Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_11.3315.702ON1898189886330.0
Skud_11.3345.702ON1885190063060.0
YKR095W (MLP1)5.702ON1875186359490.0
Smik_11.3585.702ON1878186957340.0
TDEL0B021905.702ON1810189924420.0
SAKL0E14916g5.702ON1779181624330.0
ZYRO0G06600g5.702ON1820155823690.0
NCAS0A032005.702ON1788179621290.0
Ecym_40185.702ON1769139421220.0
CAGL0G02497g5.702ON1780175320260.0
KLTH0E01056g5.702ON1771136419440.0
Kwal_55.196975.702ON1760138719040.0
KLLA0A00594g5.702ON1748142517560.0
NDAI0E050405.702ON1973172717670.0
AFR286W5.702ON1758138716780.0
TBLA0E017305.702ON1820172113841e-159
Suva_9.395.702ON1682155210611e-117
Skud_9.195.702ON1680154810231e-112
Smik_9.205.702ON168213909581e-104
YIL149C (MLP2)5.702ON167913839201e-100
NCAS0G002305.702ON173514338762e-94
KAFR0D022205.702ON167417278708e-94
KAFR0H002105.702ON145410816893e-72
KNAG0C065905.702ON165110406546e-68
Kpol_1043.705.702ON13213484595e-45
NDAI0F002905.702ON15546264533e-44
KNAG0L021405.702ON16089054167e-40
TPHA0E002305.702ON12846233551e-32
TPHA0D046105.702ON11835602304e-18
Kpol_2001.755.702ON1006184990.011
KNAG0D043404.238ON2220449890.17
TPHA0J015708.761ON1018139870.29
TDEL0E013304.238ON1657352850.52
NCAS0J013904.237ON1096154850.53
CAGL0K10890gsingletonON40096811.1
KAFR0A040908.718ON850116773.5
Ecym_83564.39ON1811178774.1
Ecym_53454.238ON1366296774.2
TDEL0B019408.442ON141775774.2
NCAS0C028408.400ON77968764.6
Kwal_23.59787.280ON73182764.8
KNAG0F009302.26ON589142765.1
KNAG0K010603.149ON442206755.3
TDEL0B070902.616ON773161755.9
NDAI0C056008.560ON864246756.3
KLTH0F01452g1.46ON40693746.8
ADL022C4.39ON3392142757.3
Ecym_64762.16ON850139748.0
KNAG0C050605.414ON1040106748.1
KAFR0A060404.237ON1102108748.5
NCAS0F005205.88ON1086106748.7
NDAI0H015407.60ON398130739.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_11.331
         (1898 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...  3330   0.0  
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...  2433   0.0  
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...  2296   0.0  
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...  2213   0.0  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   945   0.0  
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   941   0.0  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   917   0.0  
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   824   0.0  
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   822   0.0  
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   785   0.0  
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   753   0.0  
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   738   0.0  
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   681   0.0  
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   685   0.0  
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   650   0.0  
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   537   e-159
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   413   e-117
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   398   e-112
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   373   e-104
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   358   e-100
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   342   2e-94
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   339   8e-94
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   270   3e-72
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   256   6e-68
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   181   5e-45
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   179   3e-44
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   164   7e-40
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...   141   1e-32
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    93   4e-18
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    43   0.011
KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {...    39   0.17 
TPHA0J01570 Chr10 (360114..363170) [3057 bp, 1018 aa] {ON} Anc_8...    38   0.29 
TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4....    37   0.52 
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    37   0.53 
CAGL0K10890g Chr11 (1063220..1064422) [1203 bp, 400 aa] {ON} hig...    36   1.1  
KAFR0A04090 Chr1 complement(821972..824524) [2553 bp, 850 aa] {O...    34   3.5  
Ecym_8356 Chr8 (713086..718521) [5436 bp, 1811 aa] {ON} similar ...    34   4.1  
Ecym_5345 Chr5 complement(699527..703627) [4101 bp, 1366 aa] {ON...    34   4.2  
TDEL0B01940 Chr2 complement(343685..347938) [4254 bp, 1417 aa] {...    34   4.2  
NCAS0C02840 Chr3 (537144..539483) [2340 bp, 779 aa] {ON} Anc_8.4...    34   4.6  
Kwal_23.5978 s23 complement(1398157..1400352) [2196 bp, 731 aa] ...    34   4.8  
KNAG0F00930 Chr6 (170493..172262) [1770 bp, 589 aa] {ON} Anc_2.2...    34   5.1  
KNAG0K01060 Chr11 (207381..208709) [1329 bp, 442 aa] {ON} Anc_3....    33   5.3  
TDEL0B07090 Chr2 complement(1249326..1251647) [2322 bp, 773 aa] ...    33   5.9  
NDAI0C05600 Chr3 complement(1293657..1296251) [2595 bp, 864 aa] ...    33   6.3  
KLTH0F01452g Chr6 complement(109643..110863) [1221 bp, 406 aa] {...    33   6.8  
ADL022C Chr4 complement(660327..670505) [10179 bp, 3392 aa] {ON}...    33   7.3  
Ecym_6476 Chr6 (921068..923620) [2553 bp, 850 aa] {ON} similar t...    33   8.0  
KNAG0C05060 Chr3 complement(972160..975282) [3123 bp, 1040 aa] {...    33   8.1  
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    33   8.5  
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    33   8.7  
NDAI0H01540 Chr8 complement(366943..368139) [1197 bp, 398 aa] {O...    33   9.7  

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score = 3330 bits (8633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1731/1898 (91%), Positives = 1731/1898 (91%)

Query: 1    MSDRNASMRSTQNDEDTGERLNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSEN 60
            MSDRNASMRSTQNDEDTGERLNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSEN
Sbjct: 1    MSDRNASMRSTQNDEDTGERLNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSEN 60

Query: 61   IQITVTLDELKTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNEL 120
            IQITVTLDELKTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNEL
Sbjct: 61   IQITVTLDELKTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNEL 120

