Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_11.3325.705ON1111115791e-78
Skud_11.3355.705ON941113803e-48
Smik_11.3595.705ON881113551e-44
YKR095W-A (PCC1)5.705ON881113462e-43
Kpol_YGOB_1043.725.705ON881113072e-37
TDEL0B021505.705ON91802901e-34
KAFR0H001905.705ON82802882e-34
NCAS0A031805.705ON881102873e-34
TBLA0G010305.705ON89832761e-32
NDAI0E050605.705ON86802701e-31
TPHA0E002005.705ON85782647e-31
KLTH0E00990g5.705ON89772595e-30
SAKL0E14982g5.705ON891112579e-30
KLLA0A00539g5.705ON87802571e-29
Kwal_YGOB_Anc_5.7055.705ON88772518e-29
KNAG0C066205.705ON101812501e-28
ZYRO0B16368g5.705ON85742449e-28
Ecym_40165.705ON125762364e-26
AFR289W5.705ON81771873e-19
CAGL0G02535g5.705ON140551767e-17
TPHA0O010801.507ON74883615.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_11.332
         (111 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)...   227   1e-78
Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)...   150   3e-48
Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa...   141   1e-44
YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa] ...   137   2e-43
Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,...   122   2e-37
TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 ...   116   1e-34
KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, ...   115   2e-34
NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 ...   115   3e-34
TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]...   110   1e-32
NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.7...   108   1e-31
TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, ...   106   7e-31
KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,...   104   5e-30
SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 8...   103   9e-30
KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,...   103   1e-29
Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [2...   101   8e-29
KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 10...   100   1e-28
ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 8...    99   9e-28
Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON} si...    96   4e-26
AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON...    77   3e-19
CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)...    72   7e-17
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    28   5.7  

>Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)
           [333 bp, 111 aa] {ON} YKR095W-A (REAL)
          Length = 111

 Score =  227 bits (579), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 111/111 (100%), Positives = 111/111 (100%)

Query: 1   MKSQREMPLDHTLVERIFKGRPSEVFTNYGMFQNTRELKIPFETEKQANIATRVLSPDPI 60
           MKSQREMPLDHTLVERIFKGRPSEVFTNYGMFQNTRELKIPFETEKQANIATRVLSPDPI
Sbjct: 1   MKSQREMPLDHTLVERIFKGRPSEVFTNYGMFQNTRELKIPFETEKQANIATRVLSPDPI 60

Query: 61  LKPQDFQADYSSENNVMLARFRSIDDRVLRVGVSSVIDSIKTIIETMDELS 111
           LKPQDFQADYSSENNVMLARFRSIDDRVLRVGVSSVIDSIKTIIETMDELS
Sbjct: 61  LKPQDFQADYSSENNVMLARFRSIDDRVLRVGVSSVIDSIKTIIETMDELS 111

>Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)
           [282 bp, 94 aa] {ON} YKR095W-A (REAL)
          Length = 94

 Score =  150 bits (380), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 88/111 (79%), Gaps = 17/111 (15%)

Query: 1   MKSQREMPLDHTLVERIFKGRPSEVFTNYGMFQNTRELKIPFETEKQANIATRVLSPDPI 60
           M S+REM LD+TLVE++F+                 EL+IPFETE QA+IAT+VLSPDPI
Sbjct: 1   MTSKREMSLDYTLVEQVFQ-----------------ELQIPFETEGQASIATKVLSPDPI 43

Query: 61  LKPQDFQADYSSENNVMLARFRSIDDRVLRVGVSSVIDSIKTIIETMDELS 111
           LKPQDFQ DYSSE N+ML RFRSIDDRVLRVGVSSVIDSIKTI+ET+DELS
Sbjct: 44  LKPQDFQVDYSSEKNIMLVRFRSIDDRVLRVGVSSVIDSIKTIVETIDELS 94

>Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa]
           {ON} YKR095W-A (REAL)
          Length = 88

 Score =  141 bits (355), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 74/111 (66%), Positives = 81/111 (72%), Gaps = 23/111 (20%)

Query: 1   MKSQREMPLDHTLVERIFKGRPSEVFTNYGMFQNTRELKIPFETEKQANIATRVLSPDPI 60
           M S+REMPL HTL                       ELK+PF+TE+QA IATRVLSPDPI
Sbjct: 1   MSSKREMPLHHTL-----------------------ELKVPFKTEQQAVIATRVLSPDPI 37

