Query: 409  SRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFC 468
            SRMAI+LYPS FIDW+LSAE+WYTE+MKY+Y  GKLYYH++TVQQN+LEAFVNLGKSVFC
Sbjct: 348  SRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFC 407

Query: 469  QETFTPSPQYMQLVIDNIYQRAFVER-------NNGNLRNSLLIEYLKHSEAMLLPSFLE 521
            Q+ FTPS Q +QL+I+NIYQ AF++R       N    +NS LI+YLKH+E MLLPSFLE
Sbjct: 408  QDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNNETAHKNSQLIDYLKHTEVMLLPSFLE 467

Query: 522  SPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGF 581
            + DLQ+VVL YF  KFG D NG ++F+ +DMF QNP+  +Y+FRHAP+FA+S +LQ++GF
Sbjct: 468  NMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGF 527

Query: 582  GEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITESSTSNSRNENDDNDEIMSSTTS 641
            G PKNPFA+LF+LPK+LK +KDK+E+K+SS  E       T   R+   D     S   +
Sbjct: 528  GNPKNPFALLFQLPKYLKLKKDKREKKRSSATE-------TPQYRDPFHDKKSPESYFQN 580

Query: 642  ISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGI 701
            I   D+L   F+DI T              WLESL  +NMTS++C + VL KFLH P  I
Sbjct: 581  I---DALSSNFDDIPT----------NLNIWLESLNHINMTSIQCSIHVLTKFLHAPFVI 627

Query: 702  ALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDNEM 761
            ALPHFL W+YF+++I  +   ++      FWI  ++R  PW++MV+  N+L+  +LDN  
Sbjct: 628  ALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMVSLANVLVCYMLDN-- 685

Query: 762  TSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWGTLWFDTICQKNTNSISSDDDFE 821
              P +    + +    L +L++ F E E LPEIW CWG+LWFD        +I   D  E
Sbjct: 686  LHPFLKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFD--------AIKKCDVME 737

Query: 822  EVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFLFRELSRSF-QIGVIINNESSI 880
              G++D++  DSP+DGI+FD  DE GE+FW R+ R I L + +++ F  +G+ +N ++ +
Sbjct: 738  IPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKFPDLGLKVNFQAPV 797

Query: 881  --NRSSLQSNNILGNLSYKLEPLS-TLGSSIPTLNTLEGIIDVFETRSENNIDLHAVPEL 937
               R+ +  +  L   ++KL+       +    L+ L   I++ E     N+DL A P L
Sbjct: 798  FCRRNDIPQDYFLRKFTFKLDAYDEGNNNDNNELDELYETIEINEKIDNVNLDLRATPNL 857

Query: 938  SVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWY-VPNG-----SNNPETNINS 991
            SV+ G SIF YTGY +L P+Y CFDKNG F SA +Y+ W  V NG     SN P  ++  
Sbjct: 858  SVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVGNGVPIDVSNEPIYDVTD 917

Query: 992  N-CEKENEGQFLECLKSDDREIDLN---TTYFVFDATSWLRHSARIFKLAQNRLLKFAIC 1047
            N      E  F + + +  +  D N   T YFV DATSWLRH A IFKLA+N +L FAIC
Sbjct: 918  NDLSLHWEKIFFDRIAAAYKNCDENDNCTIYFVVDATSWLRHFAHIFKLAKNSILDFAIC 977

Query: 1048 LTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQ 1107
            LTTFQELR+LR SKD+NV+EAATR +ITIRQLY E K++P+RFTGN+ATH+EENLEFEEQ
Sbjct: 978  LTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQ 1037

Query: 1108 ITWRTHVDEFVIESIMKAQEKLENANQLPVSSCR-FNYVILISDDDTMKKKAEEKKIKTL 1166
            ITW+THVDEFVI++I K  +  +    +  +  +   + +L++DDD M KKA++K IKT 
Sbjct: 1038 ITWKTHVDEFVIDAIAKLNQNFQTERMIAENKNKNKQFAVLVTDDDNMNKKAKDKMIKTC 1097

Query: 1167 STRFVFSLCTKLGEQRHLCTD 1187
            +T+++FSL +KLG    LCT+
Sbjct: 1098 NTKYLFSLGSKLGINSGLCTN 1118

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  936 bits (2419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1038 (46%), Positives = 656/1038 (63%), Gaps = 129/1038 (12%)