Query: 121  ESIKRKLSDLSEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELE 180
            ESIKRKLSDLSEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELE
Sbjct: 121  ESIKRKLSDLSEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELE 180

Query: 181  TKQQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIR 240
            TKQQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIR
Sbjct: 181  TKQQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIR 240

Query: 241  NDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQ 300
            NDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQ
Sbjct: 241  NDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQ 300

Query: 301  RLIDLLESQLNAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENE 360
            RLIDLLESQLNAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENE
Sbjct: 301  RLIDLLESQLNAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENE 360

Query: 361  CLRLSSITEEAGKEDGILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPI 420
            CLRLSSITEEAGKEDGILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPI
Sbjct: 361  CLRLSSITEEAGKEDGILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPI 420

Query: 421  INSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDL 480
            INSFKERTDT             HTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDL
Sbjct: 421  INSFKERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDL 480

Query: 481  CRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDII 540
            CRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDII
Sbjct: 481  CRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDII 540

Query: 541  QLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKI 600
            QLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKI
Sbjct: 541  QLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKI 600

Query: 601  HELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMSL 660
            HELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMSL
Sbjct: 601  HELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMSL 660

Query: 661  LNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNA 720
            LNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNA
Sbjct: 661  LNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNA 720

Query: 721  ISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIXXXXXXXXXXXXXXXXXXXX 780
            ISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKI                    
Sbjct: 721  ISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIELEKNLKQELSELSSEKTSL 780

Query: 781  HIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSK 840
            HIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSK
Sbjct: 781  HIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSK 840

Query: 841  IEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLDESI 900
            IEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLDESI
Sbjct: 841  IEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLDESI 900

Query: 901  NDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTD 960
            NDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTD
Sbjct: 901  NDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTD 960

Query: 961  EKTSLEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNKEIEAVKTEYES 1020
            EKTSLEDKVSLLREQMSNLNNELDLQNQAM          ISILQNNNKEIEAVKTEYES
Sbjct: 961  EKTSLEDKVSLLREQMSNLNNELDLQNQAMEKEKAEFKKKISILQNNNKEIEAVKTEYES 1020

Query: 1021 KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQ 1080
            KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQ
Sbjct: 1021 KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQ 1080

Query: 1081 FEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSG 1140
            FEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSG
Sbjct: 1081 FEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSG 1140

Query: 1141 SVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVENEKR 1200
            SVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVENEKR
Sbjct: 1141 SVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVENEKR 1200

Query: 1201 SFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELA 1260
            SFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELA
Sbjct: 1201 SFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELA 1260

Query: 1261 ALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKT 1320
            ALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKT
Sbjct: 1261 ALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKT 1320

Query: 1321 QQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQELE 1380
            QQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQELE
Sbjct: 1321 QQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQELE 1380

Query: 1381 DAKVAENRNQLSMIKKLQEDTEENSKELETKLEENAISYDSTVXXXXXXXXXXXXXXXXX 1440
            DAKVAENRNQLSMIKKLQEDTEENSKELETKLEENAISYDSTV                 
Sbjct: 1381 DAKVAENRNQLSMIKKLQEDTEENSKELETKLEENAISYDSTVKKLNEEIGILKEELEKQ 1440

Query: 1441 XXXXXXXXXXXGTEQDDLSKVVESMKRSXXXXXXXXXXXXTREVNQKIREFQEAQEAEET 1500
                       GTEQDDLSKVVESMKRS            TREVNQKIREFQEAQEAEET
Sbjct: 1441 RQIQQQFQAAAGTEQDDLSKVVESMKRSFEEDKIKFIEEKTREVNQKIREFQEAQEAEET 1500

Query: 1501 GLKPSNINIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXX 1560
            GLKPSNINIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPT                 
Sbjct: 1501 GLKPSNINIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTEEKISKIIERKKEDLEK 1560

Query: 1561 XXXXXXXXXXKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPXXXXXX 1620
                      KSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELP      
Sbjct: 1561 EFDEKVEERLKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPSSDIIS 1620

Query: 1621 XXXXXXLRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETK 1680
                  LRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETK
Sbjct: 1621 SDDKDKLRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETK 1680

Query: 1681 QSVDSPPKHLSKMPNPLLGLPRKIEENSNPPYNPXXXXXXXXXXXXXXXXXXXFNPFTSP 1740
            QSVDSPPKHLSKMPNPLLGLPRKIEENSNPPYNP                   FNPFTSP
Sbjct: 1681 QSVDSPPKHLSKMPNPLLGLPRKIEENSNPPYNPLLSGEKLLKLNSKSSSSGGFNPFTSP 1740

Query: 1741 SPNKPLQGDEAEREPSSNETEPPTHLAPSFNIPATQGXXXXXXXXXXXXXXEERTVNEQE 1800
            SPNKPLQGDEAEREPSSNETEPPTHLAPSFNIPATQG              EERTVNEQE
Sbjct: 1741 SPNKPLQGDEAEREPSSNETEPPTHLAPSFNIPATQGLNSSSSTLSTDTNDEERTVNEQE 1800

Query: 1801 ENNAFDGIGQFQDRKVQEEGENLIEIAGASKDESKSNKRPIDEVGELKDDDDEVNTDSTN 1860
            ENNAFDGIGQFQDRKVQEEGENLIEIAGASKDESKSNKRPIDEVGELKDDDDEVNTDSTN
Sbjct: 1801 ENNAFDGIGQFQDRKVQEEGENLIEIAGASKDESKSNKRPIDEVGELKDDDDEVNTDSTN 1860

Query: 1861 EAKKIKTDNXXXXXXXXXXXXVDVNDQNEEKNDNPSPE 1898
            EAKKIKTDN            VDVNDQNEEKNDNPSPE
Sbjct: 1861 EAKKIKTDNEEEKEQQKEQGKVDVNDQNEEKNDNPSPE 1898

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score = 2433 bits (6306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1309/1900 (68%), Positives = 1531/1900 (80%), Gaps = 17/1900 (0%)