Query: 61  LKPQDFQADYSSENNVMLARFRSIDDRVLRVGVSSVIDSIKTIIETMDELS 111
           LKPQDFQ DYSSE NVML +FRSIDDRVLRVGVSSVIDSIKT++E MDELS
Sbjct: 38  LKPQDFQIDYSSEKNVMLVQFRSIDDRVLRVGVSSVIDSIKTVVEAMDELS 88

>YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa]
           {ON}  PCC1Component of the EKC/KEOPS protein complex
           with Kae1p, Gon7p, Bud32p, and Cgi121p; EKC/KEOPS
           complex is required for t6A tRNA modification and may
           have roles in telomere maintenance and transcription
          Length = 88

 Score =  137 bits (346), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 73/111 (65%), Positives = 79/111 (71%), Gaps = 23/111 (20%)

Query: 1   MKSQREMPLDHTLVERIFKGRPSEVFTNYGMFQNTRELKIPFETEKQANIATRVLSPDPI 60
           M S+RE  LDHTL                       ELKIPFETE+QA IAT+VLSPDPI
Sbjct: 1   MTSKREKSLDHTL-----------------------ELKIPFETERQATIATKVLSPDPI 37

Query: 61  LKPQDFQADYSSENNVMLARFRSIDDRVLRVGVSSVIDSIKTIIETMDELS 111
           LKPQDFQ DYSSE NVML +FRSIDDRVLRVGVSS+IDSIKTI+E MD LS
Sbjct: 38  LKPQDFQVDYSSEKNVMLVQFRSIDDRVLRVGVSSIIDSIKTIVEAMDVLS 88

>Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp, 88
           aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  122 bits (307), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 63/111 (56%), Positives = 77/111 (69%), Gaps = 23/111 (20%)

Query: 1   MKSQREMPLDHTLVERIFKGRPSEVFTNYGMFQNTRELKIPFETEKQANIATRVLSPDPI 60
           MK+QR + +DHTL                       + +IPFET +QA IA +VL PDPI
Sbjct: 1   MKTQRTIEMDHTL-----------------------DFEIPFETARQAEIAVQVLKPDPI 37

Query: 61  LKPQDFQADYSSENNVMLARFRSIDDRVLRVGVSSVIDSIKTIIETMDELS 111
           LKPQDFQ  YSS +N+++ +F+SIDDRVLRVGVSSVIDS+KTIIETMDELS
Sbjct: 38  LKPQDFQVSYSSNDNLLIMKFKSIDDRVLRVGVSSVIDSVKTIIETMDELS 88

>TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 bp,
           91 aa] {ON} Anc_5.705 YKR095W-A
          Length = 91

 Score =  116 bits (290), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 54/80 (67%), Positives = 68/80 (85%)

Query: 32  FQNTRELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVLRV 91
             ++ +L+IPF+T  QANIA +VL PDPILKPQDFQ DY++ +NV++  F+SIDDRVLRV
Sbjct: 3   LNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVLRV 62

Query: 92  GVSSVIDSIKTIIETMDELS 111
           GVSSVIDSIKTI+ET+DEL 
Sbjct: 63  GVSSVIDSIKTIVETIDELG 82

>KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, 82
           aa] {ON} Anc_5.705 YKR095W-A
          Length = 82

 Score =  115 bits (288), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%)

Query: 32  FQNTRELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVLRV 91
             +T +L+IPFE  KQANIA  VL PDPIL+PQDFQ  Y + +NV +A F SIDDRVLRV
Sbjct: 3   LDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVLRV 62

Query: 92  GVSSVIDSIKTIIETMDELS 111
           GVS+VIDS+KTIIETMDELS
Sbjct: 63  GVSNVIDSLKTIIETMDELS 82

>NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 bp,
           88 aa] {ON} Anc_5.705 YKR095W-A
          Length = 88

 Score =  115 bits (287), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 72/110 (65%), Gaps = 23/110 (20%)

Query: 1   MKSQREMPLDHTLVERIFKGRPSEVFTNYGMFQNTRELKIPFETEKQANIATRVLSPDPI 60
           MK+ REM LD+ L                        L+IPF T +QA IA +VL PDPI
Sbjct: 1   MKNGREMSLDYVL-----------------------NLEIPFTTSRQAQIAAKVLVPDPI 37