Query: 258  PANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNN 317
            P    +S+ ALI KLQ++YK I+ QE+ELQ  CS +T+SQTT+LK +W +Y+IN ELVNN
Sbjct: 266  PTTWNRSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNN 325

Query: 318  YVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQ 377
            YV FITTALLPSQ Q DL+IGQEI+++Y+IERRLWVYGTITFLDVLK+FSNFMDPE+CCQ
Sbjct: 326  YVIFITTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQ 385

Query: 378  FITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKY 437
            FI HVF+S++ M   IP K+SI W  RLGDLSRMA ALYP    DWKLSAE+WY EAMKY
Sbjct: 386  FIIHVFISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKY 445

Query: 438  VYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNG 497
             Y  GKLYYHM+TVQQN+L AF+NLGKSVFC++ F P+ QY+QLVIDNIYQRA++ R   
Sbjct: 446  TYGVGKLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEE 505

Query: 498  NLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNP 557
            +  N  +++YLKH+E M+LP+F+E+ +LQ +   YF EKFG D  G N F+   MF+QN 
Sbjct: 506  SSSNVQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNL 565

Query: 558  DFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSI 617
            +  K++FRH+P FAQ+HILQ+VG+G   N FA+L+ELPK +K+ +  ++RKKS     ++
Sbjct: 566  ESVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNM 625

Query: 618  TESSTSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTN-EAWLESL 676
            +  + S   + N+ +D              + E+FN ++ + +    ++  N + W++SL
Sbjct: 626  SIDTLSFQVSGNEIHD--------------VGEYFNSLENIDKEF--TLPPNVDIWIQSL 669

Query: 677  KFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIV 736
            ++ N T + CGM+VL+KFL GP   ALPH LPW+YF+IS+  K   L D  S+ FW + +
Sbjct: 670  QYTNTTGIFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFI 729

Query: 737  KRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWG 796
            +RIFPW+T++ F+N+LIA + DN  +  ++  LC+ YS L+L E+L  F E EELPE+W 
Sbjct: 730  RRIFPWNTIINFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWN 789

Query: 797  CWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACR 856
            CWG+LWFDTI  K+  S S     +  GIKD   LD+P DGI+FD  D+NG KFWKRACR
Sbjct: 790  CWGSLWFDTIKNKSETSYSG---LKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACR 846

Query: 857  TIFLFRELSRSFQIGVIINNESSINR-------SSLQSNNILGNLSYKLEPLSTL----- 904
             +FLF+  +  F  G+ + N +S+N           +  NI  +  +K +P   L     
Sbjct: 847  ILFLFKGYAEKFDQGLRLTNINSLNSEEENIFTKKQEKRNI--DFLFKFDPTYDLLPIDE 904

Query: 905  --GSSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFD 962
                     +     +  FE+ SENNI L AVP+LSVI G SIF+Y GYKKL P Y  +D
Sbjct: 905  ASNKYFQVYSLFTEKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYD 964

Query: 963  KNGEFLSASLYTSWYVPNGSNN---PETNINSNC--------------EKENEGQFLECL 1005
            KNG     ++Y++W   N   N   P     S+               EK    ++LEC 
Sbjct: 965  KNGNVNKGAIYSNWEAFNQLGNGLKPRMENGSSFIIDGLDDSKNFEIREKRLFAKYLECD 1024

Query: 1006 KSDD------------------------REI--------DLNT----------------- 1016
            +S +                        R++        DL+T                 
Sbjct: 1025 ESQESSDHLAEVEREGDETEDETEETNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYS 1084

Query: 1017 TYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITI 1076
            TYF+FDAT+WLRH A I+K+A + LL F ICLTTFQELRFLR+S+DENVMEAATR +I I
Sbjct: 1085 TYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVI 1144

Query: 1077 RQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQE-----KLEN 1131
            R LY   KV+PLRF G +A+HIEE+LEFEEQITWR+HV+EFVIE++ K+QE     +L N
Sbjct: 1145 RLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHN 1204

Query: 1132 -------------------ANQLPVSSCRFN---YVILISDDDTMKKKAEEKKIKTLSTR 1169
                                 Q   S+   N     +L++DD  M  KA+E+ I+T STR
Sbjct: 1205 ESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTR 1264