Query: 1    MSDRNASMRSTQNDEDTGERLNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSEN 60
            MSD+   M+STQN+E   ERLN IASFFDCSLEQVKSID DI+T LN+KL+QFNELKSEN
Sbjct: 1    MSDQGLLMKSTQNEEGASERLNVIASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSEN 60

Query: 61   IQITVTLDELKTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNEL 120
            +QITV+ DELKTNS KKI+ LKTEME+VLRQNDEIRKERNDTS+KFE +Q EK  LSNEL
Sbjct: 61   LQITVSFDELKTNSLKKIDGLKTEMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNEL 120

Query: 121  ESIKRKLSDLSEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELE 180
            ES+KRKL+DL+EEKKEIQS+QQRTLKILDERLKE+EM K  +N +++EC+ LRST++ELE
Sbjct: 121  ESVKRKLNDLTEEKKEIQSNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELE 180

Query: 181  TKQQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIR 240
            TKQQTYI+NDLNS+S+LER+TQELNLLQSNKDWLEKELSSK++QYLSYRQ+T+  ISEIR
Sbjct: 181  TKQQTYITNDLNSRSELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIR 240

Query: 241  NDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQ 300
            ++LNR++NDFQLEKTNNDVL+QKNNELS  LQEK+L +K LSDS N+EK++FS EI LKQ
Sbjct: 241  SELNRLKNDFQLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQ 300

Query: 301  RLIDLLESQLNAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENE 360
            RLIDLLE+QLNAVKEEL + R+S+ S+V SDDS++LISENE LLKDL+LTK KL QCE+E
Sbjct: 301  RLIDLLETQLNAVKEELKSIRKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESE 360

Query: 361  CLRLSSITEEAGKEDGILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPI 420
            CLRLSSITEE G+E G LTS+S+ DFILLKKQ IKEKRAKE LQNQIESFIVELEHKVP+
Sbjct: 361  CLRLSSITEETGEESGTLTSRSSTDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPV 420

Query: 421  INSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDL 480
            INSFKERTD              HTSNEKNAKI+EL +KNEK+A+ +++IHIL++QRLDL
Sbjct: 421  INSFKERTDMLENELNNSALLLEHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDL 480

Query: 481  CRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDII 540
            CRQ+QYLL+TNSVSNDSKGPLRKEEIKFIQNILQND+S TTESDSQKI+T RLVEFR++I
Sbjct: 481  CRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVI 540

Query: 541  QLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKI 600
            +LQEKN+ELLR+TRNLADKLESNE KSK  L  IEN+TINEAKEAIL+LQS+K+ LESK+
Sbjct: 541  ELQEKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMSLESKV 600

Query: 601  HELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMSL 660
             ELE+ERE  K+    Q +S NNSVIQQLT+TKRELESQ QDLQARISQ+TREST+NMSL
Sbjct: 601  EELERERETLKSSISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSL 660

Query: 661  LNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNA 720
            LNKE+QD+YDSKS +SIELG+EKSSRILAEERFKLLSNTLDL KAENDQLRKRS +LQ++
Sbjct: 661  LNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSS 720

Query: 721  ISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIXXXXXXXXXXXXXXXXXXXX 780
            ISKQDSKT ETLN+Y+SCKSKLS  ET LSNLKLE+ LKI                    
Sbjct: 721  ISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSL 780

Query: 781  HIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSK 840
             IMVTQLQTLQKERE+LLDE +KSCQNKI+ ++ A NELK E   KDQ+I QLEEDN SK
Sbjct: 781  RIMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSK 840

Query: 841  IEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLDESI 900
            IEWYQNKIETL+KD++SVM+ +NEKQ E+E+ QY++KSLEKEIEENKIRLHTYNV+DE+I
Sbjct: 841  IEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDETI 900

Query: 901  NDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTD 960
            NDDSLR+ELE SKINLT+AYSQIQEYKKLYE+T +SL+EM+S+LDESN+AFSNQIQ+LTD
Sbjct: 901  NDDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTD 960

Query: 961  EKTSLEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNKEIEAVKTEYES 1020
            EK +LEDKVSLL+EQ  NLNNELDLQ   M          I+ILQNNNKEIE VK+EYES
Sbjct: 961  EKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYES 1020

Query: 1021 KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQ 1080
            KLSKIQ DLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTY+GQV+TL L+R +
Sbjct: 1021 KLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRSE 1080

Query: 1081 FEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSG 1140
             E  LKENE +W SQK+SLLEQLDLSNSRIEDLSSQNKLLY+QIELYT  GN   DA++G
Sbjct: 1081 LENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARNG 1140

Query: 1141 SVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVENEKR 1200
              LNNDIL+TLRRERDILDTKV VAERDAKMLRQKI+L+DVELQ+ARTKL NS+VEN++R
Sbjct: 1141 PTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVENDER 1200

Query: 1201 SFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELA 1260
            S I+QQHD +MEKLNQLNLLRESN TLRNEL++ + KNKELQSEL +L+  IAPIESEL+
Sbjct: 1201 SSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESELS 1260

Query: 1261 ALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKT 1320
            ALK+S+QEKEQEIRL KEEVHRWKKRSQDI+EKHQQLSS DYEKLE+E+ESLKAQLEDK 
Sbjct: 1261 ALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDKM 1320

Query: 1321 QQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQELE 1380
            QQG ++EE+FNRLRRQAQEKLK SKL+Q++  EQLNELKDAK+ALE+SLN+AN RIQELE
Sbjct: 1321 QQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLNDANTRIQELE 1380

Query: 1381 DAKVAENRNQLSMIKKLQEDTEENSKELETKLEENAISYDSTVXXXXXXXXXXXXXXXXX 1440
              KVAE+ N+  MIK+ QED E++S+ELE KLEENAISY STV                 
Sbjct: 1381 GEKVAEDNNRSEMIKRSQEDAEKSSRELEEKLEENAISYSSTVRKLNEEIATLKEEIEKQ 1440

