Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_11.3335.706ON1187118756250.0
Smik_11.3605.706ON118093640990.0
YKR096W5.706ON119593240430.0
Skud_11.3365.706ON118893140040.0
ZYRO0B16412g5.706ON137297928720.0
TDEL0B021405.706ON114793828490.0
KAFR0H001805.706ON124197427480.0
CAGL0G02541g5.706ON129596526910.0
SAKL0E15004g5.706ON119697826100.0
NCAS0A031705.706ON1319103725690.0
Kpol_1043.735.706ON126095925500.0
Kwal_55.196785.706ON117897425280.0
KLTH0E00968g5.706ON114897325120.0
TPHA0E001905.706ON136197524730.0
Suva_9.375.706ON111795724260.0
AFR290W5.706ON121797624120.0
YIL151C5.706ON111895123970.0
Ecym_40155.706ON125798123950.0
Skud_9.175.706ON111894323920.0
Smik_9.185.706ON111896123510.0
KLLA0A00528g5.706ON122997723260.0
CAGL0H06611g5.706ON1282103923120.0
KNAG0C066305.706ON128174322170.0
NDAI0E050705.706ON155638013521e-162
TBLA0E017105.706ON152641311581e-135
TPHA0D046405.706ON9625142562e-21
ZYRO0A05632g5.615ON32774860.14
KLTH0D08800g2.601ON91098772.7
YJL016W5.164ON56175729.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_11.333
         (1187 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...  2171   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...  1583   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...  1561   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...  1546   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1110   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1102   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...  1063   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...  1041   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...  1009   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...   994   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...   986   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...   978   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...   972   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   957   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   939   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...   933   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   927   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...   927   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   926   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   910   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...   900   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   895   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...   858   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   525   e-162
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   450   e-135
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...   103   2e-21
ZYRO0A05632g Chr1 (457286..458269) [984 bp, 327 aa] {ON} similar...    38   0.14 
KLTH0D08800g Chr4 complement(734724..737456) [2733 bp, 910 aa] {...    34   2.7  
YJL016W Chr10 (405588..407273) [1686 bp, 561 aa] {ON} Putative p...    32   9.2  

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score = 2171 bits (5625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1068/1187 (89%), Positives = 1068/1187 (89%)

Query: 1    MPEISVQNPLRLSENGNARSMFLSASQPQRPSTASSFPMSVHNAARLDLSNFQVLNSSAK 60
            MPEISVQNPLRLSENGNARSMFLSASQPQRPSTASSFPMSVHNAARLDLSNFQVLNSSAK
Sbjct: 1    MPEISVQNPLRLSENGNARSMFLSASQPQRPSTASSFPMSVHNAARLDLSNFQVLNSSAK 60

Query: 61   RQNSNSVNEDINSSKRRISRPNFLDIEYTNNASSQSEKTTLYNSRPNPSARYLGSPKRAL 120
            RQNSNSVNEDINSSKRRISRPNFLDIEYTNNASSQSEKTTLYNSRPNPSARYLGSPKRAL
Sbjct: 61   RQNSNSVNEDINSSKRRISRPNFLDIEYTNNASSQSEKTTLYNSRPNPSARYLGSPKRAL 120

Query: 121  QRENSVEVTRSSPLISKPASHNGKHIAYDKHTTGXXXXXXXXXXXXAYVEAEPDGQSSNE 180
            QRENSVEVTRSSPLISKPASHNGKHIAYDKHTTG            AYVEAEPDGQSSNE
Sbjct: 121  QRENSVEVTRSSPLISKPASHNGKHIAYDKHTTGSNSLLNMSKSSLAYVEAEPDGQSSNE 180

Query: 181  IIENFQHKETESDDIHNEDGDDGADPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
            IIENFQHKETESDDIHNEDGDDGADP                                  
Sbjct: 181  IIENFQHKETESDDIHNEDGDDGADPNDLSNSENNNNYNNNNNNNINNNNNNNTNNNNIN 240

Query: 241  XXXXXXXXXXXXXXVYRPANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTE 300
                          VYRPANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTE
Sbjct: 241  NNEDDDNNEQEESNVYRPANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTE 300

Query: 301  LKSLWTIYRINTELVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFL 360
            LKSLWTIYRINTELVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFL
Sbjct: 301  LKSLWTIYRINTELVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFL 360

Query: 361  DVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSF 420
            DVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSF
Sbjct: 361  DVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSF 420

Query: 421  IDWKLSAEHWYTEAMKYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQ 480
            IDWKLSAEHWYTEAMKYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQ
Sbjct: 421  IDWKLSAEHWYTEAMKYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQ 480

Query: 481  LVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGID 540
            LVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGID
Sbjct: 481  LVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGID 540

Query: 541  ANGCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXX 600
            ANGCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHL  
Sbjct: 541  ANGCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKE 600

Query: 601  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSSTTSISERDSLIEFFNDIDTLRR 660
                                               MSSTTSISERDSLIEFFNDIDTLRR
Sbjct: 601  RKDKKERKKSSNNESSITESSTSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRR 660

Query: 661  PIVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKS 720
            PIVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKS
Sbjct: 661  PIVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKS 720

Query: 721  SQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAE 780
            SQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAE
Sbjct: 721  SQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAE 780

Query: 781  LLDVFKEKEELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIF 840
            LLDVFKEKEELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIF
Sbjct: 781  LLDVFKEKEELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIF 840

Query: 841  DVNDENGEKFWKRACRTIFLFRELSRSFQIGVXXXXXXXXXXXXLQSNNILGNLSYKLEP 900
            DVNDENGEKFWKRACRTIFLFRELSRSFQIGV            LQSNNILGNLSYKLEP
Sbjct: 841  DVNDENGEKFWKRACRTIFLFRELSRSFQIGVIINNESSINRSSLQSNNILGNLSYKLEP 900

Query: 901  LSTLGSSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTC 960
            LSTLGSSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTC
Sbjct: 901  LSTLGSSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTC 960

Query: 961  FDKNGEFLSASLYTSWYVPNGSNNPETNINSNCEKENEGQFLECLKSDDREIDLNTTYFV 1020
            FDKNGEFLSASLYTSWYVPNGSNNPETNINSNCEKENEGQFLECLKSDDREIDLNTTYFV
Sbjct: 961  FDKNGEFLSASLYTSWYVPNGSNNPETNINSNCEKENEGQFLECLKSDDREIDLNTTYFV 1020

Query: 1021 FDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLY 1080
            FDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLY
Sbjct: 1021 FDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLY 1080

Query: 1081 YENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSC 1140
            YENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSC
Sbjct: 1081 YENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSC 1140

Query: 1141 RFNYVILISDDDTMXXXXXXXXXXTLSTRFVFSLCTKLGEQRHLCTD 1187
            RFNYVILISDDDTM          TLSTRFVFSLCTKLGEQRHLCTD
Sbjct: 1141 RFNYVILISDDDTMKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD 1187

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score = 1583 bits (4099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 767/936 (81%), Positives = 817/936 (87%), Gaps = 5/936 (0%)

Query: 257  RPANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVN 316
            +PANNK+S IALIQKLQELY+VIVKQEIELQERCSQLTNSQTTELKSLWTIY+INTELVN
Sbjct: 245  KPANNKRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVN 304

Query: 317  NYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 376
            NYVTFITTALLPSQP HDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC
Sbjct: 305  NYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 364

Query: 377  QFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK 436
            QFITHVF+SLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK
Sbjct: 365  QFITHVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK 424

Query: 437  YVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN 496
            Y YNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN
Sbjct: 425  YTYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN 484

Query: 497  GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQN 556
            GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYF+EKFGIDANGCNIFN EDMFIQN
Sbjct: 485  GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQN 544

Query: 557  PDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXXXXXXXXXXXXXXXX 616
            PDFFKYFFRH PSFAQSHILQIVGFGEPKNPFAILFELPK+L                  
Sbjct: 545  PDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKTSNNDSS 604

Query: 617  XXXXXXXXXXXXXXXXXXXMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESL 676
                               MSSTTS+S+ D L+EFFNDIDTLRRPI+ SMLTNEAWLE+L
Sbjct: 605  VTESSTGNSRNGNEDDDETMSSTTSMSDPDLLVEFFNDIDTLRRPILPSMLTNEAWLETL 664

Query: 677  KFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIV 736
            KFLNMTSLKCGMIVLRKFLHGPLG+ALPH LPWIYFIISICLKS+QL+DPISKEFWIVI+
Sbjct: 665  KFLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVII 724

Query: 737  KRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWG 796
            KR+FPWDTMVTFMN+LIA +LDNE ++ IIG LC+EYS LNL+ELL+ F E E+LPEIWG
Sbjct: 725  KRMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNENEDLPEIWG 784

Query: 797  CWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACR 856
            CWGTLWFD ICQKNT+SISS+D+F+E+GI+DYMALDSP DGIIFD  DENGEKFWKRACR
Sbjct: 785  CWGTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACR 844

Query: 857  TIFLFRELSRSFQIGVXXXXXXXXXXXXLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEG 916
             IFLFRE+SRSF +GV            LQSNNIL +L YKLEPL+ + SS+P L+TLE 
Sbjct: 845  IIFLFREVSRSFPLGVIVRHDPLVNCSSLQSNNILRDLVYKLEPLTNIRSSVPVLSTLES 904

Query: 917  IIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSW 976
            I D+ E RSE N DLHAVPELSVI G +IF+Y GYKKL P+YTCFDKNGEFLSASLYTSW
Sbjct: 905  IFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSW 964

Query: 977  YVPNGSNNPETNINSNCEKENEGQFLECLKSDD-----REIDLNTTYFVFDATSWLRHSA 1031
            YVPN +NN ETNI+   E+ENE  FLEC+KS        EID  TTYFVFDATSWLRHSA
Sbjct: 965  YVPNCNNNLETNISYANERENEALFLECMKSVHPEIAYPEIDFKTTYFVFDATSWLRHSA 1024

Query: 1032 RIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFT 1091
            RIFKLAQNRLL+FAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLY E+KVLPLRFT
Sbjct: 1025 RIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYCEDKVLPLRFT 1084

Query: 1092 GNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSCRFNYVILISDD 1151
            GNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENA Q  +SS RFNYV+LISDD
Sbjct: 1085 GNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENAKQPNISSHRFNYVVLISDD 1144

Query: 1152 DTMXXXXXXXXXXTLSTRFVFSLCTKLGEQRHLCTD 1187
            DTM          TLSTRFVFSLCTKLGEQRHLCTD
Sbjct: 1145 DTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD 1180

 Score =  197 bits (501), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 139/200 (69%), Gaps = 2/200 (1%)

Query: 1   MPEISVQNPLRLSENGNARSMFLSASQPQRPSTASSFPMSVHNAA-RLDLSNFQVLNSSA 59
           MP+ SVQNP+RLSEN N RS+FLS SQPQRPS  SSFP  VHNA  RL+LS+FQVLN S 
Sbjct: 1   MPKTSVQNPIRLSENENTRSIFLSISQPQRPSNISSFPRLVHNATTRLELSDFQVLNPSF 60

Query: 60  KRQNSNSVNEDINSSKRRISRPNFLDIEYTNNASSQSEKTTLYNSRPNPSARYLGSPKRA 119
           KRQNSNSVN+DIN SKRRISR  F + E  N+ S+QSEKTT  +SR N S +++G  K +
Sbjct: 61  KRQNSNSVNDDINCSKRRISRSKFSNSEDRNDDSTQSEKTTTNHSRSNKSFKFMGRQKLS 120

Query: 120 LQRENSVEVTRSSPLISKPASHNGKHIAYDKH-TTGXXXXXXXXXXXXAYVEAEPDGQSS 178
           +Q EN VEVT+SS L+SKP +   K+  Y+K  +              A+V+ E DGQS+
Sbjct: 121 MQEENLVEVTQSSALLSKPLNKQSKNTTYEKRGSQNVVKPKNISKSSFAFVDGESDGQSN 180

Query: 179 NEIIENFQHKETESDDIHNE 198
           N I+ NFQ + + S+++ +E
Sbjct: 181 NGIVSNFQRESSNSENVCDE 200

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score = 1561 bits (4043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 762/932 (81%), Positives = 815/932 (87%), Gaps = 1/932 (0%)

Query: 257  RPANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVN 316
            +PA+NK+S IALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIY+INT+LVN
Sbjct: 264  KPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVN 323

Query: 317  NYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 376
            NYVTFITTALLPSQP HDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC
Sbjct: 324  NYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 383

Query: 377  QFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK 436
            QFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK
Sbjct: 384  QFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK 443

Query: 437  YVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN 496
            Y+YNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN
Sbjct: 444  YIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN 503

Query: 497  GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQN 556
            GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYF+EKFGIDANGCNIFN EDMF+QN
Sbjct: 504  GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQN 563

Query: 557  PDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXXXXXXXXXXXXXXXX 616
            PDFFKYFFRH PSFAQSHILQIVGFGEPKNPFAILFELPK+L                  
Sbjct: 564  PDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSS 623

Query: 617  XXXXXXXXXXXXXXXXXXXMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESL 676
                               MSSTTSIS+ D L EFFNDIDTLRRPI+ SMLTNEAWLE+L
Sbjct: 624  VTESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPILPSMLTNEAWLETL 683

Query: 677  KFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIV 736
            KFLNMTSLKCG+IVLRKFLHGPLGIALPH LPWIYFIISICLKSSQLSDP+SKEFW++IV
Sbjct: 684  KFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIV 743

Query: 737  KRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWG 796
            KR FPWDTMVTFMN+LI  +LDN+ ++ IIG LCD+Y  L+L+ELL++F E EELPEI G
Sbjct: 744  KRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEELPEILG 803

Query: 797  CWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACR 856
            CWGTLWFDTIC+KNT+SISS+D+F+E+GIKDYMALDSP DGIIFD  DENGEKFWKRACR
Sbjct: 804  CWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACR 863

Query: 857  TIFLFRELSRSFQIGVXXXXXXXXXXXXLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEG 916
            TIFLFRELSRSF IGV             Q+ NILG+L +KLEPL  + ++IP L  LE 
Sbjct: 864  TIFLFRELSRSFPIGVIIRNDPLIYRSSFQNTNILGSLVFKLEPLCNIHNNIPVLGALES 923