Query: 1170 FVFSLCTKLGEQRHLCTD 1187
            F+FS+C++LG +  +CT+
Sbjct: 1265 FIFSICSQLGMKYGICTN 1282

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score =  914 bits (2363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/812 (56%), Positives = 583/812 (71%), Gaps = 47/812 (5%)

Query: 220  NNNNNNINNNNNNNTNNNNINNNEDDDNNEQ---------------------EESNVYRP 258
            +NN       NN+N +N+ +  N + DNNE+                     ++S+    
Sbjct: 222  DNNGEGEVAGNNDNADNDGLPTNGNGDNNEKNLSNDNDNSNNNSNNNNNYPADQSDAQNT 281

Query: 259  ANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNY 318
            +  +KSS AL+QKLQ++YKVIVKQEIELQERCSQLT SQTTELK+LWTIY+INT+L+NNY
Sbjct: 282  SVTRKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNY 341

Query: 319  VTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQF 378
             TFITTALLPSQP  D++IG+EIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVC QF
Sbjct: 342  TTFITTALLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQF 401

Query: 379  ITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYV 438
            ITHVF+SLS ++ DIP K++I WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ 
Sbjct: 402  ITHVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFT 461

Query: 439  YNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN-NG 497
            Y+HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQR FV+RN  G
Sbjct: 462  YSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGG 521

Query: 498  NLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNP 557
            N RN  LI+YLKHSE MLLPSFL S DLQ VVL+YF ++FGID +  NIF+ +DMF Q P
Sbjct: 522  NYRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPP 581

Query: 558  DFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSI 617
               ++FFRHAP+FA+SHILQ+VGFG PKNPFA+LFELPK+LKER+DKKE+ KS +  ++ 
Sbjct: 582  SCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTSTAD 641

Query: 618  TESS--------TSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTN 669
              S+         +++ NE  ++D  +++T S        E+ ++I+TL+  I +  +  
Sbjct: 642  VSSTAPKTVDDQATDNVNEGTNDDHELTATLSGP------EYLDNIETLKYAIETPDIC- 694

Query: 670  EAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISK 729
              W++SL F+NMTSLKC MIVL+KFLHGPL IALPHFLPW  FII+  +K ++L +  + 
Sbjct: 695  -TWIKSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNY 753

Query: 730  EFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKE 789
            +FW +++KRIFPWDT+ +F+N+L+A VLDN   + II  LC +YSD++L ++L  F + E
Sbjct: 754  KFWRILMKRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSE 813

Query: 790  ELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEK 849
            +LPE+W CWGTLW+D IC  N NS+ + D F   GI D+M LD PIDGI FD  DE G K
Sbjct: 814  DLPEVWKCWGTLWYDAIC--NKNSVDA-DTFAGFGIGDHMFLDFPIDGIEFDAEDETGAK 870

Query: 850  FWKRACRTIFLFRELSRSFQIGVIINNESSIN-RSSLQSNNILGNLSYKLEPLSTLGSSI 908
            FWKRA R IFLF+ +S+ F  G+ I++E+ +  R+   +++ L   ++KLE         
Sbjct: 871  FWKRALRVIFLFKGISKKFDFGLKISHEAGVYCRNEKAADSPLRRFTFKLESYDE----- 925

Query: 909  PTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFL 968
            PT +     I + E  S  N D  A P LSV++G +IF Y GY+ L  +   FDKNGE +
Sbjct: 926  PTSSKFNEFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIV 985

Query: 969  SASLYTSWYVPNGSNNPETNINSNCEKENEGQ 1000
            S+S+YTSW +  G      +  ++    +EGQ
Sbjct: 986  SSSIYTSWMIDTGEAAAAASSATDNNAVSEGQ 1017

 Score =  249 bits (636), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 147/190 (77%), Gaps = 13/190 (6%)

Query: 1011 EIDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAAT 1070
            E+D   T+F+FDATSWLRH A I+K+A N +LKF +CLTTFQELRFLRKSKDENV+EAA 
Sbjct: 1092 ELDRLKTFFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAA 1151

Query: 1071 RGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLE 1130
            R IIT+RQLY EN++LPLRFTGNVA  IEE+LEFEEQITWR+HVDEFVIE++MKAQ+K  
Sbjct: 1152 RAIITMRQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFT 1211