Query: 1441 XXXXXXXXXXXGTEQDDLSKVVESMKRSXXXXXXXXXXXXTREVNQKIREFQEAQEAEET 1500
                       G   +DLS +VESMK+S            TREVN+KI      QEA+E 
Sbjct: 1441 GQIQKQLQTAAGHRDEDLSNIVESMKKSFEEDKIKFIEEKTREVNKKI------QEAQER 1494

Query: 1501 GLKPSNINIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXX 1560
              +PS++NIDE+KKQWEAEH EEV++++REAEEALKKRIRLPT                 
Sbjct: 1495 LNQPSSVNIDEMKKQWEAEHEEEVAERVREAEEALKKRIRLPTEEKISKIIERKKEDLEK 1554

Query: 1561 XXXXXXXXXXKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPXXXXXX 1620
                      KSIS S +ME + QKQLE R+QEKQKELE+EYN+KLQEKL+E+       
Sbjct: 1555 EFNEKLEEKVKSISGSEQMEAMLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSHSSSIS 1614

Query: 1621 XXXXXXLRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETK 1680
                  LRA+IEA+LREE N ELQ +KKKSFEEGKQQA MKTTLLERKLAKMESQLSE K
Sbjct: 1615 VNEKDELRAEIEAKLREELNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIK 1674

Query: 1681 QSVDSPPKHLSKMPNPLLGLPRKIEENSNPPYNPXXXXXXXXXXXXXXXXXXXFNPFTSP 1740
            QS +SPPKH + +PNPLLGLPRKIEENSN P+N                    FNPFTSP
Sbjct: 1675 QSAESPPKHANNVPNPLLGLPRKIEENSNSPFNTLLSGEKLLKFNSKSSSSGAFNPFTSP 1734

Query: 1741 SPNKPLQGDEAEREPSSNETEPPTHLAPSFNIPATQGXXXXXXXXXXXXXXEERTVNE-- 1798
            SP K LQ D+ ++E S+N+T+PPTHLAPSFNIPAT+               EE TVNE  
Sbjct: 1735 SPKKLLQKDDVQKETSNNKTDPPTHLAPSFNIPATRVLTSSSSTLSTDTNDEELTVNEPG 1794

Query: 1799 QEENNAFDGIGQFQDRKVQEEGENLIEIAGASKDESKSNKRPIDEVGELKDDDDEVNTDS 1858
            Q+ ++A + + Q    + QE  E L EI   +++++KSNKRPIDEV ELKDDDDE + + 
Sbjct: 1795 QKISSAINSLSQTGSEQNQE--EELFEIKNIAEEKTKSNKRPIDEVAELKDDDDEDSAEF 1852

Query: 1859 TNEAKKIKTDNXXXXXXXXXXXXVDVNDQNEEKNDNPSPE 1898
            TNE+KKIKTD+            V+  +++E+ ND   PE
Sbjct: 1853 TNESKKIKTDD-------EEEGKVNNEEKSEKDNDITGPE 1885

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score = 2296 bits (5949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1242/1863 (66%), Positives = 1493/1863 (80%), Gaps = 11/1863 (0%)

Query: 1    MSDRNASMRSTQNDEDTGERLNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSEN 60
            MSD +  M S QN E++ ERLNAIASFF CSLEQVKS D D+V HLNDKLLQFNELKSEN
Sbjct: 1    MSDHDTPMESIQNGENSDERLNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSEN 60

Query: 61   IQITVTLDELKTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNEL 120
            +++TV+ DELK +S KKI+ LKTEME+V+R+ND+IRKERNDT  KFESV+ EK  LS+EL
Sbjct: 61   LKVTVSFDELKASSLKKIDGLKTEMENVIRENDKIRKERNDTFVKFESVENEKMKLSSEL 120

Query: 121  ESIKRKLSDLSEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELE 180
            E +KRKL DL+EEKKE QS+QQRTLKILDERLKE+E+V+  +N S+SECKKLRSTI++LE
Sbjct: 121  EFVKRKLDDLTEEKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLE 180

Query: 181  TKQQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIR 240
            TKQQ YI+NDLNS+++LER+TQEL LLQSN DWLEKEL SKN+QYLSYRQKT+ +I +IR
Sbjct: 181  TKQQGYITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIR 240

Query: 241  NDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQ 300
            N+LNR+RNDFQ+E+TNNDVL+QKNNELSK LQEKLL+IK LSDS NSEK++FSAE++LKQ
Sbjct: 241  NELNRLRNDFQMERTNNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQ 300

Query: 301  RLIDLLESQLNAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENE 360
            RL+DLLESQLNAVKEELN+ RE N + V +DDSK+   ENE LLK+LQLTK KL QCE E
Sbjct: 301  RLVDLLESQLNAVKEELNSIRELNTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEKE 360

Query: 361  CLRLSSITEEAGKEDGILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPI 420
            CLRLSSIT+EA +++  L++KS+ DFI LKKQLIKE+R KEHLQNQIE+FIVELEHKVPI
Sbjct: 361  CLRLSSITDEADEDNENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPI 420

Query: 421  INSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDL 480
            INSFKERTD              HTSNEKNAK+KEL  KN+KL E ++++  L+KQRLDL
Sbjct: 421  INSFKERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDL 480

Query: 481  CRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDII 540
            CRQIQYLL+TNSVSNDSKGPLRKEEI+FIQNI+Q DDS  TESDSQK+VTERLVEF++II
Sbjct: 481  CRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNII 540

Query: 541  QLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKI 600
            QLQEKN+ELL+V RNLADKLES E KSK  L+ IE+ET+NEAKEAI+TL+S+K+ LES+I
Sbjct: 541  QLQEKNAELLKVVRNLADKLESKEKKSKQSLQKIESETVNEAKEAIITLKSEKMDLESRI 600