Query: 917  IIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSW 976
            IID+ E RSENN DLHAVPELSV +G +IF+Y GYKKL  +YTCFDKNGEFLSASLYT+W
Sbjct: 924  IIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTTW 983

Query: 977  YVPNGSN-NPETNINSNCEKENEGQFLECLKSDDREIDLNTTYFVFDATSWLRHSARIFK 1035
            YVPN +N N E NIN N EKENEG FLEC+KSD  EID  TTYFVFDATSWLRHSARIFK
Sbjct: 984  YVPNSNNTNIEDNINYNSEKENEGLFLECIKSDYPEIDFKTTYFVFDATSWLRHSARIFK 1043

Query: 1036 LAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVA 1095
            LAQNRLL+FAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVA
Sbjct: 1044 LAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVA 1103

Query: 1096 THIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSCRFNYVILISDDDTMX 1155
            THIEENLEFEEQITWRTHVDEFVIES+MKAQEKLE+A++  +S  RFNYV+LISDDD M 
Sbjct: 1104 THIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESASEPRLSPRRFNYVVLISDDDAMK 1163

Query: 1156 XXXXXXXXXTLSTRFVFSLCTKLGEQRHLCTD 1187
                     TLSTRFVFSLCTKLGEQRHLCTD
Sbjct: 1164 KKAEEKEIKTLSTRFVFSLCTKLGEQRHLCTD 1195

 Score =  201 bits (511), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 136/201 (67%), Gaps = 2/201 (0%)

Query: 1   MPEISVQNPLRLSENGNARSMFLSASQPQRPSTASSFPMSVHNA-ARLDLSNFQVLNSSA 59
           MPE SVQNPLRLSEN N RSMFLSASQ QRPS   SFP  V N  A L LS+FQVLN S+
Sbjct: 1   MPETSVQNPLRLSENENTRSMFLSASQQQRPSATPSFPRLVRNTTANLSLSDFQVLNPSS 60

Query: 60  KRQNSNSVNEDINSSKRRISRPNFLDIEYTNNASSQSEKTTLYNSRPNPSARYLGSPKRA 119
           KRQNSNSV +DINSSKRRISRP F DIE  NN  +  E+TT+  S  NPS RY+ S KRA
Sbjct: 61  KRQNSNSVYDDINSSKRRISRPRFSDIEGKNNDHTYPERTTVKESEKNPSPRYVSSSKRA 120

Query: 120 LQRENSVEVTRSSPLISKPASHNGKHIAYDKHT-TGXXXXXXXXXXXXAYVEAEPDGQSS 178
           L+RENSV +T+SS LISK  S NG  IA++K +               A+V+A  D QS 
Sbjct: 121 LKRENSVGITQSSALISKSFSENGGSIAHEKWSPENMIKPLNVSQNSLAFVDAGSDEQSK 180

Query: 179 NEIIENFQHKETESDDIHNED 199
           +EI+  FQ K   S +I+++D
Sbjct: 181 SEIVGGFQRKSNNSQEINDKD 201

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score = 1546 bits (4004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 751/931 (80%), Positives = 803/931 (86%)

Query: 257  RPANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVN 316
            R AN+K+SSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTEL+N
Sbjct: 258  RSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELIN 317

Query: 317  NYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 376
            NYVTFITTALLPSQP HDL+IGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC
Sbjct: 318  NYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 377

Query: 377  QFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK 436
            QFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK
Sbjct: 378  QFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK 437

Query: 437  YVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN 496
            Y+YNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN
Sbjct: 438  YIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN 497

Query: 497  GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQN 556
            GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVV+SYFVEKFGIDANGCNIFNPEDMFIQN
Sbjct: 498  GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQN 557

Query: 557  PDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXXXXXXXXXXXXXXXX 616
            PDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPK+L                  
Sbjct: 558  PDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSS 617

Query: 617  XXXXXXXXXXXXXXXXXXXMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESL 676
                               MSST SIS+ D L EFFNDIDTLRRPI+ SMLT+EAWLE+L
Sbjct: 618  VTESSTGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPILPSMLTSEAWLETL 677

Query: 677  KFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIV 736
            KFLNMTSLKCGMIVLRKFLHGPLGIALPH LPWIYFII+ CLKS+QLSDP SK+FW++IV
Sbjct: 678  KFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIV 737

Query: 737  KRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWG 796
            KR+FPWDT+VTFMN+LIA +LDNE  +PIIG LC +Y  LNLA LL+ F E EELPEIW 
Sbjct: 738  KRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIWN 797

Query: 797  CWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACR 856
            CWGTLWFDTICQKN +SISSDD+F+E+GIKDYMALD+P DGIIFD  DE+GEKFWKRACR
Sbjct: 798  CWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACR 857

Query: 857  TIFLFRELSRSFQIGVXXXXXXXXXXXXLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEG 916
             IFLFRELSR+F IGV             QS+ IL NL YKLEPLS + S+ P L  LE 
Sbjct: 858  IIFLFRELSRTFPIGVIVSNDPLIKCSSSQSSIILRNLVYKLEPLSNIRSNTPILTALEN 917

Query: 917  IIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSW 976
             +D+ E RS+NNIDL+AVPELSV  G +IF+YTGYKKL P+YTCFD+NGEFLSASLYT W
Sbjct: 918  SVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYTRW 977

Query: 977  YVPNGSNNPETNINSNCEKENEGQFLECLKSDDREIDLNTTYFVFDATSWLRHSARIFKL 1036
            Y+PNG+N  E  +NS+ EK +E  FLEC+K D   ID  TTYFVFDATSWLRHSARIFKL
Sbjct: 978  YLPNGNNISEALVNSDIEKGDEDLFLECMKPDCPGIDFETTYFVFDATSWLRHSARIFKL 1037

Query: 1037 AQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVAT 1096
            AQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYE+KVLPLRFTGNVAT
Sbjct: 1038 AQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYEDKVLPLRFTGNVAT 1097

Query: 1097 HIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSCRFNYVILISDDDTMXX 1156
            HIEENLEFEEQITWRTHVDEFVIESI KAQEKLENA Q  V+    NYV+LISDDDTM  
Sbjct: 1098 HIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENAGQPHVTPRHSNYVVLISDDDTMKK 1157

Query: 1157 XXXXXXXXTLSTRFVFSLCTKLGEQRHLCTD 1187
                    TLST+FVFSLCTKLGE+RHLCTD
Sbjct: 1158 KAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD 1188

 Score =  239 bits (610), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 148/202 (73%), Gaps = 7/202 (3%)

Query: 1   MPEISVQNPLRLSENGNARSMFLSASQPQRPSTASSFPMSVHNAA-RLDLSNFQVLNSSA 59
           MPE SVQNPLRLSENGN RSMFLSASQPQRP     FPMSV NA  RLDLSNFQVLN SA
Sbjct: 1   MPEASVQNPLRLSENGNTRSMFLSASQPQRPP----FPMSVRNATTRLDLSNFQVLNPSA 56

Query: 60  KRQNSNSVNEDINSSKRRISRPNFLDIEYTNNASSQSEKTTLYNSRPNPSARYLGSPKRA 119
           KRQNS+SV  DINSSKRRI+   FLD+E   N S+ SE+T + +SRP PS RY  SPKR+
Sbjct: 57  KRQNSSSVYNDINSSKRRINESRFLDVEDNTNDSTPSERTIICHSRPKPSPRYSNSPKRS 116

Query: 120 LQRENSVEVTRSSPLISKPASHNGKHIAYDKHTTGXXXXXXXXXXXXAYVEAEPDGQSSN 179
           L+RENSVEVT S PLISKPAS +GK+ AYDK ++             A+V+AE DGQS+N
Sbjct: 117 LKRENSVEVTGSYPLISKPASQSGKNNAYDKRSSKNLSLLNPSKSSLAFVDAEADGQSNN 176

Query: 180 EIIENFQHKETESDDIHNEDGD 201
           +II NFQHK    + IH  DGD
Sbjct: 177 DIIGNFQHKSNNREHIH--DGD 196

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1110 bits (2872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/979 (57%), Positives = 688/979 (70%), Gaps = 68/979 (6%)

Query: 261  NKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVT 320
            +K+SS AL+QKLQ++YKVIVKQEIELQERCSQLT SQTTELK+LWTIY+IN++L+NNYVT
Sbjct: 410  SKRSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVT 469

Query: 321  FITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIT 380
            F+TTALLPSQ + D++IG+EIVEIYRIERRLWVYGTITFLD+ KNFSNFMDPEVCCQFIT
Sbjct: 470  FLTTALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCCQFIT 529

Query: 381  HVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYN 440
            HVF+S+S M+ DIP KY I WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+
Sbjct: 530  HVFISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 589

Query: 441  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLR 500
            HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TF PS QYMQLVIDNIYQRAFVERNNGN R
Sbjct: 590  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHR 649

Query: 501  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFF 560
            N+ LIEYLKHSE MLLPSFLES DLQ VVL YF  KFG D+N  NIF+   MF QNPD+ 
Sbjct: 650  NTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYL 709

Query: 561  KYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXXXXXXXXXXXXXXXXXXXX 620
            +YFFRHAP+FA+SHILQ+VGFG+PKNPFA+LFELP+ L                      
Sbjct: 710  RYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTKSTTVTETSS 769

Query: 621  XXXXXXXXXXXXXXXMSSTTSISERDSLIE-FFNDIDTLRRPI-VSSMLTNEAWLESLKF 678
                                  S+R S  E FF +I+TLR P  V S L  E W ESL +
Sbjct: 770  TMAIDDLEDEQ-----------SDRMSTPEGFFGNIETLRFPYSVPSNL--EIWNESLNY 816

Query: 679  LNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKR 738
            +NMTSLKC M+VL+KFL GPL +ALPHF+PW YFIIS+  K   L+   S++FW+  V R
Sbjct: 817  INMTSLKCSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDR 876

Query: 739  IFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCW 798
            IFPW+T+V+F+N+LIA +LDN   S ++ SLC +YS + L +LLD F   E LPE+W CW
Sbjct: 877  IFPWNTIVSFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCW 936

Query: 799  GTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTI 858
            GTLWFDTIC K  + +   +D E VGIK++M LD+PIDGI FD NDE+GE FWKRACR I
Sbjct: 937  GTLWFDTICNKEQSHV---EDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRII 993

Query: 859  FLFRELSRSFQIGVXXXXXXXX--XXXXLQSNNILGNLSYKLE-----PLSTLGSSIPT- 910
            FLF+ L+ +F IG+              +   +IL + S+KL       L  +    P+ 
Sbjct: 994  FLFKGLAENFPIGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPST 1053

Query: 911  ----LNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGE 966
                L+ L+  +++FE  S  NI +  +P LSVI+G SIF+Y GY++L P+Y  +DKNGE
Sbjct: 1054 TAIDLDHLKNTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGE 1113

Query: 967  FLSASLYTSWYVPNGSNN----PETNINSNCEKE-----------NE-------GQFLEC 1004
            FLSASLYTSWY  N +NN    P    + + +++           N+       G F + 
Sbjct: 1114 FLSASLYTSWYANNNTNNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADD 1173

Query: 1005 LKSDD---REIDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSK 1061
            L   D   +    +TTYFV D T+WLRH   I+KLA + +LKFAICLTTF ELRFLRK K
Sbjct: 1174 LFLRDALYQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPK 1233

Query: 1062 DENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIES 1121
            DENV+EAATR IIT+RQLY E K+LPLRFTGNVATHIEE+LEFEE+ITWR+HVDEFVIE+
Sbjct: 1234 DENVVEAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEA 1293

Query: 1122 IMKAQEKLENANQLPVSS-------------CRFNYVILISDDDTMXXXXXXXXXXTLST 1168
            + KAQ K +  NQL +                   +V+L++DD  M          T ST
Sbjct: 1294 VYKAQSKFQEMNQLQLEQEEQQHQLRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFST 1353

Query: 1169 RFVFSLCTKLGEQRHLCTD 1187
            +FVFSLC  +G +  +CT+
Sbjct: 1354 KFVFSLCNSIGLRSKICTN 1372

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1102 bits (2849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/938 (58%), Positives = 670/938 (71%), Gaps = 34/938 (3%)

Query: 261  NKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVT 320
            +KKSS AL+QKLQ++YKVIVKQEIELQERCSQLTNSQTTELK LW IY++N++L+NNYVT
Sbjct: 233  SKKSSQALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVT 292

Query: 321  FITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIT 380
            FITTALLP Q   DL IGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFIT
Sbjct: 293  FITTALLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFIT 352

Query: 381  HVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYN 440
            HVF+S+S M++DIPS+Y+I W QRLGDLSRMAIALYPS FIDWKLSAEHWY EAMKY+Y 
Sbjct: 353  HVFISISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYG 412

Query: 441  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLR 500
            HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQRAFVERNNGN R
Sbjct: 413  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHR 472

Query: 501  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFF 560
            NS LIEYLKHSE MLLPSFLES DLQ VVL YF +KFG+D N  NIF+   MF QNPD  
Sbjct: 473  NSQLIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQL 532

Query: 561  KYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXXXXXXXXXXXXXXXXXXXX 620
            KYFFRHAP+FA+SHILQ+VGFG+PKNPFA+LFELP+ L                      
Sbjct: 533  KYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRKTKSSVTTETSS 592

Query: 621  XXXXXXXXXXXXXXXMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKFLN 680
                               +S S    + +FF++ID+L  P +    + E W  SLK+LN
Sbjct: 593  AMAIDEEEYI--------DSSFSLGAQVQQFFDNIDSLTSPYLFPP-SLEVWNCSLKYLN 643

Query: 681  MTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIF 740
            +TSL C MIVL+KFL GP+ +ALPH LPW YFII++  K   ++D  S+EFW+ +V RIF
Sbjct: 644  ITSLHCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIF 703

Query: 741  PWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWGT 800
            PW+T+V F+N+LIA  LDN   S  I  LC+E S + L +L++ F   E+LPE+W CWG 
Sbjct: 704  PWNTIVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGL 763

Query: 801  LWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFL 860
            LWFD IC K+   +   D +E  GIKD+M LD PIDGI FD +DE+G KFWKRACR IFL
Sbjct: 764  LWFDAICDKDKVQM---DSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFL 820