Query: 1131 NANQ-------------LPVSSCRFNYVILISDDDTMKKKAEEKKIKTLSTRFVFSLCTK 1177
             A +             +P+   RF+YV L+++D  MK+KA+++ IKT ST FVFSLC+K
Sbjct: 1212 TAGETKQPEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSK 1271

Query: 1178 LGEQRHLCTD 1187
            LG    LCT+
Sbjct: 1272 LGMSLDLCTN 1281

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1526

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/785 (45%), Positives = 492/785 (62%), Gaps = 151/785 (19%)

Query: 262  KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTF 321
            KKS+  LIQKLQ +YK+IV QE+ELQ++C++L+ SQ+T+LK LW+IY++N +L+NNY+ F
Sbjct: 263  KKSNQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILF 322

Query: 322  ITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 381
            I T+L PSQ  +D +IG+EI+EIY+IERRLW+YGTITFLD+LKNF+NFMDPE+  QFITH
Sbjct: 323  ILTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITH 382

Query: 382  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNH 441
            VF S+S MISD+P  +   W QRLGDLSRMAIALYPS+FIDWKLS+E+WY E+MK+ ++H
Sbjct: 383  VFESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSH 442

Query: 442  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN----- 496
            GKLYYH+STVQQN LEAFVNLGKSVFC +TF PS +YMQLVIDNIYQRAF+ERN+     
Sbjct: 443  GKLYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSS 502

Query: 497  ------------------GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFG 538
                               N +   LIEYLKHSE MLLP+FLE+  L+ VVL+YF   FG
Sbjct: 503  NNAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFG 562

Query: 539  ----------------------------------------------------IDANGCNI 546
                                                                +  N  N+
Sbjct: 563  KIAIQSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINL 622

Query: 547  FNPEDMFIQ-NPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKK 605
            FN  ++F Q N D  KYFF+++ +FA+SHILQ++GFG+PKNPFA+LF+LPK+LKERK K+
Sbjct: 623  FNFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYLKERKTKR 682

Query: 606  ERKK-----------------SSNN--ESSITESSTSNSRNENDDNDE-----------I 635
            + K                  SSN    S ++    +NS + N  N +           +
Sbjct: 683  KSKASNSNSNMNTNTTVNANISSNTIPSSDVSMKYETNSDSSNPTNSKSSLYKSSNSNIV 742

Query: 636  MSSTTS---------------------------ISERDSLI------EFFNDIDTLRRPI 662
            MSS+T+                           + + D ++      +FFN++++L+   
Sbjct: 743  MSSSTTSFATAISTTNNSISSNMDVDTELQNNGMEDEDEMLDNLSPQDFFNNLESLK--- 799

Query: 663  VSSMLTN--EAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKS 720
            +S  L N  E W ESLK++N+ SL C +IVL+KFL+GPL ++LPH LPW YFIIS+ L+ 
Sbjct: 800  LSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHMLPWSYFIISLALRI 859

Query: 721  SQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAE 780
              L +  S+ FW+  +++IFPW+++V+++N++I+ +LDN   + +I  L + YS+ NL E
Sbjct: 860  ESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMITKLINNYSNKNLDE 919

Query: 781  LLDVFKEKE-ELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGII 839
            LL  F E E ELPE+W C+G+LWFD I +     I S D  + + +KD   L+ PIDG+ 
Sbjct: 920  LLVEFNENEYELPEVWKCYGSLWFDVIAEN--YQIYSRDCSKNISMKDTKCLNYPIDGLP 977

Query: 840  FDVNDENGEKFWKRACRTIFLFRELSRSFQ--IGVIINNESSI--NRSSLQSNNILGNLS 895
            FD  +ENG  FWKR+CR IFLF+ +   F    G+ I++ +S+  NRS + +N+IL   +
Sbjct: 978  FDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSNTSVYCNRSDIPNNHILRTFA 1037

Query: 896  YKLEP 900
            +KL P
Sbjct: 1038 FKLLP 1042

 Score =  258 bits (658), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 162/335 (48%), Positives = 199/335 (59%), Gaps = 80/335 (23%)

Query: 921  FETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWYVP- 979
            FE  S  N DL+  P LS+I+  S+F Y GYK+  P+++ FDKNGE +S SLYTS  +  
Sbjct: 1150 FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDT 1209