Query: 601  HELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMSL 660
             EL+KE E+ K    +++ S +N  I+QLTETKR+LESQ QDLQ RISQ+TRESTENMSL
Sbjct: 601  EELQKELEELKTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSL 660

Query: 661  LNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNA 720
            LNKE+QDLYDSKS +SI+LG+EKSSRILAEERFKLLSNTLDL KAENDQLRKR   LQN 
Sbjct: 661  LNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNT 720

Query: 721  ISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIXXXXXXXXXXXXXXXXXXXX 780
            I KQDSKT ETLN+YVSCKSKLS +ETEL NLK E+ L++                    
Sbjct: 721  ILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKLSPEKDSL 780

Query: 781  HIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSK 840
             IMVTQLQTLQKERE+LL+ET+KSCQ KID L++A +ELK E  +KD +IKQLEEDN+S 
Sbjct: 781  RIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSN 840

Query: 841  IEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLDESI 900
            IEWYQNKIE L+KD+ESV++S++ KQ ++E+ QY++KSLEKEIEE+KIRLHTYNV+DE+I
Sbjct: 841  IEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETI 900

Query: 901  NDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTD 960
            NDDSLR+ELEKSKINLTDAYSQI+EYK LYETT +SLQ+ +S+LDES K F+NQI+NLTD
Sbjct: 901  NDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTD 960

Query: 961  EKTSLEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNKEIEAVKTEYES 1020
            EKTSLEDK+SLL+EQM NLNNELDLQ + M          ISILQNNNKE+EAVK+EYES
Sbjct: 961  EKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYES 1020

Query: 1021 KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQ 1080
            KLSKIQ DLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQV+TLNL+R Q
Sbjct: 1021 KLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQ 1080

Query: 1081 FEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSG 1140
             E ALKENE +W+SQKESLLEQLDLSNSRIEDLSSQNKLLYDQI++YT    +  ++ +G
Sbjct: 1081 LENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNG 1140

Query: 1141 SVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVENEKR 1200
              LNN ILITLRRERDILDTKV VAERDAKMLRQKISL+DVELQ+ARTKL NS+VE E  
Sbjct: 1141 PGLNN-ILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENH 1199

Query: 1201 SFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELA 1260
            S IIQQHD++MEKLNQLNLLRESN TLRNEL+++N+K KELQSEL++L+ N+APIESEL 
Sbjct: 1200 SSIIQQHDDIMEKLNQLNLLRESNITLRNELENNNNKKKELQSELDKLKQNVAPIESELT 1259

Query: 1261 ALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKT 1320
            ALK+S+QEKEQE++L KEEVHRWKKRSQDI+EKH+QLSS+DYEKLE+EIE+LK +LE+K 
Sbjct: 1260 ALKYSMQEKEQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEKLESEIENLKEELENKE 1319

Query: 1321 QQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQELE 1380
            +QGA++EEKFNRLRRQAQE+LK SKLSQDS  EQ+N L+DAK  LE SL+ ANARI+EL+
Sbjct: 1320 RQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQ 1379

Query: 1381 DAKVAENRNQLSMIKKLQEDTEENSKELETKLEENAISYDSTVXXXXXXXXXXXXXXXXX 1440
            +AKVA+  NQL  I+KLQED E+ S+EL+ KLEE+  SY+ST+                 
Sbjct: 1380 NAKVAQGNNQLEAIRKLQEDAEKASRELQAKLEESTTSYESTINGLNEEITTLKEEIEKQ 1439

Query: 1441 XXXXXXXXXXXGTEQDDLSKVVESMKRSXXXXXXXXXXXXTREVNQKIREFQEAQEAEET 1500
                         EQ+DLS +VESMK+S            T+EVN+KI E QE       
Sbjct: 1440 RQIQQQLQATSANEQNDLSNIVESMKKSFEEDKIKFIKEKTQEVNEKILEAQERLN---- 1495

Query: 1501 GLKPSNINIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXX 1560
              +PSNIN++EIKK+WE+EH +EVS+KIREAEEALKKRIRLPT                 
Sbjct: 1496 --QPSNINMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTEEKINKIIERKKEELEK 1553

Query: 1561 XXXXXXXXXXKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPXXXXXX 1620
                      KS+ QSG+++ + +KQLE+++QEKQKELENEYNKKLQE+L+++P      
Sbjct: 1554 EFEEKVEERIKSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHIS 1613

Query: 1621 XXXXXXLRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETK 1680
                  LRA+IE++LREEFN+ELQ IKKKSF+EGKQQAMMKTTLLERKLAKMESQLSETK
Sbjct: 1614 DDERDKLRAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETK 1673

Query: 1681 QSVDSPPKHLSKMPNPLLGLPRKIEENSNPPYNPXXXXXXXXXXXXXXXXXXXFNPFTSP 1740
            QS +SPPK ++ + NPLLGLPRKIEENSN P+NP                   FNPFTSP
Sbjct: 1674 QSAESPPKSVNNVQNPLLGLPRKIEENSNSPFNP-LLSGEKLLKLNSKSSSGGFNPFTSP 1732

Query: 1741 SPNKPLQGDEAEREPSSNETEPPTHLAPSFNIPATQGXXXXXXXXXXXXXXEERTVNEQE 1800
            SPNK LQ D  +RE  +N+T+PPTHL PSFNIPA++G              EE T N   
Sbjct: 1733 SPNKHLQNDNDKRESLANKTDPPTHLEPSFNIPASRGLISSSSTLSTDTNDEELTSNNPA 1792

Query: 1801 ENNAFD-GIGQFQDRKVQEEGENLIEIAGASKDESKSNKRPIDEVGELKDDDDEVNTDST 1859
            + ++ +  +   +D + ++EGE  ++   A ++++KSNKRPIDEVGELK+D+D+  T++ 
Sbjct: 1793 QKDSSNRNVQSEEDTEKKKEGEP-VKRGEAIEEQTKSNKRPIDEVGELKNDEDDT-TENI 1850