Query: 861  FRELSRSFQIGVXXXXXXXXXXXXLQS-NNILGNLSYKLEPLSTLGSSIPTLNTLEGIID 919
            F+ ++ +FQ  +                N++L +  +KL       +S+     L+  I+
Sbjct: 821  FKRIAENFQTRLVVSSQAQVHCRRTDPMNHVLKSFCFKLRDTFYNSNSV-----LQNTIE 875

Query: 920  VFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWYVP 979
            VFE  S+ N D+   P+LSV++  SIF Y GYK+L  + +C+D+ GEF+S SLYTSW   
Sbjct: 876  VFEEGSDANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNE 935

Query: 980  NGSNNPETNINSNCEKENEGQ-FLECLKSDDREIDLN---------TTYFVFDATSWLRH 1029
               N    +  +  +  NE   F+E + +   E +++          T+FV DATSWLRH
Sbjct: 936  TSKNEIPQSEPTQQQTANEADLFIEGINTSLTEFNIDFPECKMNGKDTFFVLDATSWLRH 995

Query: 1030 SARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLR 1089
             A ++KLA N++L+FAICLTTFQELRFLRKSKDENV+EAATR +IT+RQLY EN++LPLR
Sbjct: 996  FAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILPLR 1055

Query: 1090 FTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSCRFNYVILIS 1149
            FTGNVATHIEE+LEFEEQITWR+HVDEFV E+I KAQ +L   N+       F++V+L++
Sbjct: 1056 FTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQENR------DFHHVVLVT 1109

Query: 1150 DDDTMXXXXXXXXXXTLSTRFVFSLCTKLGEQRHLCTD 1187
            DD  M          TLSTRFVF+ C  +G +  +CT+
Sbjct: 1110 DDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score = 1063 bits (2748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/974 (55%), Positives = 673/974 (69%), Gaps = 58/974 (5%)

Query: 262  KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTF 321
            KK+S  LI+KLQ +YK+IVKQE+ELQ+RCSQLT SQTTELK+LW+IY++NT+L+NNY+TF
Sbjct: 278  KKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITF 337

Query: 322  ITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 381
            ITTALLPSQ   D+ IG+EIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFITH
Sbjct: 338  ITTALLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 397

Query: 382  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNH 441
            VF+SLSTM+ D+P K+SI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+H
Sbjct: 398  VFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 457

Query: 442  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN-NGNLR 500
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQR FV+RN NGN+R
Sbjct: 458  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVR 517

Query: 501  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFF 560
            NS LI+YLKHSE MLLPSFLE+ DLQ VVL+YF ++FG+D N  NIF  +DMF Q P   
Sbjct: 518  NSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPASL 577

Query: 561  KYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXXXXXXXXXXXXXXXXXXXX 620
            +++FRHAP+FA+SHILQ+VGFG PKNPFA+LF+LP  L                      
Sbjct: 578  RFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFL-----KERKDKKEKNKSKSSTE 632

Query: 621  XXXXXXXXXXXXXXXMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKFLN 680
                           ++++  ++E + + E+F++ID+LR PI    +    WL+SL+ LN
Sbjct: 633  ISTMSIDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHPNIL--VWLKSLEHLN 690

Query: 681  MTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIF 740
            MTSLKC +IVLRKFL GPL IALPH LPW YFII+  LK+    +  S +FW ++++RI 
Sbjct: 691  MTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRIL 750

Query: 741  PWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDL-NLAELLDVFKEKEELPEIWGCWG 799
            PW+T+ +F+N+L+A +LDN   +  I  LC+ YS+  N  ELLD F   E LPEIW CWG
Sbjct: 751  PWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWG 810

Query: 800  TLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIF 859
            TLWFD I  K      + D F  +GI+D+M LD P+DGI FD  DE GE FW RA R +F
Sbjct: 811  TLWFDVISNKRA---LNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVF 867

Query: 860  LFRELSRSFQIG--VXXXXXXXXXXXXLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEGI 917
            LF+ ++ + Q G  V            +  N+IL + S+K+E       S    +T+  +
Sbjct: 868  LFKGIAENLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTINKL 927

Query: 918  IDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWY 977
            + +FE   E N+D  A P LSV+KG +IF Y GYKKL  N   FD+NGE +S+S+YT+W 
Sbjct: 928  LPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWV 987

Query: 978  VPNGS--NN---------------------PET------NINSNCEKENEGQF------- 1001
            + N +  NN                     PE       N  SN + E++  F       
Sbjct: 988  IDNDNSLNNSQGNQYTSNMQMTQQQRQLLPPEQQNFQMRNFASNEDTEDDFNFELYMNPE 1047

Query: 1002 --------LECLKSDDREIDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQE 1053
                         + + EI+ N TYFVFDATSWLRH A I+KL+ N +L FA+CLTTFQE
Sbjct: 1048 KLNKNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQE 1107

Query: 1054 LRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTH 1113
            LRFLRKSKDENV+ AA R IIT+RQLY E K+LPLRFTGNVAT IEE+LEFEEQITWR+H
Sbjct: 1108 LRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSH 1167

Query: 1114 VDEFVIESIMKAQEKLENANQLPVSSCRFNYVILISDDDTMXXXXXXXXXXTLSTRFVFS 1173
            VDEFVIE+++KAQ K  +AN+       FN+V+L++DD  M          T +T F+FS
Sbjct: 1168 VDEFVIEAVVKAQNKFISANESVTLRKGFNHVVLVTDDINMKRKAQEQGIKTFTTHFIFS 1227

Query: 1174 LCTKLGEQRHLCTD 1187
            +C KLG Q ++CT+
Sbjct: 1228 VCRKLGIQDNVCTN 1241

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score = 1041 bits (2691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/965 (55%), Positives = 683/965 (70%), Gaps = 62/965 (6%)

Query: 257  RPANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVN 316
            +  N+ K + AL+QKLQ++YK IV+QE+ELQE+C+QLT+SQTT+L S+W+IYRIN ELV 
Sbjct: 359  KANNSNKPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVT 418

Query: 317  NYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 376
            NYVTFI+TALL SQ Q+DL+IGQEIVE YRI RRLWVYGTITFLDVLKNFS+FMDPEVC 
Sbjct: 419  NYVTFISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCS 478

Query: 377  QFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK 436
            QFITHVF+S+STM++DIP+KYSI W+QRLGDLSRMAIALYPS FIDWKLS+E+WY +A+K
Sbjct: 479  QFITHVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALK 538

Query: 437  YVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN 496
            Y Y +GKLYYHMST+QQNTLEAFVNLGKSVFCQ+TF PSPQYMQLVIDNIYQRAF+ER +
Sbjct: 539  YTYGYGKLYYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGS 598

Query: 497  GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQN 556
             N RNS LIEYLKHSE MLLP+F+ + +LQ VV++YF  KFG D +  NIF P D+F+QN
Sbjct: 599  NNTRNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQN 658

Query: 557  PDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXXXXXXXXXXXXXXXX 616
            P+  KYFFRHAP+FA+SHILQ VGFG+ KNPFA+LF+LPK                    
Sbjct: 659  PENLKYFFRHAPAFAESHILQTVGFGDSKNPFALLFDLPK--------------FLKEKK 704

Query: 617  XXXXXXXXXXXXXXXXXXXMSSTTSISERDSLI---EFFNDIDTLRRPIVSSMLTNEAWL 673
                               + S  +IS  DSLI   ++F+++++++ P +      + WL
Sbjct: 705  DKKDRKKTKSSGEPTSNESVMSLDNIS-TDSLISSDQYFSNLESMQHPYLPPPRY-DIWL 762

Query: 674  ESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWI 733
            +SL +LN+T+++CG+IVLRKFLHGP  +ALPH + W YFIIS+CLKS  L D  S+ FW 
Sbjct: 763  KSLSYLNLTAVQCGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWS 822

Query: 734  VIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPE 793
              ++R+ P +++V+F+N+LIA  LDN   S +I S+ +E   ++L ELL  F   EELPE
Sbjct: 823  SFMRRLLPLNSIVSFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPE 882

Query: 794  IWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKR 853
            +W CWGTLWFD I  K+    +S   +E++G+ D++  DSPIDGI+FD  DENGEKFWKR
Sbjct: 883  VWKCWGTLWFDAITDKSNTDTNS---YEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKR 939

Query: 854  ACRTIFLFRELSRSFQIGVXXXXXXXX--XXXXLQSNNILGNLSYKLEPLSTLGSSIPT- 910
            A R IFLF++++ +F IG+              ++ N+ILG+ S+K+E     G+++   
Sbjct: 940  ALRIIFLFKKIAETFDIGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVE 999

Query: 911  -LNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLS 969
              N L  II++ E  +E NI + A P +S+ +  +IF YTGYK++ P    FDKNGE  S
Sbjct: 1000 IENCLGAIIEMTEMPNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRS 1059

Query: 970  ASLYTSWY-----VPNGSNNPETNINSNC--------------------EKENEGQFLEC 1004
            A+ YTSWY     VP  + +PE ++  +                     E+EN    L+ 
Sbjct: 1060 AANYTSWYSAQEIVPKSAASPENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLDG 1119

Query: 1005 LKSDDREIDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDEN 1064
            L       +L TT FV DATSWLRHSA I+KLA N  L F+ICLTTFQELRFLRKSKDEN
Sbjct: 1120 L-------NLETTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDEN 1172

Query: 1065 VMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMK 1124
            VMEAA R II IRQLY + KV+PLRFTGN+ATHIEE+LEFEEQITWR+HVDEFVIESI K
Sbjct: 1173 VMEAAARAIIIIRQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISK 1232

Query: 1125 AQEK-LENANQLPV-SSCRFNYVILISDDDTMXXXXXXXXXXTLSTRFVFSLCTKLGEQR 1182
            AQ+K L+   Q PV +  RF   +L+SDD+ M          T +TRFVF+LC+++G+ R
Sbjct: 1233 AQKKFLQPFVQNPVDNDSRF--FVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGR 1290

Query: 1183 HLCTD 1187
             +CT+
Sbjct: 1291 LICTN 1295

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score = 1009 bits (2610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/978 (52%), Positives = 667/978 (68%), Gaps = 77/978 (7%)

Query: 262  KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTF 321
            K +S AL+QKLQ++Y+ IVKQEIELQERCSQLTNSQTT++K+LW IY++N EL+NNY++F
Sbjct: 240  KHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISF 299

Query: 322  ITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 381
            ITTALLPSQP+ DL+IGQEIVEIYR+ERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI+H
Sbjct: 300  ITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISH 359

Query: 382  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNH 441
            VF+S+S M+ D+P +YSI WL+RLGDLSRMAIALYPS FIDWKLSAEHWY++A+ Y Y H
Sbjct: 360  VFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGH 419

Query: 442  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 501
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TF PS QYMQLVIDNIYQRAF ER+ G+ RN
Sbjct: 420  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRN 479

Query: 502  SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFFK 561
              ++EYLKHSE MLLPSFLESP+LQ VVL++F ++FG+  N  + F+ + +FIQ+ +  +
Sbjct: 480  FPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLR 539

Query: 562  YFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXXXXXXXXXXXXXXXXXXXXX 621
            YFF HAP+FA+SHILQ+VGFG+P+NPFAILFELPK L                       
Sbjct: 540  YFFSHAPAFAESHILQLVGFGDPRNPFAILFELPKFLKERKERKERRRSKSSPPLPTNLD 599

Query: 622  XXXXXXXXXXXXXXMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKFLNM 681
                           + ++SI    S+  +F +ID+ R P  S     + W +SL +LN+
Sbjct: 600  DG-------------NGSSSI----SVDHYFENIDSHRVP-YSFPQDIQIWQQSLSYLNL 641

Query: 682  TSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIFP 741
            TS++C M VL+KFLH PL  ALPH LPW +F++S+ ++ S LS    K+FW+V ++RIFP
Sbjct: 642  TSMECSMSVLKKFLHAPLLTALPHLLPWAHFLVSVAIRISSLSSDALKKFWLVFMRRIFP 701

Query: 742  WDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWGTL 801
            W+++V+F+N L+A +LDN      +  LC+EY+ ++L  L++ F   EELPE+W CWGTL
Sbjct: 702  WNSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTL 761

Query: 802  WFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFLF 861
            WFDTI  K+    SS    +  GI+D++ LD+PIDGI FD +DE+G KFWKRACR IF+F
Sbjct: 762  WFDTISNKSELKASS---VQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMF 818

Query: 862  RELSRSFQIGVXXXXXXXXXXXXLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEGIIDVF 921
            + +++ F  G+            + + + L   S+K E L     +   L + +  I VF
Sbjct: 819  KGMAKEFHYGIRVSDTPISTRRDVTTLHALKRFSFKFEELPQEWDNEVFLQS-DNFIKVF 877

Query: 922  ETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSW----- 976
            E  S  N +  AVP LS+I G SIF + GY+++ P+Y CF+KNG+ ++ SLYTS      
Sbjct: 878  EPISPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERV 937

Query: 977  ------------YVPNG-------------SNNPETNINSNCEKE----NEGQFLECLKS 1007
                        +V NG                PET +     K      +  F+E L+ 
Sbjct: 938  AIQGGDDFNVKRHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLR- 996

Query: 1008 DDR--------EIDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRK 1059
            D R          D N TYFV DATSWLRH A ++KLA N +LKFAICLTTFQELRFLRK
Sbjct: 997  DSRFPHGDLACNADSNVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRK 1056

Query: 1060 SKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVI 1119
            SKDE+V+EAATR +IT RQLYYE K+LPLRFTGN+ATH+EE+LEFEEQITWR+HVDEFVI
Sbjct: 1057 SKDESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVI 1116

Query: 1120 ESIMKAQEKLENAN------------QLPVSSCRFNYVILISDDDTMXXXXXXXXXXTLS 1167
            E++ K+Q K +  N              P    +FN+V+L++DD  M            S
Sbjct: 1117 EAVYKSQRKFKGLNLQARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFS 1176

Query: 1168 TRFVFSLCTKLGEQRHLC 1185
            +RF+F+ C +LG  + +C
Sbjct: 1177 SRFMFAFCNQLGYNQKVC 1194

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score =  994 bits (2569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/1037 (53%), Positives = 668/1037 (64%), Gaps = 122/1037 (11%)