Query: 980  -NGSN------NPETNIN------------SNCEKE---------NEGQFL-------EC 1004
             NGS+      N  TN N            SN  KE         N+  FL       + 
Sbjct: 1210 INGSSSNANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEKEIFNKI 1269

Query: 1005 LKSDDREID--------------LNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTT 1050
            L  D + ID               + TYFV DATSWLRH A ++KLA N +LKFAICLTT
Sbjct: 1270 LDPDYKNIDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTT 1329

Query: 1051 FQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITW 1110
            FQELRFLRKSKDENVMEAATR IIT+RQLY E ++LPLRFTGN+ATHIEE+LEFEEQITW
Sbjct: 1330 FQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITW 1389

Query: 1111 RTHVDEFVIESIMKAQ-EKLENANQ----------------------LPVSSCRFNYVIL 1147
            R+HVDEFVIE+I +AQ ++ +N NQ                      L V+   F   +L
Sbjct: 1390 RSHVDEFVIEAIKRAQLKRRDNRNQEDSNVTSSNNNPIINNNENNGNLNVTDMIF---VL 1446

Query: 1148 ISDDDTMKKKAEEKK----IKTLSTRFVFSLCTKL 1178
            ++DD +M KK +E+K    I T ST+FVFSLC  L
Sbjct: 1447 VTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  528 bits (1359), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 268/380 (70%), Positives = 303/380 (79%), Gaps = 43/380 (11%)

Query: 262 KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTF 321
           K SS ALIQKLQ++YK+IVKQEI+LQ+RCSQLT SQTT+LK+LWTIY+IN +L+NNY+ F
Sbjct: 392 KTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINF 451

Query: 322 ITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 381
           IT ALLP+Q ++DL IG+EI+EIYRIERRLWVYGTITFLDVLK+FSNFMDPEVCCQFI+H
Sbjct: 452 ITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISH 511

Query: 382 VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNH 441
           VF+++S +++DIP KYSI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+H
Sbjct: 512 VFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSH 571

Query: 442 GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 501
           GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNGN RN
Sbjct: 572 GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRN 631

Query: 502 SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGI---------------------- 539
             LIEYLKH+E MLLP+FLES DLQNVVL YF  KFGI                      
Sbjct: 632 LQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGANVN 691

Query: 540 ---------------------DANGCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQI 578
                                     +IF  +DMFIQNPD  KYFFRH+ +FAQSHILQ+
Sbjct: 692 IPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQL 751

Query: 579 VGFGEPKNPFAILFELPKHL 598
           VGFG+PKNPFA+LFELPK L
Sbjct: 752 VGFGDPKNPFALLFELPKFL 771

 Score =  409 bits (1051), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 244/579 (42%), Positives = 334/579 (57%), Gaps = 99/579 (17%)

Query: 650  EFFNDIDTLRRPIVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPW 709
            EFF +ID L+ P      T E WLESLK +N+ SLKC +IVL+KFL+GP+ IALPH L W
Sbjct: 867  EFFENIDLLQFPYKIPQ-TIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTW 925

Query: 710  IYFIISICLK-SSQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLD--NEMTSPII 766
            I+FIISI LK  + ++D  SK FW   +K I PW+++V F+N+L+  +LD  N+    +I
Sbjct: 926  IHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLI 985

Query: 767  GSLCDEYSDL---NLAELLDVFKEKEELPEIWGCWGTLWFDTICQKNTNS---------- 813
             SL ++Y+ +   +L E+L  F + E LPEIW CWGTLWFD IC KN NS          
Sbjct: 986  ISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNN 1045

Query: 814  -----------------ISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACR 856
                               +D     +GI+D+  LD P+DGI F  NDE+G  F+KR+ R
Sbjct: 1046 NTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIR 1105

Query: 857  TIFLFRELSRSF-QIGVIINNESS--INRSSLQSNNILGNLSYKLEPL------------ 901
             IFL + +  +F  +G+ I++E+S     + +  N IL N ++KL  L            
Sbjct: 1106 LIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTE 1165

Query: 902  -----------STLGSSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGG-SIFNYT 949
                         L  +   L+ +     + E   E N++L   P LS++ G  +IFNY 
Sbjct: 1166 QNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYL 1225