Query: 1860 NEA 1862
            NE+
Sbjct: 1851 NES 1853

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score = 2213 bits (5734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1206/1869 (64%), Positives = 1454/1869 (77%), Gaps = 17/1869 (0%)

Query: 1    MSDRNASMRSTQNDEDTGERLNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSEN 60
            M D + S++S QN ++T ERL AIASFF  S EQV+SI+ D++ HLNDKLLQFNELKSEN
Sbjct: 1    MPDHDISIKSVQNSDNTDERLKAIASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSEN 60

Query: 61   IQITVTLDELKTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNEL 120
            +QITV+ DELKTNS+KKI++LK EME++++QND IRKER+DT  K ES + EKT +SNEL
Sbjct: 61   LQITVSFDELKTNSSKKIDNLKKEMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNEL 120

Query: 121  ESIKRKLSDLSEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELE 180
            ESIKR+  DL EEKKE+Q +QQRTLKILDERLKELE+ ++ +N SD+ECK+LRSTI++LE
Sbjct: 121  ESIKRRADDLIEEKKELQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLE 180

Query: 181  TKQQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIR 240
            TKQQ  I++DLNS+++LER+ QELN+LQS  DWLEKEL SKN+QYLSYR+KT+ II EIR
Sbjct: 181  TKQQDLITSDLNSRAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIR 240

Query: 241  NDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQ 300
            N+LN +R+DFQ+EKT NDVL QKN+ELSK LQEKLL+IK+LSD  +SEK++FS EI LKQ
Sbjct: 241  NELNHLRSDFQVEKTKNDVLTQKNDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQ 300

Query: 301  RLIDLLESQLNAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENE 360
            RL+DLLESQLNAVKEEL++TR        S+DSK+ +SE E L+K+LQLTK +L QC++E
Sbjct: 301  RLVDLLESQLNAVKEELDSTRGLE----TSNDSKKHMSEKEDLVKELQLTKEELAQCKSE 356

Query: 361  CLRLSSITEEAGKEDGILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPI 420
            C+RLSSI  E  +E G  TS+S+ DFILLKKQLIKEKRAKEHLQNQIESFI+ELEHKVPI
Sbjct: 357  CIRLSSIIGETDEESGSSTSRSSSDFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPI 416

Query: 421  INSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDL 480
            INSFKERTDT             HTSNEKNAKI+EL  K+EKL + +++I  L KQRLDL
Sbjct: 417  INSFKERTDTLENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDL 476

Query: 481  CRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDII 540
            CRQ+QYLL+TNSVS DSKGPLRKEEI FIQNILQND    TE+DSQKIVTERLVEFR II
Sbjct: 477  CRQVQYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSII 536

Query: 541  QLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKI 600
            +LQEKN+ELL++ RNLAD+LESNEN+SK  L+ IE+ETINEAKEAILTL+++K QLESK+
Sbjct: 537  ELQEKNTELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQLESKV 596

Query: 601  HELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMSL 660
             ELEKE E  K    ++ETS  NS IQQL ETKR LE Q QDLQ+ ISQ+TRESTENMSL
Sbjct: 597  EELEKECENSKALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSL 656

Query: 661  LNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNA 720
            LNKE+QDLYDSKS +SI+LG+EKSSRILAEERFKLLSNTLDL KAENDQLRKR   LQ+ 
Sbjct: 657  LNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQST 716

Query: 721  ISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIXXXXXXXXXXXXXXXXXXXX 780
            I KQDSKTQETLN+Y+SCKSKL+  ETEL NLK E+ LKI                    
Sbjct: 717  ILKQDSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGL 776

Query: 781  HIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSK 840
             IMVTQLQTLQKERENLLDET+KS QNKID L++A NELK EA  KDQ IKQLEEDN+S 
Sbjct: 777  RIMVTQLQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSS 836

Query: 841  IEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLDESI 900
            IEWYQNKIE L+KD+ES++ S+N+KQ E+E+ Q+++KSLEKEI+ENKIRLHTYNV+D +I
Sbjct: 837  IEWYQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTI 896

Query: 901  NDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTD 960
            NDDSLR+ELEKSKI+LTDAYSQIQEYK+LYET  KSL++M S+ +ES+K FSN+I+NLT+
Sbjct: 897  NDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTN 956

Query: 961  EKTSLEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNKEIEAVKTEYES 1020
            EK+SLE+K+SLL+EQ+ NLNNELDLQN+ M          ISILQNNNKE+EAVK+EYES
Sbjct: 957  EKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYES 1016

Query: 1021 KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQ 1080
            KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTY+ QV TL L+R Q
Sbjct: 1017 KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQ 1076

Query: 1081 FEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSG 1140
             E  LKENE +W SQ+++L+EQL+ SNSRIEDL+SQNKLLYDQIELYTT     TD    
Sbjct: 1077 LESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDK 1136

Query: 1141 SVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVENEKR 1200
              LN+ IL++LRRERDILDTKV VAERDAKMLRQKISL+D+ELQEARTKL NS++E EKR
Sbjct: 1137 PALNS-ILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKR 1195

Query: 1201 SFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELA 1260
              IIQQH+++MEKLNQLNLLRESN TLRNEL+++N + + LQSEL++L+ +IAPIESELA
Sbjct: 1196 PTIIQQHEDIMEKLNQLNLLRESNITLRNELENNNEEKRVLQSELDKLKQDIAPIESELA 1255

Query: 1261 ALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKT 1320
            ALK+S+QEKEQE+RLTKEEVHRWKKRSQDI+EKH+Q+SS+DYEKLE EI+SLK +L++KT
Sbjct: 1256 ALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKT 1315

Query: 1321 QQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQELE 1380
            +QGA++EE+FNRLRRQAQE+LK SKLS D+  EQ+N+LK+AK+ LEKSL++AN +I+ELE
Sbjct: 1316 RQGAEAEERFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKSLDDANTKIEELE 1375