Query: 262  KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTF 321
            KK+  AL++KLQ++YKVIVKQEIELQERCSQLT SQTT+LK+LWTIY++N +L+NNYVTF
Sbjct: 294  KKTGEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTF 353

Query: 322  ITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 381
            ITTALL SQ Q DL IG+EI+EIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH
Sbjct: 354  ITTALLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 413

Query: 382  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNH 441
            VF+SLSTM++DIP+KYSI WLQRLGDLSRMAIALYPS FIDWKLSAE WY EAMK+ YNH
Sbjct: 414  VFISLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNH 473

Query: 442  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 501
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNGN RN
Sbjct: 474  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRN 533

Query: 502  SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGI-------------------DAN 542
              LIEYLKHSE MLLP+FLE+ +LQ VVL YF EKFGI                   +  
Sbjct: 534  LQLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTR 593

Query: 543  GCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXX 602
              ++F   DMFIQNP+  KYFFRHAP+FA+SHILQ+VGFG+PKNPFA+LFELPK+L    
Sbjct: 594  TIDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYL---- 649

Query: 603  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSSTTSISERDSLIEFFND-------- 654
                                             MS   S    D +   F+D        
Sbjct: 650  -KERKDKKEKKKSKSNSNSNNNNNASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTS 708

Query: 655  ------IDTLRRP--IVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHF 706
                  I+ LR    I +S+   E W+ SL  +N+ SLKC MIVL+KFLHGPL IALPH 
Sbjct: 709  EEFFQNIEQLRFDYFIPNSL---EIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHL 765

Query: 707  LPWIYFIISICLKSSQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDN-EMTSP- 764
            LPW YFIISI LK   L+   SK FWI I+K IFPW+ ++ F+N+L+   LDN  + +P 
Sbjct: 766  LPWCYFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPS 825

Query: 765  ------------IIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWGTLWFDTICQKNTN 812
                         I  LC++YS +  A+LL  F E E+LPE+W CWGTLWFDTI  KN  
Sbjct: 826  AVNDTKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNG- 884

Query: 813  SISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFLFRELSRSFQ--- 869
                 D FE +GIKD+M LD PIDGI + + DE GE FWKR  R IFLF+ ++ +F    
Sbjct: 885  --MDADSFENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLG 942

Query: 870  IGVXXXXXXXXXXXXLQSNNILGNLSYKLEPL------STLGSSI-----PTLNTLEGII 918
            + V            +  +NIL   S+K          + LG  +       +N +   +
Sbjct: 943  LKVSYNAGTEYRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFV 1002

Query: 919  DVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWYV 978
            D+ E   E N++    P  S+I    IF+YTGYKKL PN   FDKNGEF S S+YT+W +
Sbjct: 1003 DIKEPIHETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPM 1062

Query: 979  P-------------NGSNNPETNINSNCEKENEGQFLECLKSDDRE------------ID 1013
                            + +  T++ +     +E  F +  + + R+             +
Sbjct: 1063 DYDQLILAQNNNNNTNATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPFN 1122

Query: 1014 LNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGI 1073
               TYFVFDATSWLRH A I+KLA N +LKFA+CLTTFQELRFLRKSKD NV+EA+TR I
Sbjct: 1123 RYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAI 1182

Query: 1074 ITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEK----- 1128
            IT+RQLY +  +LPLRFTGNVAT IEE+LEFEEQITWR+HVDEFVIE++MKAQEK     
Sbjct: 1183 ITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSK 1242

Query: 1129 -LEN-----------ANQLPVS------SCRFNYVILISDDDTMXXXXXXXXXXTLSTRF 1170
             +EN           A    VS      S  F YV+LI+DDD+M          T  T+ 
Sbjct: 1243 TVENMEGTSNWGEIDATTTTVSAEEEEKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQV 1302

Query: 1171 VFSLCTKLGEQRHLCTD 1187
            VFS+C+ +G    +CT+
Sbjct: 1303 VFSVCSMMGIDEGVCTN 1319

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score =  986 bits (2550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/959 (52%), Positives = 641/959 (66%), Gaps = 65/959 (6%)

Query: 262  KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTF 321
            +KSS AL+QKLQ++YK+I+KQE+ELQERCSQLTNSQTTE+K+LW IY++N +L+NNYVTF
Sbjct: 312  RKSSQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTF 371

Query: 322  ITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 381
            ITTAL PSQ + DL+IG+EIV+IY+IERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH
Sbjct: 372  ITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 431

Query: 382  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNH 441
            VF+S+S+M+ DIP KY+I WLQ+LGDLSRMA+AL+PS FIDWKLSAE WY  AM+Y Y +
Sbjct: 432  VFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGY 491

Query: 442  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN-NGNLR 500
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ TF PS QY+QLVIDNIYQRAF +RN + N R
Sbjct: 492  GKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSR 551

Query: 501  N-SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNI--FNPEDMFIQNP 557
            N  LL++YLKHSE MLLP+F+ESPDLQ VVL YF+EKFGID N  N+  F P  MFIQN 
Sbjct: 552  NCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNN 611

Query: 558  DFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXXXXXXXXXXXXXXXXX 617
            D  K++FRHA +FA++ ILQ+VG+G PKNPFA+LF LPK+L                   
Sbjct: 612  DQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKRKPKNQIVGE 671

Query: 618  XXXXXXXXXXXXXXXXXXMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEA--WLES 675
                              M +   +   D    FFN+ID L    +++ + N    W +S
Sbjct: 672  DGSSTTFSSVSGMEYMVNMETNVFLGSED----FFNNIDKL---AINNFMPNSISLWNDS 724

Query: 676  LKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVI 735
            LK+ N T+ KC MIVL+KFL+GPL +ALPH LPW+YF+ISI L+  +  D    EFW   
Sbjct: 725  LKYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAF 784

Query: 736  VKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIW 795
            +KRIFPW++MV F+N+L+A ++DN   +  +  LCD+Y  LNL ELL  F   E+LPE+W
Sbjct: 785  IKRIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVW 844

Query: 796  GCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRAC 855
             C G+LWFD I +K  +   + D + E GIKDY  LD P+DGI FD NDE G KFWKR+ 
Sbjct: 845  KCRGSLWFDIIDEKRNS--QNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSV 902

Query: 856  RTIFLFRELSRSFQ-IG--VXXXXXXXXXXXXLQSNNILGNLSYKLEPLSTLGSSIPTLN 912
            R IFLFR +   F   G               L  N+ L   S+KL   S        + 
Sbjct: 903  RVIFLFRGIVERFNGFGNLAISYNAPVINRRGLGVNSHLVGYSFKLMAKSD------DIM 956

Query: 913  TLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASL 972
              + ++  FE    NN D +A+P LS+I G +IF Y GYK++  +Y  FDKNG+ +S S 
Sbjct: 957  FDDMLVSNFEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSF 1016

Query: 973  YTSWYVPNGSNNPETNINSN-------------CEKENEGQ-FLECLKSDDREID----- 1013
            Y +W +     N +T +N                +  NE + F +C   +   +D     
Sbjct: 1017 YNTWSI-----NQDTGVNGGPLSNNSSSSNAASSDPMNEKELFNKCFDPEYDSVDEFWNK 1071

Query: 1014 --------------LNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRK 1059
                             TYF+ DATSWLRH A ++K+A N +LKF+ICLTTFQELRFLRK
Sbjct: 1072 EIYDDIGRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRK 1131

Query: 1060 SKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVI 1119
            SKDENV+EAATR IIT+RQL+ E K+LPLRFTGNVATHIEE+LEFEEQITWR+HVDEFVI
Sbjct: 1132 SKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVI 1191

Query: 1120 ESIMKAQEKLENANQLPVSSCRFNYVILISDDDTMXXXXXXXXXXTLSTRFVFSLCTKL 1178
            E+++KA+ K +      +   +   ++L++DD  M          T STRFVF++   L
Sbjct: 1192 EAVIKAETKRKEQEMHNMKGFQ---IVLVTDDSNMKNKALEKGSKTFSTRFVFAISNYL 1247

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score =  978 bits (2528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/974 (52%), Positives = 644/974 (66%), Gaps = 85/974 (8%)

Query: 264  SSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTFIT 323
            +S AL+QKLQ++Y+ IVKQE+ELQERC+QLT SQTT+LK+LW IY+IN EL+NNYV FIT
Sbjct: 240  TSQALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFIT 299

Query: 324  TALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVF 383
            TALLPSQP+ DL+IGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQFITHVF
Sbjct: 300  TALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVF 359

Query: 384  VSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHGK 443
            +S+STM+ D+P K+S  W +RLGDLSRMAIALYPS FIDWKLSAEHWY++A+ +++ HGK
Sbjct: 360  ISISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGK 419

Query: 444  LYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSL 503
            LYYHMSTVQQNTLEAFVNLGKSVFC++TF PSPQYMQLVIDNIYQRAF ERN GN RNSL
Sbjct: 420  LYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSL 479

Query: 504  LIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFFKYF 563
            ++EYLKHSE MLL SFLESP+LQ VVLS+F  KFG+  +  + FNP DMF+Q+ +  KYF
Sbjct: 480  MVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYF 539

Query: 564  FRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXXXXXXXXXXXXXXXXXXXXXXX 623
            FRHAP+FA+SHILQ VGFG+PKNPFA+LFELPK L                         
Sbjct: 540  FRHAPAFAESHILQTVGFGDPKNPFALLFELPKFL-----------------------KE 576

Query: 624  XXXXXXXXXXXXMSSTTSISERDSL--IEFFNDIDTLRRPIVSSMLTNEA-WLESLKFLN 680
                          S TSI     L   E+  ++D+ R         + A W ESL  +N
Sbjct: 577  RKERKERRKSKSSHSFTSIETTSHLSPSEYLENVDSPR--YAYEFPEDLAIWRESLSHIN 634

Query: 681  MTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIF 740
            +TS +C  IV +KFL GPL +A+ H LPW YF++S+ LK   L     K FWI +V++IF
Sbjct: 635  ITSARCSSIVFQKFLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIF 694

Query: 741  PWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWGT 800
            PW+++V F+N+L+A VLDN   +  I +LC++   ++   L++ F E E+LPEIW CWG 
Sbjct: 695  PWNSIVDFLNMLMAFVLDNNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGA 754

Query: 801  LWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFL 860
            LWFD I  K   S   D D    G KD+   D P DGI FD +DE GEKFWKRACR IF+
Sbjct: 755  LWFDVIADK---SNGEDGDVINSGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFI 811

Query: 861  FRELSRSFQIGVXXXXXXXXXXXXLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEGI--- 917
            F+ +++ F +G+            + + + L N S+  E        IP  + ++     
Sbjct: 812  FKGIAQEFSLGLTLSAFAPQSRRPMTAGHPLQNFSFNFE-------EIPAQSQIQSFVRN 864

Query: 918  -IDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSW 976
             I +FE  +  N+D +  P  S+++G SIF++ GY+++  +YTCF+K+G  +S SLYTS 
Sbjct: 865  QIPLFEEIATGNLDPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSG 924

Query: 977  YVPNG------------------SNNPETNINSNCEKENEGQFLECLKSDDRE------- 1011
             +  G                  SN PE    +  E+        C+  +  E       
Sbjct: 925  KLERGPIQGGDDFNTERYGRSEDSNKPENAQITELERLERDWLDNCMNPEFIEQAYEMKF 984

Query: 1012 --------IDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDE 1063
                     D   +YFV DATSWLRH A +FKLA N +L+F ICLTTFQELRFLRKSKDE
Sbjct: 985  PFGDLSCNCDSGVSYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDE 1044

Query: 1064 NVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIM 1123
            +V+EAATR +IT+RQLY + K+LPLRFTGNVATH+EE+LEFEEQITWR+HVDEFVIE++ 
Sbjct: 1045 SVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVY 1104

Query: 1124 KAQEKLENANQLPVSSCR----------FNYVILISDDDTMXXXXXXXXXXTLSTRFVFS 1173
            KAQ+K E  N     +            F++V L+SDD  M          T STRF+F+
Sbjct: 1105 KAQKKFEAINAQAKEAGHDFIATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFA 1164

Query: 1174 LCTKLGEQRHLCTD 1187
            +C ++G     CT+
Sbjct: 1165 VCNQIGLAHQACTN 1178

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score =  972 bits (2512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/973 (51%), Positives = 655/973 (67%), Gaps = 77/973 (7%)

Query: 261  NKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVT 320
            + ++S AL+QKLQ++Y+ IVKQE+ELQERCSQLT+SQTT+LK+LW IY++NTEL+NNYV 
Sbjct: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266

Query: 321  FITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIT 380
            FITTALLPSQP+ DL+IGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQFIT
Sbjct: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326

Query: 381  HVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYN 440
            HVF+S+S M+ D+P K++  WL+RLGDLSRMAIALYPS FIDWKLSAEHWYT+A+ +++ 
Sbjct: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386

Query: 441  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLR 500
            HGKLYYHMSTVQQNTLEAFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN GN R
Sbjct: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQR 446

Query: 501  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFF 560
            NSL++EYLKHSE MLL SFLESP+LQ VVLS+F  KFGI +N  + F+ + +F+Q+ +  
Sbjct: 447  NSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERT 506

Query: 561  KYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXXXXXXXXXXXXXXXXXXXX 620
            KYFFRHAP+FA+SHILQ+VGFG PKNPFA+LFELPK L                      
Sbjct: 507  KYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFL---------------------- 544

Query: 621  XXXXXXXXXXXXXXXMSSTTSISERD--SLIEFFNDIDTLRRPIVSSMLTNEA-WLESLK 677
                            +S TS+      S IE+   +D+ R   V    T+ A W +SL 
Sbjct: 545  -KERKERKERRKSKSSNSFTSMEAPSPTSPIEYLESVDSPR--FVYEFPTDLAIWQQSLS 601

Query: 678  FLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVK 737
             +N TS+KC  +VL+KFLHGPL  A  H LPW YF++S+ ++  +L  P  K+FWI + +
Sbjct: 602  HINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCR 661

Query: 738  RIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGC 797
            ++FPW+++V F+N++IA  LDN   +  I +LC+++  +++  L+D F + E+LPE+W C
Sbjct: 662  QVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKC 721