Query: 950  GYKKLCPNYTCFDKNGEFLSASLYTSW------------------YVPNGSNNPETNINS 991
            GYK+L  N   F +NGE +S S+Y+SW                  ++ N S     N+  
Sbjct: 1226 GYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNENVTV 1285

Query: 992  NCEKENEGQFLECLK----------SDDRE----------IDLNTTYFVFDATSWLRHSA 1031
                  +  F E +K          S++ +          I+ + T+FVFDATSWLRH A
Sbjct: 1286 GDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRHFA 1345

Query: 1032 RIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFT 1091
             I+KL++N  LKFA+CLTTFQELRFLRKSKD NV+EA+TR IIT+RQLY E K+LPLRFT
Sbjct: 1346 HIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRFT 1405

Query: 1092 GNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLE 1130
            GNVAT IEE+LEFEEQITWR+HVDEFVIE+I+++QE+ +
Sbjct: 1406 GNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFK 1444

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5.706
            YIL151C
          Length = 962

 Score =  162 bits (411), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 210/927 (22%), Positives = 382/927 (41%), Gaps = 168/927 (18%)

Query: 304  LWTIYRINTELVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVL 363
            L  +++++T++V+ Y  FI  AL  +  Q DL+ G+E V   R+  RL  +     L+++
Sbjct: 144  LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203

Query: 364  KNFSNFM----------DPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAI 413
            +N+ N M          + +   +FI    + ++ M+ +IP K+   W   +GDL+R+ +
Sbjct: 204  ENYKNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLM 263

Query: 414  ALYPSSFIDWKLSAEHWY-----TEAMKYVYNHGK----------LYYHMSTVQQNTLEA 458
             L       ++L++ H Y       A+ Y  N+GK           Y+++S VQ ++L  
Sbjct: 264  LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323

Query: 459  FVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPS 518
             V L K +  + T        QL ID I  +   ++   NL+ S+    +      LL  
Sbjct: 324  IVTLSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQ--VNLKQSMGGTTILMKYFTLLSL 381

Query: 519  FLESPD------LQNVVLSYFVEKFG--IDANGCNIFNPEDMFIQNPD--FFKYFFRHAP 568
            F  S        ++   L YF  +F      N  ++  P +   +  +  +  ++F +AP
Sbjct: 382  FFGSTSSSQLSGMERSSLHYFWNEFANEYHLNYSSLRKPVNCKYRQKEINYSMFYFNNAP 441

Query: 569  SFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITESSTSNSRNE 628
             F+   I++ +   +  NPF  ++                KSS                 
Sbjct: 442  LFSLISIVETIIMNKKLNPFFCVY----------------KSS----------------- 468

Query: 629  NDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKFLNMTSLKCGM 688
              D+ EI S   S+S    LIE  +D                           T L    
Sbjct: 469  --DDFEIKS--VSLSNWKILIEQMDD---------------------------TLLHSNK 497

Query: 689  IVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIFPWDTMVTF 748
            ++ +KFL   + I+ P  LPW+ F IS+  + + ++D      W  +++ + PWD +VT+
Sbjct: 498  LLFKKFLMLNVAISQPFILPWLLFYISVASEVANVTDRHVLLLWKDLLQNLLPWDDIVTY 557

Query: 749  MNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWGTLWFDTICQ 808
            +N  I  V  + + S  + +L       +L +LL     +    EI  C G +WFD++  
Sbjct: 558  LNESIDMVNKHSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLAS 617

Query: 809  K-NTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFLFRELSRS 867
            K    SI++++    +  K Y A +   D +I+D +D+   K W RA   I L + +   
Sbjct: 618  KIKQASITTNESL--MKFKSYNASE---DSLIYDDDDQVYTKMWTRALLIILLIKNVIND 672

Query: 868  FQ--IGVIINNESSINRSSLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEGIIDVFETRS 925
            +   I V I  +S  N S +++++ L N     + L   G               FE  +
Sbjct: 673  YPELIDVSIRGQSLTNSSCIKNSDSLTN-----DYLFDWG---------------FELNN 712

Query: 926  ENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWYVPNGSNNP 985
             N +    + + ++     IF ++      P++  FDKNG+        S Y    SN+ 
Sbjct: 713  NNAV----IIDDTLHGRNRIFKFS----YIPDFQDFDKNGDITWGYSLISNYDYIYSNDF 764