Query: 61  LKPQDFQADYSSENNVMLARFRSIDDRVLRVGVSSVIDSIKTIIETMDEL 110
           LKPQDFQ +Y S++N++   FR IDDRVLRVGVSSVIDSIKTIIET+DEL
Sbjct: 38  LKPQDFQVEYLSQDNILAVHFRGIDDRVLRVGVSSVIDSIKTIIETIDEL 87

>TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]
           {ON} Anc_5.705 YKR095W-A
          Length = 89

 Score =  110 bits (276), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 65/83 (78%)

Query: 28  NYGMFQNTRELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDR 87
           N    ++T  L IPF T KQA+IA +VL PDPIL+PQDFQ  Y+S+ N ++  F+SIDDR
Sbjct: 6   NNMQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSIDDR 65

Query: 88  VLRVGVSSVIDSIKTIIETMDEL 110
           VLRVGVSSVIDS+KTIIET DEL
Sbjct: 66  VLRVGVSSVIDSVKTIIETFDEL 88

>NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.705
           YKR095W-A
          Length = 86

 Score =  108 bits (270), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (82%), Gaps = 4/80 (5%)

Query: 35  TRELKIPFETEKQANIATRVLSPDPILKPQDFQADY----SSENNVMLARFRSIDDRVLR 90
           T E++IPF  E+ A IA +VLSPDPILKP+DFQ +Y    +  NNV+L +F+SID+RVLR
Sbjct: 7   TLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDERVLR 66

Query: 91  VGVSSVIDSIKTIIETMDEL 110
           VGVSSV+DSIKTI+ETMDEL
Sbjct: 67  VGVSSVLDSIKTILETMDEL 86

>TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, 85
           aa] {ON} Anc_5.705 YKR095W-A
          Length = 85

 Score =  106 bits (264), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 66/78 (84%)

Query: 33  QNTRELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVLRVG 92
           Q+  +L IPFET KQA+IA +VL PDP L+P++F+ DYSS+ + ++  F+S+DDRVLRVG
Sbjct: 5   QSLEKLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVG 64

Query: 93  VSSVIDSIKTIIETMDEL 110
           VS+VIDSIKTIIET+DEL
Sbjct: 65  VSNVIDSIKTIIETIDEL 82

>KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp, 89
           aa] {ON} similar to uniprot|Q3E833 Saccharomyces
           cerevisiae YKR095W-A PCC1 Protein
          Length = 89

 Score =  104 bits (259), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 49/77 (63%), Positives = 60/77 (77%)

Query: 35  TRELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVLRVGVS 94
           T  L++PF+T KQA  A +VL PDPILKPQDF  +YSS+ + +   F  +DDRVLRVGVS
Sbjct: 12  TLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGVDDRVLRVGVS 71

Query: 95  SVIDSIKTIIETMDELS 111
           SVI+SIKTIIET+DE S
Sbjct: 72  SVIESIKTIIETIDEFS 88

>SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 89
           aa] {ON} similar to uniprot|Q3E833 Saccharomyces
           cerevisiae YKR095W-A PCC1 Proposed transcription factor
           involved in the expression of genes regulated by
           alpha-factor and galactose
          Length = 89

 Score =  103 bits (257), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 68/111 (61%), Gaps = 23/111 (20%)

Query: 1   MKSQREMPLDHTLVERIFKGRPSEVFTNYGMFQNTRELKIPFETEKQANIATRVLSPDPI 60
           MK+ R+M LDH L                        L+IP ET  QA IA + L PDP+
Sbjct: 1   MKNTRQMSLDHHLY-----------------------LEIPLETPSQAIIAMKALKPDPV 37

Query: 61  LKPQDFQADYSSENNVMLARFRSIDDRVLRVGVSSVIDSIKTIIETMDELS 111
           LKP+DFQ +YS+ +  +   F+SIDDRVLRVGVSSVI+S+KTIIETMDE  
Sbjct: 38  LKPEDFQVEYSAADYKLCVSFKSIDDRVLRVGVSSVIESVKTIIETMDEFG 88

>KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp, 87
           aa] {ON} highly similar to uniprot|Q3E833 Saccharomyces
           cerevisiae YKR095W-A PCC1 Protein
          Length = 87

 Score =  103 bits (257), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 67/80 (83%)

Query: 32  FQNTRELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVLRV 91
           F+++  L+IPFE+ KQA++A +VL PDPI+KP+DFQ  YS+++  ++  F S+D+R+LRV
Sbjct: 8   FEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILRV 67