Query: 798  WGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRT 857
            WG LWFD I  K   S   D+      ++D+M  D P+DGI FD +DE G +FWKRACR 
Sbjct: 722  WGALWFDVISDK---SDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRL 778

Query: 858  IFLFRELSRSFQIGVXXXXXXXXXXXXLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEGI 917
            +F+F+ +++ F +G+            L + + L N  +K E       S   ++T    
Sbjct: 779  VFIFKGIAQEFNMGLTLASVPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALISTQ--- 835

Query: 918  IDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWY 977
            +  FE  SE N+D +A P  S+++G S+F   GY++L  ++TCF+K G  ++ SLYTS  
Sbjct: 836  MPAFENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGS 895

Query: 978  VPNGSNNPETNINS-------NCEKENEGQFLE-----------CLKSDDRE-------- 1011
            +  G  +   + N+          K +  Q  E           C+  +  E        
Sbjct: 896  LEKGPIHGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFP 955

Query: 1012 -------IDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDEN 1064
                    D   +YFV DATSWLRH A ++KLA N +L+FAICLTTFQELRFLRKSKDE+
Sbjct: 956  FGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDES 1015

Query: 1065 VMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMK 1124
            V+EAATR +IT+RQLY E ++LPLRFTGNVATH+EE+LEFEEQITWR+HVDEFVIE++ K
Sbjct: 1016 VVEAATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYK 1075

Query: 1125 AQEKLENANQ---------LPVSSCR-FNYVILISDDDTMXXXXXXXXXXTLSTRFVFSL 1174
            AQ K E  N          +P +    F+++ L+SDD  M          T S+RF+F++
Sbjct: 1076 AQNKFEALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAV 1135

Query: 1175 CTKLGEQRHLCTD 1187
            C ++G   H CT+
Sbjct: 1136 CNQIGLAHHACTN 1148

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  957 bits (2473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/975 (50%), Positives = 641/975 (65%), Gaps = 68/975 (6%)

Query: 262  KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTF 321
            +KSS  L+QKLQ++YK IVKQEIELQERC +LTNSQTTELK+LWTIYR+N+ELV+NY+TF
Sbjct: 378  RKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITF 437

Query: 322  ITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 381
            ITTA+ P+QP+ D  IG+EI+EIY+IERRLWVYGTITFLD+LKNFSNFMDPEVCCQFI H
Sbjct: 438  ITTAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFH 497

Query: 382  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNH 441
            VF+S+S M++DIP KY ++W Q+LGDLSRMAIALYPS+FIDWKLSAE WY  AM++ Y H
Sbjct: 498  VFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGH 557

Query: 442  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGN--L 499
            GKLYYHMSTVQQNTLEAFVNLGKS+FC+ TF PS QY+QLVI NIYQRA+ + NN N   
Sbjct: 558  GKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGR 617

Query: 500  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGC--NIFNPEDMFIQNP 557
             + LL++Y+KH E  LLP+F ES +LQ VVL YF++KFG+D N    N+F    MF+QN 
Sbjct: 618  NDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNN 677

Query: 558  DFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXXXXXXXXXXXXXXXXX 617
            D FK F+R++ +FA+S ILQIVG+G  K+PF++LFELPK+L                   
Sbjct: 678  DQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKPKTMLILK 737

Query: 618  XXXXXXXXXXXXXXXXXXMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTN--EAWLES 675
                               ++   ++      EFF +IDT+  P   S + N  + W  S
Sbjct: 738  ITQPRLYHRWVGTTLPTMPNNNVFLTAE----EFFENIDTINYP---SFMPNSVDIWNHS 790

Query: 676  LKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVI 735
            L++ N  S+KC MIV +KFLH P  IALPH LPW YFIISI L+  +  +    EFW+  
Sbjct: 791  LQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEF 850

Query: 736  VKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIW 795
            V+RIFPW+++V F+N+L+A ++DN     I+  LC  Y+ ++L ELL  F E EELPE+W
Sbjct: 851  VRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVW 910

Query: 796  GCWGTLWFDTICQ-------KNTNSISSDD----DFEEVGIKDYMALDSPIDGIIFDVND 844
             C G+LWFDTI +       KN   I+  D    D++  G+KDY   D PIDG  FD +D
Sbjct: 911  KCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESD 970

Query: 845  ENGEKFWKRACRTIFLFRELSRSFQ-IGVXXXXXXXXXXXXLQSNNILGNLSYKLEPLST 903
            E GE+FWKRA R IFLF++L+ S+  +G              +    +  +  +L   S 
Sbjct: 971  EIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSF 1030

Query: 904  LGSSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDK 963
              ++      L+ II+ FET  E N D H  P LS++ G SIF+Y GYK++CPN+  FDK
Sbjct: 1031 KLNASSDGVMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFDK 1090

Query: 964  NGEFLSASLYTSWYVPN--------------------GSNNPETNINSNCEKENE-GQFL 1002
            NG+F+S S + SW + N                    GS N     ++N +  NE   F 
Sbjct: 1091 NGDFISTSFFNSWSIKNLTNELSRNTCSSITDDAISSGSGNDSAAASTNNDPMNELLVFN 1150

Query: 1003 ECLKSDDREID-----------------LNTTYFVFDATSWLRHSARIFKLAQNRLLKFA 1045
            EC     + ++                    TYF+ DATSWLRH A I+K+A +++LKFA
Sbjct: 1151 ECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAHIYKIATSKILKFA 1210

Query: 1046 ICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFE 1105
            ICLTTFQELR+LRKSKD NV+EAATR IIT+RQLY+EN +LPLRFTGNVATHIEE+LEFE
Sbjct: 1211 ICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHIEEHLEFE 1270

Query: 1106 EQITWRTHVDEFVIESIMKAQEK-LENANQLPVSSCRFNY----VILISDDDTMXXXXXX 1160
            EQITWR+HVDEFVIE+++KA+EK  +  N + + +         +IL++DD TM      
Sbjct: 1271 EQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFGIILVTDDITMKNKAMD 1330

Query: 1161 XXXXTLSTRFVFSLC 1175
                T STRF+FS+ 
Sbjct: 1331 RKIKTFSTRFIFSMA 1345

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  939 bits (2426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/957 (49%), Positives = 631/957 (65%), Gaps = 56/957 (5%)

Query: 255  VYRPANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTEL 314
            V R   + + +   I+KLQE+YK+IV QE ELQ+RC  LT SQTTELKSLW IY++NTEL
Sbjct: 193  VTRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTEL 252

Query: 315  VNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEV 374
            + NY+ FI TALL +QP +DL++GQEI++IYRIE+RLWVYG ITFLDVLK+FSNFMDPEV
Sbjct: 253  IKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEV 312

Query: 375  CCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEA 434
            CCQFIT+ F+ +S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+
Sbjct: 313  CCQFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTES 372

Query: 435  MKYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVER 494
            MKY+Y  GKLYYH++T+QQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R
Sbjct: 373  MKYIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDR 432

Query: 495  NNGNL-------RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIF 547
            ++GN        RNS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF +KFG D NG ++F
Sbjct: 433  SSGNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVF 492

Query: 548  NPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXXXXXXX 607
            + +DMF QNP+  +Y+FRHAP+FA+S ILQ++GFG PKNPFA+LF+LPKHL         
Sbjct: 493  STKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHLKFKKDKREK 552

Query: 608  XXXXXXXXXXXXXXXXXXXXXXXXXXXXMSSTTSISERDSLIEFFNDIDTLRRPIVSSML 667
                                                ++ S   +F +IDTL         
Sbjct: 553  KKSGAAEIPHYRD--------------------PFDDQGSSESYFQNIDTLNSDFNDPPT 592

Query: 668  TNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPI 727
                WL+SL ++NMTS++C + VL KFLH PL +ALPHFL W++FII++  K   ++   
Sbjct: 593  NIGIWLDSLNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQ 652

Query: 728  SKEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKE 787
               FWI  ++R  PW++MVTF N+L+  +LDN    P +    +++  L L +L++ F E
Sbjct: 653  VTAFWIHFLRRTMPWNSMVTFSNVLVCYMLDN--LHPFLEKQLEKFYSLELDDLIEYFNE 710

Query: 788  KEELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENG 847
             E LPE+W CWG+LWFD        ++   D  E  G++D++  DSP+DGI+FD  DE G
Sbjct: 711  NENLPEVWKCWGSLWFD--------AVKKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIG 762

Query: 848  EKFWKRACRTIFLFRELSRSF---QIGVXXXXXXXXXXXXLQSNNILGNLSYKLEPLSTL 904
            EKFW R+ RTI   + +++ F    + V            +  +  L NL++KL+P    
Sbjct: 763  EKFWIRSVRTILTLKGIAKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEED 822

Query: 905  G-SSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDK 963
              +    L+ L   I++ E     NIDL A P+LSV+ G SIF YTGY +L  +Y CFDK
Sbjct: 823  AFNDNNELDELYDTIEINELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDK 882

Query: 964  NGEFLSASLYTSWYVPNGSNNPETNINSNCEKENEG-----QFLECLKSDDREIDLNT-- 1016
            NG F SA +YT W   N  N    +++S    ++        + + L      I  NT  
Sbjct: 883  NGGFNSAFIYTQW--SNVGNGVTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIGKNTDD 940

Query: 1017 -----TYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATR 1071
                  YFV DATSWLRH A IFKLA+N +LKFAICLTTFQELR+LR SKD+NV+EAATR
Sbjct: 941  DGSCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATR 1000

Query: 1072 GIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLEN 1131
             +ITIRQLY E K++P+RFTGN+ATHIEENLEFEEQITW+THVDEFVI++I K  +  + 
Sbjct: 1001 SVITIRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQT 1060

Query: 1132 ANQLPVSSCRFN-YVILISDDDTMXXXXXXXXXXTLSTRFVFSLCTKLGEQRHLCTD 1187
               +  +  R   + +L++DDD M          T +T+++FSL +KLG    LCT+
Sbjct: 1061 ERTIDKNKGRSKEFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score =  933 bits (2412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/976 (49%), Positives = 639/976 (65%), Gaps = 87/976 (8%)

Query: 262  KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTF 321
            K+SS AL++KLQE+Y+ IV+QE ELQ+RCSQLT SQTT+LK+LW IY++N EL++NY  F
Sbjct: 279  KQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFMF 338

Query: 322  ITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 381
            ITTALLP+QP+ DL+IG+EI+E+YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +
Sbjct: 339  ITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIIY 398

Query: 382  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNH 441
            VF+S+S M+ DIP K+SI WL+RLGDLSRMAIALYPS FIDWKLSAEHWY EA+KY + H
Sbjct: 399  VFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFGH 458

Query: 442  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 501
            GKLYYHMSTVQQNTL AFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN+G+ RN
Sbjct: 459  GKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRN 518

Query: 502  SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFFK 561
            + L+EYLKH+E MLLPSFLES +LQ+VVL++F +KFG+ +N  + F+P  +F+Q+ +  K
Sbjct: 519  AHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSN-VDFFDPRLVFVQDSERLK 577

Query: 562  YFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXXXXXXXXXXXXXXXXXXXXX 621
            +FFRHA  +A+SH+LQ+VGFG+P+NPFA+LFELPKHL                       
Sbjct: 578  HFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLKERKDRREKRKSKSSTSTQY--- 634

Query: 622  XXXXXXXXXXXXXXMSSTTSISERDSLI---EFFNDIDTLRRPIVSSMLTNEAWLESLKF 678
                              TSI +  +     EFF  ID+ +  I         W ESL +
Sbjct: 635  -----------------DTSIDDDCAFAAPSEFFETIDSTKY-IYKFPDDINIWKESLSY 676

Query: 679  LNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKR 738
             N+T++KC MIVLRKFLHGPL  ALPH LPW YF+ +   +   +     + FW+ +V++
Sbjct: 677  ANVTAMKCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQ 736

Query: 739  IFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCW 798
            +FP++T++TF+N+L+  + +    +       +++ D++LA+L+  F E EELPE+W CW
Sbjct: 737  LFPFNTIITFLNVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECW 796

Query: 799  GTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTI 858
            GTLWFD +   NT  I++  D    G+KD+M +DSPIDGI FD NDE+GEKFWKR  R I
Sbjct: 797  GTLWFDAL---NTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVI 853

Query: 859  FLFRELSRSFQIGVXXXXXXXXXXXXLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEGII 918
             LFR L+    +G+            +       +L +K E   +    +  L     + 
Sbjct: 854  LLFRALALECPVGL----------REISGGRNWRSLVFKFEEPPSEWCDM-YLEPFTLVF 902

Query: 919  DVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWYV 978
            D FE  S  N+D  A P   +     I    GY+ L P+Y CF++NG+ ++ SLYT   +
Sbjct: 903  DTFEQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTL 962

Query: 979  PNGSNNPETNINSNCEKENEGQFLECLKSD-----DRE---------------------- 1011
             +   +   + N     EN G+ +   + D     DRE                      
Sbjct: 963  ESSGIHGGDDFNGKRLLEN-GELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQ 1021

Query: 1012 ----------IDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSK 1061
                       D + TYFV DAT+WLRH   ++KLA N +LKFAICLTTFQELRFLRKSK
Sbjct: 1022 MLPRGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSK 1081

Query: 1062 DENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIES 1121
            DE+V+EAATR +IT+RQLYYE K+LPLRFTGNVA H+EE+LE EEQ+TWR+HVDEFVIE+
Sbjct: 1082 DESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEA 1141

Query: 1122 IMKAQEKLENANQ---------LPVSS-CRFNYVILISDDDTMXXXXXXXXXXTLSTRFV 1171
            I KAQ+K    N          +P  +  RFN++ L++DD  M            STRF+
Sbjct: 1142 IHKAQDKFNALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFM 1201

Query: 1172 FSLCTKLGEQRHLCTD 1187
            FS+C +LG  +++CT+
Sbjct: 1202 FSVCNELGHAKNVCTN 1217

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score =  927 bits (2397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/951 (50%), Positives = 624/951 (65%), Gaps = 68/951 (7%)

Query: 267  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTFITTAL 326
              I+KLQE+YK+IV QE ELQ+RC  LT SQTTELKSLW IYR+NTEL+ NY+ FI TAL
Sbjct: 206  TFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITAL 265