Query: 986  ETNINSNCEKENEGQFLECL------KSDDREIDLNTTYFVFDATSWLRHSARIFKLAQN 1039
             +  + N  +    + L         KS      L   YF+ D  +WL+HS ++ +    
Sbjct: 765  NSEEDGNFFQRYSRRLLSAHNDYSEDKSKKYLPKLENNYFMVDTLAWLKHSNKLKRFIAE 824

Query: 1040 RLLKFAICLTTFQELRFLRK-SKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHI 1098
              +K  + ++   +L  L+  S+ E+V  +A+R +I I  LY  N++  L+         
Sbjct: 825  EKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLYAMNQINILK--------- 875

Query: 1099 EENLEFEEQITWRTHVDEFVIESIMKAQEKLEN---------ANQLPVSSCRFNYVILIS 1149
                EFE  I+    +       I+    K +N           QL +   R + V+++S
Sbjct: 876  ----EFESPIS--KALKNIDGSQILNFNGKFKNDLLTKENGPGQQLNMIELRMDNVVVVS 929

Query: 1150 DDDTMKKKAEEKKIKTLSTRFVFSLCT 1176
            DD       ++K    +ST+ +FS+ +
Sbjct: 930  DDKLSLATFKKKGYNVVSTKVLFSVAS 956

>ZYRO0A05632g Chr1 (457286..458269) [984 bp, 327 aa] {ON} similar to
           uniprot|P26449 Saccharomyces cerevisiae YOR026W BUB3
           Kinetochore checkpoint WD40 repeat protein that
           localizes to kinetochores during prophase and metaphase
           delays anaphase in the presence of unattached
           kinetochores forms complexes with Mad1p-Bub1p and with
           Cdc20p binds Mad2p and Mad3p
          Length = 327

 Score = 35.8 bits (81), Expect = 0.61,   Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 33/74 (44%), Gaps = 6/74 (8%)

Query: 925 SENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWYVPNGSNN 984
           S N +  HA P LS      +F   GYK   P   C D  G+ L   L    ++P G N 
Sbjct: 51  SLNTVLRHAFPLLSCC---VLFPSGGYK---PEIYCGDVQGQVLLVDLELGKFIPMGGNT 104

Query: 985 PETNINSNCEKENE 998
            +  I+S C  +N+
Sbjct: 105 AQLGISSLCSYKNQ 118

>KLTH0D08800g Chr4 complement(734724..737456) [2733 bp, 910 aa] {ON}
           similar to uniprot|P35724 Saccharomyces cerevisiae
           YKL064W
          Length = 910

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 39/98 (39%), Gaps = 2/98 (2%)

Query: 497 GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGID--ANGCNIFNPEDMFI 554
           G LR   +  +    +  ++P F    D +NV L     + G D    G NI  P  +  
Sbjct: 328 GRLRPKKITPWHLRRKGSIIPGFSGQTDAKNVKLVSQTSRKGQDDFLVGSNIQYPPHIVS 387

Query: 555 QNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILF 592
            NP+ F++ +      +  H   I G  +P   F  LF
Sbjct: 388 NNPEHFRFTYFREDLDSTIHSPTISGLLQPGQKFEELF 425

>ZYRO0F01826g Chr6 complement(149490..151799) [2310 bp, 769 aa] {ON}
           similar to uniprot|P36120 Saccharomyces cerevisiae
           YKR024C DBP7 Putative ATP-dependent RNA helicase of the
           DEAD-box family involved in ribosomal biogenesis
          Length = 769

 Score = 33.9 bits (76), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 65/144 (45%), Gaps = 15/144 (10%)

Query: 188 KETESDDIHNEDGDDGADPNDLSNSENNNNYNNNNNNNINN-NNNNNTNNNNINNNEDDD 246
           K   +DD +N     G    +  NS  +NN N+NN   +++   +N   +  +N NE DD
Sbjct: 103 KGGNTDDANNAKESTGEKVVEFRNSGKSNNANSNNGQVVSSLFTSNREISTAVNTNERDD 162

Query: 247 NNEQEESNVYRPANN------KKSSIALIQKLQELYKVIVKQEIELQERCSQLT------ 294
           + EQ  SN     ++      K + ++ +++  ++ K    Q++ L    SQ T      
Sbjct: 163 STEQAPSNAPLSGDSFEDLGIKGALLSHLKEKMKIQKPTSIQKLVLSHLLSQWTGQNDDL 222