Query: 92  GVSSVIDSIKTIIETMDELS 111
           GV+SVI+SIKTI+ET+DEL 
Sbjct: 68  GVNSVIESIKTIVETIDELC 87

>Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [267
           bp, 88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  101 bits (251), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 59/77 (76%)

Query: 35  TRELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVLRVGVS 94
           T  L++PF+ +KQA  A +VL PDPILKPQDF  +Y+S  N +   F  +DDRVLRVGVS
Sbjct: 12  TLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGVDDRVLRVGVS 71

Query: 95  SVIDSIKTIIETMDELS 111
           SVI+SIKTI+ET+DE S
Sbjct: 72  SVIESIKTIVETIDEFS 88

>KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 101
           aa] {ON} Anc_5.705 YKR095W-A
          Length = 101

 Score =  100 bits (250), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 60/81 (74%)

Query: 30  GMFQNTRELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVL 89
               +T  L +PFET +QA IA++VL PDPILKPQDF   Y+++   + ARF   D RVL
Sbjct: 9   AALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGRDARVL 68

Query: 90  RVGVSSVIDSIKTIIETMDEL 110
           RVGVSSVIDS+KTIIE++DEL
Sbjct: 69  RVGVSSVIDSLKTIIESLDEL 89

>ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 85
           aa] {ON} similar to uniprot|Q3E833 Saccharomyces
           cerevisiae YKR095W-A
          Length = 85

 Score = 98.6 bits (244), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 60/74 (81%)

Query: 37  ELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVLRVGVSSV 96
            L IPF  ++ + +A +VL PDPIL+P+DFQ +Y S+ N++   F+S+DDRVLRVGVSSV
Sbjct: 9   HLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRVGVSSV 68

Query: 97  IDSIKTIIETMDEL 110
           IDS+KTI+ET+DEL
Sbjct: 69  IDSVKTIVETIDEL 82

>Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON}
           similar to Ashbya gossypii AFR289W
          Length = 125

 Score = 95.5 bits (236), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 58/76 (76%)

Query: 36  RELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVLRVGVSS 95
           R L++PFE  KQA IA  VL  DP+L+P+DF+ DY+ ++  +L  F SID R LRVGVSS
Sbjct: 49  RCLEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSS 108

Query: 96  VIDSIKTIIETMDELS 111
           VI+SIKT++ETMDE S
Sbjct: 109 VIESIKTVVETMDEFS 124

>AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON}
           Syntenic homolog to Saccharomyces cerevisiae YKR095W-A
           (PCC1); 1-intron
          Length = 81

 Score = 76.6 bits (187), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 54/77 (70%)

Query: 34  NTRELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVLRVGV 93
           +T  L +PFE+ + A+IA R L+PDP+L+P++    ++S+   +  +  +ID RVLRV  
Sbjct: 3   HTLHLHVPFESARLADIAARALAPDPLLRPEELSVSFASDGASLNIKLAAIDARVLRVAT 62

Query: 94  SSVIDSIKTIIETMDEL 110
           +S+ +++KT++ET DEL
Sbjct: 63  NSIFEALKTVVETADEL 79

>CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)
          [423 bp, 140 aa] {ON} similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein of
          unknown function
          Length = 140

 Score = 72.4 bits (176), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%)

Query: 36 RELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVLR 90
          R+L +PFET + A IA RVL PDPIL+P+DFQ +Y ++  V+   F++IDDRVLR
Sbjct: 29 RDLHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83

>TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {ON}
           Anc_1.507 YKL198C
          Length = 748

 Score = 28.1 bits (61), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 36/83 (43%), Gaps = 2/83 (2%)

Query: 25  VFTNYGMFQNTRELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSI 84
           V+  YG+  NT + +       Q    +  L P P+  P DF  D+  + +  L    + 
Sbjct: 141 VYNPYGINNNTTQPQNDISFYMQEGENSERLLPLPVSSPDDFLPDHLKQKSYQLTDGFNF 200

Query: 85  --DDRVLRVGVSSVIDSIKTIIE 105
             D++ L  G SS +  +K+  +
Sbjct: 201 DKDNKFLGAGSSSEVKRVKSAFD 223

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,112,756
Number of extensions: 419845
Number of successful extensions: 1059
Number of sequences better than 10.0: 27
Number of HSP's gapped: 1053
Number of HSP's successfully gapped: 27
Length of query: 111
Length of database: 53,481,399
Length adjustment: 81
Effective length of query: 30
Effective length of database: 44,193,453
Effective search space: 1325803590
Effective search space used: 1325803590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)