Query: 327  LPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 386
            L +QP +DL++GQEI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + F+S+
Sbjct: 266  LTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISV 325

Query: 387  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHGKLYY 446
            S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKY+Y  GKLYY
Sbjct: 326  SNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYY 385

Query: 447  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNL------- 499
            H++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++G+        
Sbjct: 386  HIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNNEIAH 445

Query: 500  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDF 559
            RNS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF +KFG D NG ++F+ +DMF QNP+ 
Sbjct: 446  RNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFCQNPES 505

Query: 560  FKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXXXXXXXXXXXXXXXXXXX 619
             +Y+FRHAP+FA+S +LQ++GFG PKNPFA+LF+LPK+                      
Sbjct: 506  LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKY----------LKLKKDKREKKR 555

Query: 620  XXXXXXXXXXXXXXXXMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKFL 679
                            +SS +     D+L   FNDI T              WL+SL  +
Sbjct: 556  SEATETSSYTDPFDVQISSESYFQNIDALNSSFNDIPT----------NLNIWLDSLNHI 605

Query: 680  NMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRI 739
            NMTS++C + VL KFLH PL +ALPHFL W++FI++I  K   ++      FWI  ++R 
Sbjct: 606  NMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRT 665

Query: 740  FPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWG 799
             PW+++VT  N+L+  +LDN    P +    +++  L L +L++ + E E LPEIW CWG
Sbjct: 666  MPWNSIVTLGNVLVCYMLDN--LHPFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWG 723

Query: 800  TLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIF 859
            TLWFD        +I   D  E  G++D++  DSP+DGI+FD  DE GEKFW R+ R + 
Sbjct: 724  TLWFD--------AIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVL 775

Query: 860  LFRELSRSF---QIGVXXXXXXXXXXXXLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEG 916
            L + +++ F    + V            +  +  L NL++KL+       +    N L+ 
Sbjct: 776  LLKGIAKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDE--DNYNDNNELDD 833

Query: 917  IIDVFETRSE---NNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLY 973
            + D  E   E    N+D  A P LSV+ G SIF YTGY +L P+Y CFDKNG F SA +Y
Sbjct: 834  LYDTIEINEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIY 893

Query: 974  TSWY-VPNGSNNPETN------INSNCEKENEGQFLECLKSDDREIDLN---TTYFVFDA 1023
            + W  V NG     +        N+N     E  F + + +  +  D N   T YFV DA
Sbjct: 894  SQWSNVGNGVTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTLYFVIDA 953

Query: 1024 TSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYEN 1083
            TSWLRH A IFKLA+N  LKFAICLTTFQELR+LR SKD+ V+EAATR +ITIRQLY E 
Sbjct: 954  TSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEK 1013

Query: 1084 KVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKL-------ENANQLP 1136
            K++P+RFTGN+ATH+EENLEFEEQITW+THVDEFVI++I K  ++        EN N+  
Sbjct: 1014 KIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKNKGK 1073

Query: 1137 VSSCRFNYVILISDDDTMXXXXXXXXXXTLSTRFVFSLCTKLGEQRHLCTD 1187
                   + +L++DDD M          T +T+++FSL +KLG    LCT+
Sbjct: 1074 ------EFAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score =  927 bits (2395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/981 (49%), Positives = 640/981 (65%), Gaps = 93/981 (9%)

Query: 261  NKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVT 320
            +K SS  L++KLQE+YK IVKQE ELQERCSQLT SQTT+LK+LW IY++N EL++NY T
Sbjct: 316  SKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFT 375

Query: 321  FITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIT 380
            FITTALLP+QP+ DL+IGQEI+E+YRIERRLW+YGTITFLDVLKNFSNFMDPEVCCQFI 
Sbjct: 376  FITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIV 435

Query: 381  HVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYN 440
            +VF+S+S ++ +IP  +S+ WL+RLGDLSRMAIALYPS FIDWKLSAEHWY EA+KY + 
Sbjct: 436  YVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFG 495

Query: 441  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLR 500
            HGKLYYHMSTVQQNTL AFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN+G+ R
Sbjct: 496  HGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHR 555

Query: 501  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFF 560
             S ++EYLKH+E MLLPSFLE+ + Q VVL++F +KFG   +  N F+P  +F+Q+ +  
Sbjct: 556  YSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSA-NFFDPSLIFVQDCERL 614

Query: 561  KYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXXXXXXXXXXXXXXXXXXXX 620
            K+FFRHA  +A+SHILQ+VGFG+P+NPFA+LFELPK +                      
Sbjct: 615  KHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIKERKERKEKRKSKSTA------ 668

Query: 621  XXXXXXXXXXXXXXXMSSTTSISERDSL----IEFFNDIDTLRRPIVSSMLTNEAWLESL 676
                            S+ + +S  D+     ++FF  +++ +     S   N  W ESL
Sbjct: 669  ----------------SNQSDMSIDDTFLGDPVQFFETLNSTKTAYRFSQDLN-IWKESL 711

Query: 677  KFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIV 736
             ++N TS++C M+VLRKFL+  L  ALPH LPW YF++++ L+   + +  SK FWIV +
Sbjct: 712  NYVNKTSMRCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFI 771

Query: 737  KRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWG 796
            ++IFPW+++  F+N+L+  + D + T   I      Y ++ L ELL+ F E E+LPE+W 
Sbjct: 772  RQIFPWESITNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWN 831

Query: 797  CWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACR 856
            CWGTLWFD I   N+  +S+  D    G+KD+M LD+P+DGI FD +DE+GEKFWKR  R
Sbjct: 832  CWGTLWFDVI---NSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVR 888

Query: 857  TIFLFRELSRSFQIGVXXXXXXXXXXXXLQSNNILGNLSYKL-EPLSTLGSSIPTLNTLE 915
             I LFR ++  F  G                ++   +L +K  EP +        L +  
Sbjct: 889  VILLFRGIAYQFPFGF----------TEFNGSDDWKSLVFKFNEPPAEWKEQY--LGSFS 936

Query: 916  GIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTS 975
                 FE+ S  N DL + P   ++ G  I    GYK+L P+Y CF+KNG+ ++ SLYTS
Sbjct: 937  KEYGEFESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTS 996

Query: 976  WYVPNGSNNPETNINSNCEK---ENE----------------------GQFL-------- 1002
                 GS  P  + +    K   ENE                       +FL        
Sbjct: 997  GMSEGGSGVPNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTN 1056

Query: 1003 ----ECLKSDDRE--IDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRF 1056
                +CL   D +   D + TYFV DAT+WLRH   ++KLA + LLKFAICLTTFQELRF
Sbjct: 1057 SRWEQCLPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRF 1116

Query: 1057 LRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDE 1116
            LRKSKDE+V+EAATR +IT+RQLYYE K+LPLRFTGNVA H+EE+LE EEQ+TWR+HVDE
Sbjct: 1117 LRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDE 1176

Query: 1117 FVIESIMKAQEKLENANQLPVSSCR----------FNYVILISDDDTMXXXXXXXXXXTL 1166
            FVIE+I KAQ K    N+   +S R          FN++ L++DD  M            
Sbjct: 1177 FVIEAIDKAQSKFNQLNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAF 1236

Query: 1167 STRFVFSLCTKLGEQRHLCTD 1187
            ST+F+F++C ++G  + +CTD
Sbjct: 1237 STKFMFAICHEIGLSKKVCTD 1257

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  926 bits (2392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/943 (50%), Positives = 623/943 (66%), Gaps = 52/943 (5%)

Query: 267  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTFITTAL 326
              I+KLQE+Y++IV QE ELQ+RC  LT SQTTELKSLW IYR+NTEL+ NY+ FI TAL
Sbjct: 206  TFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITAL 265

Query: 327  LPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 386
            L +QP +DL++GQEI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + F+S+
Sbjct: 266  LTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISV 325

Query: 387  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHGKLYY 446
            S+M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKY+Y  GKLYY
Sbjct: 326  SSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYY 385

Query: 447  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNL------- 499
            H++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++          
Sbjct: 386  HIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNNETAH 445

Query: 500  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDF 559
            RNS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF +KFG D NG +IF+ +DMF QNP+ 
Sbjct: 446  RNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMFCQNPES 505

Query: 560  FKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXXXXXXXXXXXXXXXXXXX 619
             +Y+FRHAP+FA+S +LQ++GFG PKNPFA+LF+LPK+L                     
Sbjct: 506  LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYL----------KLKRHKREKKK 555

Query: 620  XXXXXXXXXXXXXXXXMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKFL 679
                            +SS +     DSL   F+DI T              WL+SL  +
Sbjct: 556  SGATEVPQYRDPFDDQISSESYFQNIDSLTSNFDDIPT----------NLNIWLDSLNHI 605

Query: 680  NMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRI 739
            NMTS++C + VL KFLH PL +ALPHFL W++FI++I  K   ++      FWI  ++R 
Sbjct: 606  NMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRT 665

Query: 740  FPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWG 799
             PW++MV   N+L+  +LDN    P +    + +  L L +L++ F E E LPEIW CWG
Sbjct: 666  MPWNSMVNLANVLVCYMLDN--IHPFLERELERFYSLELDDLIEYFNENENLPEIWKCWG 723

Query: 800  TLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIF 859
            +LWFD        +I   D  E  G++D++  DSP+DGI+FD  DE GE+FW R+ RTI 
Sbjct: 724  SLWFD--------AIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTIL 775

Query: 860  LFRELSRSF---QIGVXXXXXXXXXXXXLQSNNILGNLSYKLEPLSTLGSSIPT-LNTLE 915
            + + +++ F    + V            +  +  L N ++KL+       +    L+ L 
Sbjct: 776  ILKGVAKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKLDEYEENDHNDNNELDELY 835

Query: 916  GIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTS 975
              I++ E     N DL A P LSV+ G +IF YTGY +L P+Y CFDKNG F SA +Y+ 
Sbjct: 836  DTIEINEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQ 895

Query: 976  WY-VPNG------SNNPETNINSNCEKENEGQFLECLKSDDREIDLN---TTYFVFDATS 1025
            W  V NG      S +     N+N     E  F + + +     D N   + YFV DATS
Sbjct: 896  WSNVGNGMVLDVSSESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNCSVYFVIDATS 955

Query: 1026 WLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKV 1085
            WLRH A IFKLA+N +LKFAICLTTFQELR+LR SKD+NV+EAATR +ITIRQLY E K+
Sbjct: 956  WLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKI 1015

Query: 1086 LPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSCRFN-Y 1144
            +PLRFTGN+AT++EENLEFEEQITW THVDEFVI++I K  +  +    +  +  + N Y
Sbjct: 1016 IPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKNKNNAY 1075

Query: 1145 VILISDDDTMXXXXXXXXXXTLSTRFVFSLCTKLGEQRHLCTD 1187
             +L++DDD M          T +T+++FSL +K+G    LCT+
Sbjct: 1076 AVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  910 bits (2351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/961 (49%), Positives = 624/961 (64%), Gaps = 64/961 (6%)

Query: 255  VYRPANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTEL 314
            V R   + + +   I+KLQE+YK+IV QE ELQ+RC  LT SQTTELKSLW IYR+NTEL
Sbjct: 194  VVRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTEL 253

Query: 315  VNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEV 374
            + NY+ FI TALL +QP +DL++GQEI++IY +E+RLWVYG ITFLDVLKNFSNFMDPEV
Sbjct: 254  IKNYINFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEV 313

Query: 375  CCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEA 434
            CCQFI + F+S+S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+
Sbjct: 314  CCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTES 373

Query: 435  MKYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVER 494
            MKY+Y  GKLYYH++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R
Sbjct: 374  MKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDR 433

Query: 495  -------NNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIF 547
                   N    +NS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF  KFG D NG ++F
Sbjct: 434  GSSGTNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVF 493

Query: 548  NPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXXXXXXX 607
            + +DMF QNP+  +Y+FRHAP+FA+S +LQ++GFG PKNPFA+LF+LPK+L         
Sbjct: 494  DTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREK 553

Query: 608  XXXXXXXXXXXXXXXXXXXXXXXXXXXXMSSTTSISERDSLIE------FFNDIDTLRRP 661
                                         S+T +   RD   +      +F +ID L   
Sbjct: 554  KRS--------------------------SATETPQYRDPFHDKKSPESYFQNIDALSSN 587

Query: 662  IVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSS 721
                      WLESL  +NMTS++C + VL KFLH P  IALPHFL W+YF+++I  +  
Sbjct: 588  FDDIPTNLNIWLESLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLE 647

Query: 722  QLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAEL 781
             ++      FWI  ++R  PW++MV+  N+L+  +LDN    P +    + +    L +L
Sbjct: 648  TINSKQVIAFWIHFLRRTMPWNSMVSLANVLVCYMLDN--LHPFLKKELESFYSFELDDL 705

Query: 782  LDVFKEKEELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFD 841
            ++ F E E LPEIW CWG+LWFD        +I   D  E  G++D++  DSP+DGI+FD
Sbjct: 706  IEHFNENENLPEIWKCWGSLWFD--------AIKKCDVMEIPGVQDHLFFDSPLDGIVFD 757

Query: 842  VNDENGEKFWKRACRTIFLFRELSRSF---QIGVXXXXXXXXXXXXLQSNNILGNLSYKL 898
              DE GE+FW R+ R I L + +++ F    + V            +  +  L   ++KL
Sbjct: 758  EKDEIGERFWVRSVRAISLLKGIAKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKL 817

Query: 899  EPLS-TLGSSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPN 957
            +       +    L+ L   I++ E     N+DL A P LSV+ G SIF YTGY +L P+
Sbjct: 818  DAYDEGNNNDNNELDELYETIEINEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPD 877

Query: 958  YTCFDKNGEFLSASLYTSWY-VPNG-----SNNPETNINSN-CEKENEGQFLECLKSDDR 1010
            Y CFDKNG F SA +Y+ W  V NG     SN P  ++  N      E  F + + +  +
Sbjct: 878  YHCFDKNGGFNSAFIYSQWSNVGNGVPIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYK 937

Query: 1011 EIDLN---TTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVME 1067
              D N   T YFV DATSWLRH A IFKLA+N +L FAICLTTFQELR+LR SKD+NV+E
Sbjct: 938  NCDENDNCTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVE 997