Query: 295 --NSQTTELKSLWTIYRINTELVN 316
             N+QT   K+L  +  I   +++
Sbjct: 223 FINAQTGSGKTLAFLLPIFARILD 246

>Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362W
           (REAL)
          Length = 736

 Score = 33.5 bits (75), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%)

Query: 226 INNNNNNNTNNNNINNNEDDDNNEQEESNVYRPANNKKSSI 266
           I N+N   T NNN      D+NN+QEE +  RP N ++  I
Sbjct: 457 IKNSNIGVTTNNNKQQTRTDENNDQEEQHKLRPQNQQQEKI 497

>KNAG0A01890 Chr1 complement(137589..143111) [5523 bp, 1840 aa] {ON}
           Anc_8.555 YPL082C gene spans a gap in the genome
           sequence
          Length = 1840

 Score = 33.5 bits (75), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 34/61 (55%), Gaps = 5/61 (8%)

Query: 598 LKERKDKKERKKSSNNESSITESSTSNS--RNENDDNDEIMSSTTSISERDSLIEFFNDI 655
           + +R+ K + K SSN    ITESS S S  + E+DDN    S TT ++ +   +E  + I
Sbjct: 209 MAKRRKKIQAKSSSNRPIDITESSVSKSLLKQEDDDNSNASSPTTLVNPK---MEITDQI 265

Query: 656 D 656
           D
Sbjct: 266 D 266

>Kwal_56.24037 s56 complement(822878..823306) [429 bp, 142 aa] {OFF}
           [contig 166] FULL
          Length = 142

 Score = 31.6 bits (70), Expect = 5.2,   Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 657 TLRRPIVSSMLTNEAWLESLKFLNMTS-LKCGMIVL 691
           TL +P + S LTNEA LE LK+L   S  KC + V+
Sbjct: 48  TLCQPYMFSCLTNEAKLECLKYLGSISWTKCSLFVM 83

>YJL129C Chr10 complement(173599..177306) [3708 bp, 1235 aa] {ON}
           TRK1Component of the Trk1p-Trk2p potassium transport
           system; 180 kDa high affinity potassium transporter;
           phosphorylated in vivo and interacts physically with the
           phosphatase Ppz1p, suggesting Trk1p acitivy is regulated
           by phosphorylation
          Length = 1235

 Score = 32.7 bits (73), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 39/65 (60%), Gaps = 2/65 (3%)

Query: 205 DPNDLSNSENNNN--YNNNNNNNINNNNNNNTNNNNINNNEDDDNNEQEESNVYRPANNK 262
           D  D  +S+ N++    +++NNN N+N ++ + ++ +  +E DDN E +E+N Y    + 
Sbjct: 201 DEQDSVHSDQNSHDISRDSSNNNTNHNGSSGSLDDFVKEDETDDNGEYQENNSYSTVGSS 260

Query: 263 KSSIA 267
            +++A
Sbjct: 261 SNTVA 265

>YJL016W Chr10 (405588..407273) [1686 bp, 561 aa] {ON} Putative
           protein of unknown function; GFP-fusion protein
           localizes to the cytoplasm; conserved in closely related
           Saccharomyces species
          Length = 561

 Score = 32.0 bits (71), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 31/75 (41%), Gaps = 20/75 (26%)

Query: 89  TNNASSQSEKTTLYNSRPN--PSARYLGSPKRALQRENSVEV----------------TR 130
            NN S  S  T L N  PN  P +R   SPK    R NS  V                TR
Sbjct: 314 ANNGSGDSSSTALNNESPNTTPKSRTFFSPKG--HRRNSSHVSSLTSRSTKKPITNFTTR 371

Query: 131 SSPLISKPASHNGKH 145
           ++ L+ +P  H+G H
Sbjct: 372 TNGLLIRPLPHHGVH 386

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 144,140,487
Number of extensions: 7774738
Number of successful extensions: 291883
Number of sequences better than 10.0: 5158
Number of HSP's gapped: 180570
Number of HSP's successfully gapped: 11813
Length of query: 1187
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1066
Effective length of database: 39,606,813
Effective search space: 42220862658
Effective search space used: 42220862658
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)