Query: 1068 AATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQE 1127
            AATR +ITIRQLY E K++P+RFTGN+ATH+EENLEFEEQITW+THVDEFVI++I K  +
Sbjct: 998  AATRSVITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQ 1057

Query: 1128 KLENANQLPVSSCR-FNYVILISDDDTMXXXXXXXXXXTLSTRFVFSLCTKLGEQRHLCT 1186
              +    +  +  +   + +L++DDD M          T +T+++FSL +KLG    LCT
Sbjct: 1058 NFQTERMIAENKNKNKQFAVLVTDDDNMNKKAKDKMIKTCNTKYLFSLGSKLGINSGLCT 1117

Query: 1187 D 1187
            +
Sbjct: 1118 N 1118

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score =  900 bits (2326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/977 (50%), Positives = 627/977 (64%), Gaps = 88/977 (9%)

Query: 268  LIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTFITTALL 327
            L++KLQE+YK IVKQE ELQERCS LT  QTT+LK+LW  Y+IN EL++NY+ FITTALL
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 328  PSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLS 387
            PSQ +  L IGQEIV++YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +VF++LS
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 388  TMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHGKLYYH 447
             M+ D+P KYSI WL+RLGDLSRMAIALYPS F+DWKLSAEHWY E++K+ + HGKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 448  MSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEY 507
            MSTVQQNTLEAFVNLGKSVFC++ F PSPQYMQLVIDNIYQRAF ER++   R + +++Y
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY 523

Query: 508  LKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFFKYFFRHA 567
            LKH+E MLLPSFLES +LQNVV+ YF  KFG+ ++G N F+P  +FIQ+ +  K+FFRH+
Sbjct: 524  LKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLKHFFRHS 582

Query: 568  PSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 627
              F+QSHILQ+ GFG+PKNPFA+LFEL KHL                             
Sbjct: 583  SLFSQSHILQLCGFGDPKNPFAMLFELSKHL------------KSRKERKERKKSTKSTS 630

Query: 628  XXXXXXXXMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKFLNMTSLKCG 687
                     SS    S  D    FF+ ID+ + P     L    W  SL ++N+TS+KCG
Sbjct: 631  EGSLDPVEFSSQQQASTED----FFSTIDSPKVP-YEFPLDLGVWKRSLHYINVTSMKCG 685

Query: 688  MIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIFPWDTMVT 747
            MIVLR+FL+GP+  ALPH LPW+ FIISI ++  Q++D   K+FWIV ++RIFPWD+++T
Sbjct: 686  MIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLIT 745

Query: 748  FMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWGTLWFDTIC 807
            FMN LI   +     +  I +    Y  +N  ELL    E E LPE W CWG+LWF+TI 
Sbjct: 746  FMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTIS 805

Query: 808  QKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFLFR----- 862
            +K+   +++    E  G+ D + LDSP +GI FD +DE G K+W+R CRT+ LF      
Sbjct: 806  KKSDLDVTT---LESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEW 862

Query: 863  ELSRSFQIGVXXXXXXXXXXXXLQ---SNNILGNLSYKLEPLSTLGSSIPTLNTLEGIID 919
            E    +  G             L    +++    LS +L P      S P         +
Sbjct: 863  EACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVELYPEE--NESFP--------FE 912

Query: 920  VFETRSENNI-DLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWYV 978
             FE  S  N  D       S+I G SI N  G+K + P+Y CF+KNG+ ++ASLYT   +
Sbjct: 913  KFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPL 972

Query: 979  PNGSNNPETNINSNCEKEN------------------EGQFLECLKSDD---REI----- 1012
               +     + N+N   +N                  E  +LE   + D   RE+     
Sbjct: 973  ETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSF 1032

Query: 1013 --------DLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDEN 1064
                    D N T+FV DAT+WLRH A I+KLA + +LKFAICLTTFQELRFLRKSKDE+
Sbjct: 1033 LGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDES 1092

Query: 1065 VMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMK 1124
            V+EAATR +I +RQLYYE K+L LRFTGNVA H+EE+LE EEQ+TW++HVDEFVI++I K
Sbjct: 1093 VLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAK 1152

Query: 1125 AQEKLENANQ---------LPV-----SSCRFNYVILISDDDTMXXXXXXXXXXTLSTRF 1170
            AQ+K    N          +P+     S+ RFN+V L++DD  M          T STRF
Sbjct: 1153 AQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRF 1212

Query: 1171 VFSLCTKLGEQRHLCTD 1187
            VF++C +LG +  +CT+
Sbjct: 1213 VFAICRELGRETGVCTN 1229

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  895 bits (2312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/1039 (45%), Positives = 632/1039 (60%), Gaps = 131/1039 (12%)

Query: 258  PANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNN 317
            P    +S+ ALI KLQ++YK I+ QE+ELQ  CS +T+SQTT+LK +W +Y+IN ELVNN
Sbjct: 266  PTTWNRSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNN 325

Query: 318  YVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQ 377
            YV FITTALLPSQ Q DL+IGQEI+++Y+IERRLWVYGTITFLDVLK+FSNFMDPE+CCQ
Sbjct: 326  YVIFITTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQ 385

Query: 378  FITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKY 437
            FI HVF+S++ M   IP K+SI W  RLGDLSRMA ALYP    DWKLSAE+WY EAMKY
Sbjct: 386  FIIHVFISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKY 445

Query: 438  VYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNG 497
             Y  GKLYYHM+TVQQN+L AF+NLGKSVFC++ F P+ QY+QLVIDNIYQRA++ R   
Sbjct: 446  TYGVGKLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEE 505

Query: 498  NLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNP 557
            +  N  +++YLKH+E M+LP+F+E+ +LQ +   YF EKFG D  G N F+   MF+QN 
Sbjct: 506  SSSNVQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNL 565

Query: 558  DFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXXXXXXXXXXXXXXXXX 617
            +  K++FRH+P FAQ+HILQ+VG+G   N FA+L+ELPK +                   
Sbjct: 566  ESVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFI--------------KDNEI 611

Query: 618  XXXXXXXXXXXXXXXXXXMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTN-EAWLESL 676
                              +S   S +E   + E+FN ++ + +    ++  N + W++SL
Sbjct: 612  SRQRKKSKTGVDNMSIDTLSFQVSGNEIHDVGEYFNSLENIDKEF--TLPPNVDIWIQSL 669

Query: 677  KFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIV 736
            ++ N T + CGM+VL+KFL GP   ALPH LPW+YF+IS+  K   L D  S+ FW + +
Sbjct: 670  QYTNTTGIFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFI 729

Query: 737  KRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWG 796
            +RIFPW+T++ F+N+LIA + DN  +  ++  LC+ YS L+L E+L  F E EELPE+W 
Sbjct: 730  RRIFPWNTIINFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWN 789

Query: 797  CWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACR 856
            CWG+LWFDTI  K+  S S     +  GIKD   LD+P DGI+FD  D+NG KFWKRACR
Sbjct: 790  CWGSLWFDTIKNKSETSYSG---LKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACR 846

Query: 857  TIFLFRELSRSFQIGVXXXXXXXXXXXXLQSNNILG--------------NLSYKLEPLS 902
             +FLF+  +  F  G+             +  NI                + +Y L P+ 
Sbjct: 847  ILFLFKGYAEKFDQGLRLTNINSLNS---EEENIFTKKQEKRNIDFLFKFDPTYDLLPID 903

Query: 903  TLGSSIPTLNTL-EGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCF 961
               +    + +L    +  FE+ SENNI L AVP+LSVI G SIF+Y GYKKL P Y  +
Sbjct: 904  EASNKYFQVYSLFTEKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYY 963

Query: 962  DKNGEFLSASLYTSWYVPNGSNN---PETNINSNC--------------EKENEGQFLEC 1004
            DKNG     ++Y++W   N   N   P     S+               EK    ++LEC
Sbjct: 964  DKNGNVNKGAIYSNWEAFNQLGNGLKPRMENGSSFIIDGLDDSKNFEIREKRLFAKYLEC 1023

Query: 1005 LKSDD------------------------REI--------DLNT---------------- 1016
             +S +                        R++        DL+T                
Sbjct: 1024 DESQESSDHLAEVEREGDETEDETEETNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAYY 1083

Query: 1017 -TYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIIT 1075
             TYF+FDAT+WLRH A I+K+A + LL F ICLTTFQELRFLR+S+DENVMEAATR +I 
Sbjct: 1084 STYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIV 1143

Query: 1076 IRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQE-----KLE 1130
            IR LY   KV+PLRF G +A+HIEE+LEFEEQITWR+HV+EFVIE++ K+QE     +L 
Sbjct: 1144 IRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELH 1203

Query: 1131 N-------------------ANQLPVSSCRFN---YVILISDDDTMXXXXXXXXXXTLST 1168
            N                     Q   S+   N     +L++DD  M          T ST
Sbjct: 1204 NESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCST 1263

Query: 1169 RFVFSLCTKLGEQRHLCTD 1187
            RF+FS+C++LG +  +CT+
Sbjct: 1264 RFIFSICSQLGMKYGICTN 1282

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score =  858 bits (2217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/743 (57%), Positives = 528/743 (71%), Gaps = 14/743 (1%)

Query: 262  KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTF 321
            +KSS AL+QKLQ++YKVIVKQEIELQERCSQLT SQTTELK+LWTIY+INT+L+NNY TF
Sbjct: 285  RKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTF 344

Query: 322  ITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 381
            ITTALLPSQP  D++IG+EIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFITH
Sbjct: 345  ITTALLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 404

Query: 382  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNH 441
            VF+SLS ++ DIP K++I WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+H
Sbjct: 405  VFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 464

Query: 442  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN-NGNLR 500
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQR FV+RN  GN R
Sbjct: 465  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYR 524

Query: 501  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFF 560
            N  LI+YLKHSE MLLPSFL S DLQ VVL+YF ++FGID +  NIF+ +DMF Q P   
Sbjct: 525  NPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSCL 584

Query: 561  KYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLXXXXXXXXXXXXXXXXXXXXXX 620
            ++FFRHAP+FA+SHILQ+VGFG PKNPFA+LFELPK+L                      
Sbjct: 585  RFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTSTADVSS 644

Query: 621  XXXXXXXXXXXXXXXMSSTTS--ISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKF 678
                             +     ++   S  E+ ++I+TL+  I +  +    W++SL F
Sbjct: 645  TAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETPDIC--TWIKSLDF 702

Query: 679  LNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKR 738
            +NMTSLKC MIVL+KFLHGPL IALPHFLPW  FII+  +K ++L +  + +FW +++KR
Sbjct: 703  INMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKR 762

Query: 739  IFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCW 798
            IFPWDT+ +F+N+L+A VLDN   + II  LC +YSD++L ++L  F + E+LPE+W CW
Sbjct: 763  IFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCW 822

Query: 799  GTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTI 858
            GTLW+D IC  N NS+ + D F   GI D+M LD PIDGI FD  DE G KFWKRA R I
Sbjct: 823  GTLWYDAIC--NKNSVDA-DTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVI 879

Query: 859  FLFRELSRSFQIGVXXXXXXXXXXXXLQ-SNNILGNLSYKLEPLSTLGSSIPTLNTLEGI 917
            FLF+ +S+ F  G+             + +++ L   ++KLE         PT +     
Sbjct: 880  FLFKGISKKFDFGLKISHEAGVYCRNEKAADSPLRRFTFKLESYDE-----PTSSKFNEF 934

Query: 918  IDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWY 977
            I + E  S  N D  A P LSV++G +IF Y GY+ L  +   FDKNGE +S+S+YTSW 
Sbjct: 935  IPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWM 994

Query: 978  VPNGSNNPETNINSNCEKENEGQ 1000
            +  G      +  ++    +EGQ
Sbjct: 995  IDTGEAAAAASSATDNNAVSEGQ 1017

 Score =  233 bits (594), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 138/190 (72%), Gaps = 13/190 (6%)

Query: 1011 EIDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAAT 1070
            E+D   T+F+FDATSWLRH A I+K+A N +LKF +CLTTFQELRFLRKSKDENV+EAA 
Sbjct: 1092 ELDRLKTFFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAA 1151

Query: 1071 RGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLE 1130
            R IIT+RQLY EN++LPLRFTGNVA  IEE+LEFEEQITWR+HVDEFVIE++MKAQ+K  
Sbjct: 1152 RAIITMRQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFT 1211

Query: 1131 NANQ-------------LPVSSCRFNYVILISDDDTMXXXXXXXXXXTLSTRFVFSLCTK 1177
             A +             +P+   RF+YV L+++D  M          T ST FVFSLC+K
Sbjct: 1212 TAGETKQPEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSK 1271

Query: 1178 LGEQRHLCTD 1187
            LG    LCT+
Sbjct: 1272 LGMSLDLCTN 1281

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  525 bits (1352), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 268/380 (70%), Positives = 303/380 (79%), Gaps = 43/380 (11%)

Query: 262 KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTF 321
           K SS ALIQKLQ++YK+IVKQEI+LQ+RCSQLT SQTT+LK+LWTIY+IN +L+NNY+ F
Sbjct: 392 KTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINF 451

Query: 322 ITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 381
           IT ALLP+Q ++DL IG+EI+EIYRIERRLWVYGTITFLDVLK+FSNFMDPEVCCQFI+H
Sbjct: 452 ITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISH 511

Query: 382 VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNH 441
           VF+++S +++DIP KYSI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+H
Sbjct: 512 VFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSH 571

Query: 442 GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 501
           GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNGN RN
Sbjct: 572 GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRN 631

Query: 502 SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGI---------------------- 539
             LIEYLKH+E MLLP+FLES DLQNVVL YF  KFGI                      
Sbjct: 632 LQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGANVN 691

Query: 540 ---------------------DANGCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQI 578
                                     +IF  +DMFIQNPD  KYFFRH+ +FAQSHILQ+
Sbjct: 692 IPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQL 751

Query: 579 VGFGEPKNPFAILFELPKHL 598
           VGFG+PKNPFA+LFELPK L
Sbjct: 752 VGFGDPKNPFALLFELPKFL 771

 Score =  402 bits (1033), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 240/579 (41%), Positives = 326/579 (56%), Gaps = 99/579 (17%)

Query: 650  EFFNDIDTLRRPIVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPW 709
            EFF +ID L+ P      T E WLESLK +N+ SLKC +IVL+KFL+GP+ IALPH L W
Sbjct: 867  EFFENIDLLQFPYKIPQ-TIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTW 925

Query: 710  IYFIISICLK-SSQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLD--NEMTSPII 766
            I+FIISI LK  + ++D  SK FW   +K I PW+++V F+N+L+  +LD  N+    +I
Sbjct: 926  IHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLI 985

Query: 767  GSLCDEYSDL---NLAELLDVFKEKEELPEIWGCWGTLWFDTICQKNTNS---------- 813
             SL ++Y+ +   +L E+L  F + E LPEIW CWGTLWFD IC KN NS          
Sbjct: 986  ISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNN 1045

Query: 814  -----------------ISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACR 856
                               +D     +GI+D+  LD P+DGI F  NDE+G  F+KR+ R
Sbjct: 1046 NTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIR 1105

Query: 857  TIFLFRELSRSF---QIGVXXXXXXXXXXXXLQSNNILGNLSYKLEPL------------ 901
             IFL + +  +F    + +            +  N IL N ++KL  L            
Sbjct: 1106 LIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTE 1165

Query: 902  -----------STLGSSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGG-SIFNYT 949
                         L  +   L+ +     + E   E N++L   P LS++ G  +IFNY 
Sbjct: 1166 QNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYL 1225

Query: 950  GYKKLCPNYTCFDKNGEFLSASLYTSW------------------YVPNGSNNPETNINS 991
            GYK+L  N   F +NGE +S S+Y+SW                  ++ N S     N+  
Sbjct: 1226 GYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNENVTV 1285

Query: 992  NCEKENEGQFLECLK----------SDDRE----------IDLNTTYFVFDATSWLRHSA 1031
                  +  F E +K          S++ +          I+ + T+FVFDATSWLRH A
Sbjct: 1286 GDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRHFA 1345

Query: 1032 RIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFT 1091
             I+KL++N  LKFA+CLTTFQELRFLRKSKD NV+EA+TR IIT+RQLY E K+LPLRFT
Sbjct: 1346 HIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRFT 1405

Query: 1092 GNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLE 1130
            GNVAT IEE+LEFEEQITWR+HVDEFVIE+I+++QE+ +
Sbjct: 1406 GNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFK 1444

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  450 bits (1158), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 223/413 (53%), Positives = 285/413 (69%), Gaps = 76/413 (18%)

Query: 262 KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTF 321
           KKS+  LIQKLQ +YK+IV QE+ELQ++C++L+ SQ+T+LK LW+IY++N +L+NNY+ F
Sbjct: 263 KKSNQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILF 322

Query: 322 ITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 381
           I T+L PSQ  +D +IG+EI+EIY+IERRLW+YGTITFLD+LKNF+NFMDPE+  QFITH
Sbjct: 323 ILTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITH 382

Query: 382 VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNH 441
           VF S+S MISD+P  +   W QRLGDLSRMAIALYPS+FIDWKLS+E+WY E+MK+ ++H
Sbjct: 383 VFESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSH 442

Query: 442 GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN----- 496
           GKLYYH+STVQQN LEAFVNLGKSVFC +TF PS +YMQLVIDNIYQRAF+ERN+     
Sbjct: 443 GKLYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSS 502

Query: 497 ------------------GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFG 538
                              N +   LIEYLKHSE MLLP+FLE+  L+ VVL+YF   FG
Sbjct: 503 NNAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFG 562

Query: 539 ----------------------------------------------------IDANGCNI 546
                                                               +  N  N+
Sbjct: 563 KIAIQSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINL 622

Query: 547 FNPEDMFIQ-NPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHL 598
           FN  ++F Q N D  KYFF+++ +FA+SHILQ++GFG+PKNPFA+LF+LPK+L
Sbjct: 623 FNFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL 675

 Score =  246 bits (627), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 155/335 (46%), Positives = 190/335 (56%), Gaps = 80/335 (23%)

Query: 921  FETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWYVP- 979
            FE  S  N DL+  P LS+I+  S+F Y GYK+  P+++ FDKNGE +S SLYTS  +  
Sbjct: 1150 FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDT 1209

Query: 980  -NGSN------NPETNIN------------SNCEKENEGQ----------------FLEC 1004
             NGS+      N  TN N            SN  KE+                   F + 
Sbjct: 1210 INGSSSNANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEKEIFNKI 1269

Query: 1005 LKSDDREID--------------LNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTT 1050
            L  D + ID               + TYFV DATSWLRH A ++KLA N +LKFAICLTT
Sbjct: 1270 LDPDYKNIDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTT 1329

Query: 1051 FQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITW 1110
            FQELRFLRKSKDENVMEAATR IIT+RQLY E ++LPLRFTGN+ATHIEE+LEFEEQITW
Sbjct: 1330 FQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITW 1389

Query: 1111 RTHVDEFVIESIMKAQ-EKLENANQ----------------------LPVSSCRFNYVIL 1147
            R+HVDEFVIE+I +AQ ++ +N NQ                      L V+   F   +L
Sbjct: 1390 RSHVDEFVIEAIKRAQLKRRDNRNQEDSNVTSSNNNPIINNNENNGNLNVTDMIF---VL 1446

Query: 1148 ISDDDTMXXXXXXXXXX----TLSTRFVFSLCTKL 1178
            ++DD +M              T ST+FVFSLC  L
Sbjct: 1447 VTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481

 Score =  213 bits (543), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 108/258 (41%), Positives = 165/258 (63%), Gaps = 12/258 (4%)

Query: 650  EFFNDIDTLRRPIVSSMLTN--EAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFL 707
            +FFN++++L+   +S  L N  E W ESLK++N+ SL C +IVL+KFL+GPL ++LPH L
Sbjct: 790  DFFNNLESLK---LSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHML 846

Query: 708  PWIYFIISICLKSSQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIG 767
            PW YFIIS+ L+   L +  S+ FW+  +++IFPW+++V+++N++I+ +LDN   + +I 
Sbjct: 847  PWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMIT 906

Query: 768  SLCDEYSDLNLAELLDVFKEKE-ELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIK 826
             L + YS+ NL ELL  F E E ELPE+W C+G+LWFD I +     I S D  + + +K
Sbjct: 907  KLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAEN--YQIYSRDCSKNISMK 964

Query: 827  DYMALDSPIDGIIFDVNDENGEKFWKRACRTIFLFRELSRSFQ----IGVXXXXXXXXXX 882
            D   L+ PIDG+ FD  +ENG  FWKR+CR IFLF+ +   F     + +          
Sbjct: 965  DTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSNTSVYCNR 1024

Query: 883  XXLQSNNILGNLSYKLEP 900
              + +N+IL   ++KL P
Sbjct: 1025 SDIPNNHILRTFAFKLLP 1042

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5.706
            YIL151C
          Length = 962

 Score =  103 bits (256), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 116/514 (22%), Positives = 213/514 (41%), Gaps = 67/514 (13%)

Query: 682  TSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIFP 741
            T L    ++ +KFL   + I+ P  LPW+ F IS+  + + ++D      W  +++ + P
Sbjct: 491  TLLHSNKLLFKKFLMLNVAISQPFILPWLLFYISVASEVANVTDRHVLLLWKDLLQNLLP 550

Query: 742  WDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWGTL 801
            WD +VT++N  I  V  + + S  + +L       +L +LL     +    EI  C G +
Sbjct: 551  WDDIVTYLNESIDMVNKHSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFI 610

Query: 802  WFDTICQK-NTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFL 860
            WFD++  K    SI++++    +  K Y A +   D +I+D +D+   K W RA   I L
Sbjct: 611  WFDSLASKIKQASITTNESL--MKFKSYNASE---DSLIYDDDDQVYTKMWTRALLIILL 665

Query: 861  FRELSRSFQ--IGVXXXXXXXXXXXXLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEGII 918
             + +   +   I V            +++++ L N     + L   G             
Sbjct: 666  IKNVINDYPELIDVSIRGQSLTNSSCIKNSDSLTN-----DYLFDWG------------- 707

Query: 919  DVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWYV 978
              FE  + N +    + + ++     IF ++      P++  FDKNG+        S Y 
Sbjct: 708  --FELNNNNAV----IIDDTLHGRNRIFKFS----YIPDFQDFDKNGDITWGYSLISNYD 757

Query: 979  PNGSNNPETNINSNCEKENEGQFLECL------KSDDREIDLNTTYFVFDATSWLRHSAR 1032
               SN+  +  + N  +    + L         KS      L   YF+ D  +WL+HS +
Sbjct: 758  YIYSNDFNSEEDGNFFQRYSRRLLSAHNDYSEDKSKKYLPKLENNYFMVDTLAWLKHSNK 817

Query: 1033 IFKLAQNRLLKFAICLTTFQELRFLRK-SKDENVMEAATRGIITIRQLYYENKVLPLRFT 1091
            + +      +K  + ++   +L  L+  S+ E+V  +A+R +I I  LY  N++  L+  
Sbjct: 818  LKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLYAMNQINILK-- 875

Query: 1092 GNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLEN---------ANQLPVSSCRF 1142
                       EFE  I+    +       I+    K +N           QL +   R 
Sbjct: 876  -----------EFESPIS--KALKNIDGSQILNFNGKFKNDLLTKENGPGQQLNMIELRM 922

Query: 1143 NYVILISDDDTMXXXXXXXXXXTLSTRFVFSLCT 1176
            + V+++SDD              +ST+ +FS+ +
Sbjct: 923  DNVVVVSDDKLSLATFKKKGYNVVSTKVLFSVAS 956

 Score = 82.4 bits (202), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/325 (23%), Positives = 147/325 (45%), Gaps = 37/325 (11%)

Query: 304 LWTIYRINTELVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVL 363
           L  +++++T++V+ Y  FI  AL  +  Q DL+ G+E V   R+  RL  +     L+++
Sbjct: 144 LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203

Query: 364 KNFSNFM----------DPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAI 413
           +N+ N M          + +   +FI    + ++ M+ +IP K+   W   +GDL+R+ +
Sbjct: 204 ENYKNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLM 263

Query: 414 ALYPSSFIDWKLSAEHWY-----TEAMKYVYNHGK----------LYYHMSTVQQNTLEA 458
            L       ++L++ H Y       A+ Y  N+GK           Y+++S VQ ++L  
Sbjct: 264 LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323

Query: 459 FVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPS 518
            V L K +  + T        QL ID I  +   ++   NL+ S+    +      LL  
Sbjct: 324 IVTLSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQ--VNLKQSMGGTTILMKYFTLLSL 381

Query: 519 FLESPD------LQNVVLSYFVEKFGID--ANGCNIFNPEDMFIQNPD--FFKYFFRHAP 568
           F  S        ++   L YF  +F  +   N  ++  P +   +  +  +  ++F +AP
Sbjct: 382 FFGSTSSSQLSGMERSSLHYFWNEFANEYHLNYSSLRKPVNCKYRQKEINYSMFYFNNAP 441

Query: 569 SFAQSHILQIVGFGEPKNPFAILFE 593
            F+   I++ +   +  NPF  +++
Sbjct: 442 LFSLISIVETIIMNKKLNPFFCVYK 466

>ZYRO0A05632g Chr1 (457286..458269) [984 bp, 327 aa] {ON} similar to
           uniprot|P26449 Saccharomyces cerevisiae YOR026W BUB3
           Kinetochore checkpoint WD40 repeat protein that
           localizes to kinetochores during prophase and metaphase
           delays anaphase in the presence of unattached
           kinetochores forms complexes with Mad1p-Bub1p and with
           Cdc20p binds Mad2p and Mad3p
          Length = 327

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 33/74 (44%), Gaps = 6/74 (8%)

Query: 925 SENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWYVPNGSNN 984
           S N +  HA P LS      +F   GYK   P   C D  G+ L   L    ++P G N 
Sbjct: 51  SLNTVLRHAFPLLSCC---VLFPSGGYK---PEIYCGDVQGQVLLVDLELGKFIPMGGNT 104

Query: 985 PETNINSNCEKENE 998
            +  I+S C  +N+
Sbjct: 105 AQLGISSLCSYKNQ 118

>KLTH0D08800g Chr4 complement(734724..737456) [2733 bp, 910 aa] {ON}
           similar to uniprot|P35724 Saccharomyces cerevisiae
           YKL064W
          Length = 910

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 39/98 (39%), Gaps = 2/98 (2%)

Query: 497 GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDA--NGCNIFNPEDMFI 554
           G LR   +  +    +  ++P F    D +NV L     + G D    G NI  P  +  
Sbjct: 328 GRLRPKKITPWHLRRKGSIIPGFSGQTDAKNVKLVSQTSRKGQDDFLVGSNIQYPPHIVS 387

Query: 555 QNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILF 592
            NP+ F++ +      +  H   I G  +P   F  LF
Sbjct: 388 NNPEHFRFTYFREDLDSTIHSPTISGLLQPGQKFEELF 425

>YJL016W Chr10 (405588..407273) [1686 bp, 561 aa] {ON} Putative
           protein of unknown function; GFP-fusion protein
           localizes to the cytoplasm; conserved in closely related
           Saccharomyces species
          Length = 561

 Score = 32.3 bits (72), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 31/75 (41%), Gaps = 20/75 (26%)

Query: 89  TNNASSQSEKTTLYNSRPN--PSARYLGSPKRALQRENSVEV----------------TR 130
            NN S  S  T L N  PN  P +R   SPK    R NS  V                TR
Sbjct: 314 ANNGSGDSSSTALNNESPNTTPKSRTFFSPKG--HRRNSSHVSSLTSRSTKKPITNFTTR 371

Query: 131 SSPLISKPASHNGKH 145
           ++ L+ +P  H+G H
Sbjct: 372 TNGLLIRPLPHHGVH 386

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 120,577,284
Number of extensions: 5348663
Number of successful extensions: 20959
Number of sequences better than 10.0: 108
Number of HSP's gapped: 21598
Number of HSP's successfully gapped: 152
Length of query: 1187
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1066
Effective length of database: 39,606,813
Effective search space: 42220862658
Effective search space used: 42220862658
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)