Query: 1381 DAKVAENRNQLSMIKKLQEDTEENSKELETKLEENAISYDSTVXXXXXXXXXXXXXXXXX 1440
            +AK  ++ NQL  IK+LQ+D E +SKE +TKLEE A  YDST+                 
Sbjct: 1376 NAKAEQDNNQLDAIKRLQQDAENSSKEFKTKLEEKATFYDSTIKKLNEEIITLREEIEKQ 1435

Query: 1441 XXXXXXXXXXXGTEQDDLSKVVESMKRSXXXXXXXXXXXXTREVNQKIREFQEAQEAEET 1500
                         EQ+DLSK+VESMK++            T+EVN+KI E QE       
Sbjct: 1436 RRIQQQLQSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERLN---- 1491

Query: 1501 GLKPSNINIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXX 1560
              +PSNINIDE+K +W+AEH EEV  +IREAEEALKKRIRLPT                 
Sbjct: 1492 --QPSNINIDELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEK 1549

Query: 1561 XXXXXXXXXXKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPXXXXXX 1620
                      K +SQSG+M+  FQKQ E RIQEKQKELE++YN    EKL+EL       
Sbjct: 1550 EFDEKVEERIKLLSQSGQMDVTFQKQFEIRIQEKQKELEDKYN----EKLKELSHSNSIS 1605

Query: 1621 XXXXXXLRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETK 1680
                  LRA+IE ++R+E ++ELQ IKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETK
Sbjct: 1606 IDERDQLRAEIETKMRKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETK 1665

Query: 1681 QSVDSPPKHLSKMPNPLLGLPRKIEENSNPPYNPXXXXXXXXXXXXXXXXXXXFNPFTSP 1740
            +  +SP KH++   N LLGLPRKIEENS+  +NP                   FNPFTSP
Sbjct: 1666 KITESPSKHVNHTQNQLLGLPRKIEENSSSSFNPLLSGEKLLKLNSKSSSSGGFNPFTSP 1725

Query: 1741 SPNKPLQGDEAEREPSSNETEPPTHLAPSFNIPATQGXXXXXXXXXXXXXXEERTVNEQE 1800
            SPNK  Q  + +RE ++N+ +PPTHL PSFNIPA +G              EE T NEQ 
Sbjct: 1726 SPNKSSQKVDDQRELTTNKADPPTHLTPSFNIPAGRGLISSSSTLSTDTNDEELTGNEQ- 1784

Query: 1801 ENNAFDGIGQFQDRKVQEEGENLIEIAGASKDESKSNKRPIDEVGELKDDDDEVNTDSTN 1860
             NN+ DG  Q +    + E +   E     + E+ S+KRPIDEV ELKDDDDEV+ + +N
Sbjct: 1785 -NNSSDGNTQLEAGIEKAEEKEFAEKKKEVEGETTSHKRPIDEVRELKDDDDEVSAEFSN 1843

Query: 1861 EAKKIKTDN 1869
            E KK+KTD+
Sbjct: 1844 EPKKVKTDD 1852

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  945 bits (2442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 682/1899 (35%), Positives = 1079/1899 (56%), Gaps = 145/1899 (7%)

Query: 1    MSDRNASMRSTQNDEDTGERLNAIASFFDCSLEQVKSIDRDIVTH--LNDKLLQFNELKS 58
            MS++   + S+  DE +      IA F   S +++K +  D V    L +KL +FN L+S
Sbjct: 1    MSEKETLVGSSGTDELS----QRIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQS 56

Query: 59   ENIQITVTLDELKTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSN 118
             N+++  T+DELK     K++SLK E E ++R+ND  ++ RN    +   + +EKT    
Sbjct: 57   NNLRLHATVDELKALCTSKVDSLKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALG 116

Query: 119  ELESIKRKLSDLSEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILE 178
            ++E++K +L +  E+K  ++S++Q  +K+L+E++ ELE  K  S    ++ K LR  ++E
Sbjct: 117  QMENVKFELQNTIEQKNVLKSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLME 176

Query: 179  LETKQQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISE 238
             + + QT   N L  KS+LE   Q++ +L  + +WLEKE++SK +Q + YRQ+ +T + +
Sbjct: 177  TQNEVQTLKCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQK 236

Query: 239  IRNDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITL 298
               ++ R++ND+QLEK++ + L +KN E+S+DLQ KL +IK LSD  N+EK++FS E++L
Sbjct: 237  SLQEVARLKNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSL 296

Query: 299  KQRLIDLLESQLNAVKEELNNTRESNYSDVNSDDSKQLIS-ENEKLLKDLQLTKHKLVQC 357
            KQ+L+DL + QL + KEEL  T E +    NS ++  L S +  + + DL   + +L + 
Sbjct: 297  KQKLLDLQDEQLQSFKEELRLTEEKH----NSTEADNLQSTQQARFMDDLAQVRQQLEES 352

Query: 358  ENECLRLSSITEE--AGKEDGILTSKSN-------GDFILLKKQLIKEKRAKEHLQNQIE 408
             +E LRL ++  E     E+  L S +N       GD  +LKKQLIKE+  KE+LQ QIE
Sbjct: 353  NHERLRLQAVVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIE 412

Query: 409  SFIVELEHKVPIINSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIKELKVKNEKLAEYKD 468
            SF+VELE+KVP+INS KER+ T             HTS+EK  K +EL+    K+ + + 
Sbjct: 413  SFVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEI 472

Query: 469  EIHILSKQRLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKI 528
              H L +QR DL RQ+Q+LL   ++ NDS+GPL  +E+ FI+ I++N++  + ESDSQ I
Sbjct: 473  NTHTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENEN-PSNESDSQSI 531

Query: 529  VTERLVEFRDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILT 588
            +TERLVEF+DI  LQE+N+ELL+  R LAD+LE  E  S   + ++E +TI+EAKEAI+T
Sbjct: 532  ITERLVEFKDIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIIT 591

Query: 589  LQSQKVQLESKIHELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELESQ-----TQDL 643
            LQ +  ++ESK+  +EKER+ +K        S +N     L +  R  +SQ      + L
Sbjct: 592  LQERNSEIESKVSTIEKERDAYKAILSQTSQSFDN-----LGDADRMKDSQENQELIKSL 646

Query: 644  QARISQVTRESTENMSLLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLA 703
            + ++S +T E+++N  LLN+E+++LY SK+ L+I   +E+SSR LAE+R KLL +TL++ 
Sbjct: 647  EDKLSTLTTETSKNNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMT 706

Query: 704  KAENDQLRKRSINLQNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIXXX 763
            K EN +L +RS  LQ+ +SKQ+++  ET+N Y+SC+SKLS +E   +NL  E++L     
Sbjct: 707  KNENAELIRRSHELQSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKSLLQSSS 766

Query: 764  XXXXXXXXXXXXXXXXXHIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEA 823
                             ++MVTQLQTLQ ERENLL E++ S +  I  L+   +ELKTE 
Sbjct: 767  DSLRREIQKISVERNSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEI 826

Query: 824  IRKDQYIKQLEEDNDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEI 883
              KD  IK  E+   ++ +W+Q KI+ +  D   +   L  K   V + + E+  L+K+I
Sbjct: 827  SSKDNEIKASEDAKRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKI 886

Query: 884  EENKIRLHTYNVLDESINDDS----LRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQE 939
            EE+  R+ +Y  L+++ N ++    LR++LEK+ I L  AYSQ +E+K++  T +++L+ 
Sbjct: 887  EESDSRIASYKTLNDAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKN 946

Query: 940  MSSQLDESNKAFSNQIQNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXXX 999
            +S++ +E  +A  +  +    EK  LE  VS L++ +  LNNE  LQ             
Sbjct: 947  LSNEFEERTEALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILK 1006

Query: 1000 XISILQNNNKEIEAVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISE 1059
             +  L+++   +  VK EY+ KL ++QKDL+QQT YAN AQ NYE+ELQKHA+VSK IS+
Sbjct: 1007 KLVSLESSEHSLGQVKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQ 1066

Query: 1060 LREQLHTYKGQVETLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKL 1119
            LR ++ + + +++ L  +  Q ++ L+  E +W +QK  L   +D    +++++SSQNKL
Sbjct: 1067 LRSEVQSGRSEIQQLKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKL 1126

Query: 1120 LYDQIELYTTT----GNKPTDAKSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQK 1175
            L+ Q+EL + +     NK     S      ++LI+LRRERDIL+TK+ V++R+ K+L QK
Sbjct: 1127 LFSQVELLSKSEREFENKLLPGSS------ELLISLRRERDILETKLTVSKREEKLLHQK 1180

Query: 1176 ISLIDVELQEARTKLCNSKVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSN 1235
               ++ EL EAR KL   +  +   S I +QH+++ME+LNQ+NLLRESN TLRN ++++ 
Sbjct: 1181 QVALEDELAEARKKLFKLQENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQ 1240

Query: 1236 SKNKELQSELERLRGNIAPIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQ 1295
             KN +LQSEL  L+  I P+ SEL+  + SI+EK+Q I L  +E  RWK+RS DI+ +H+
Sbjct: 1241 EKNSDLQSELNHLQSKILPLNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHE 1300

Query: 1296 QLSSTDYEKLETEIESLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQL 1355
            ++   +Y KLE EI +LK +LE K+++  D  ++F RL++QA EKL ASK++Q +   ++
Sbjct: 1301 KIDPEEYRKLEEEISNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEV 1360

Query: 1356 NELKDAKLALEKSLNNANARIQELE------DAKVAENRNQLSMIKKLQEDTEENSKELE 1409
            NEL+  K  +E+ L     ++  LE      D++ A N +    ++   +D  E  KE+E
Sbjct: 1361 NELQGTKTKMEEILKETQTKVLNLEKLLTERDSESANNED----LRHELDDALERCKEIE 1416

Query: 1410 TKLEENAISYDSTVXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTEQDDLSKVVESMKRSX 1469
             KL E   S +  +                            G++   LS VVESMK++ 
Sbjct: 1417 VKLGETVGSSEG-LTSQLNEEINSLKEQVRIFKEKENDSTLEGSQ--GLSNVVESMKKAF 1473

Query: 1470 XXXXXXXXXXXTREVNQKIREFQEAQEAEETG--LKP-SNINIDEIKKQWEAEHNEEVSK 1526
                       T E N+K  E ++A+ + E G   +P S  +++ +KKQWE E+     +
Sbjct: 1474 EEEKIKFIQEKTEEYNKKFEE-EKAKLSSENGSPAEPVSAPDVNSLKKQWEEEYEAISQQ 1532

Query: 1527 KIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXXXXKSISQSGKMEDIFQKQ 1586
            +I+EAEE LKKRIR+PT                                    E+  +K 
Sbjct: 1533 RIQEAEENLKKRIRMPT------------------------------------EERIKKV 1556

Query: 1587 LESRIQEKQKELENEYNKKLQEKLRELPXXXXXXXXXXXXLRADIEAQLREEFNHELQTI 1646
            L+ R    + ELE E+ ++L+E   + P            L+  +E++   ++   L + 
Sbjct: 1557 LDKR----KTELEEEFQRRLKENNLQ-P--EGGDAKEREELKKQLESEFEAKYKEILAST 1609

Query: 1647 KKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKQSVDSPPKHLSKMPNPLLGLPRKIEE 1706
            KKK+FEEGKQQA MK+TLLERK++K+ESQL+    S ++P     K     +GLP KI+E
Sbjct: 1610 KKKAFEEGKQQAAMKSTLLERKISKLESQLN----SSNNPTPE--KAAATSVGLPTKIDE 1663

Query: 1707 N------SNPPYNPXXXXXXXXXXXXXXXXXXXFNPFTSPSP-NKPLQGDEAEREPSSNE 1759
            +      +  P                       NPFTS  P N  + G +     +   
Sbjct: 1664 SRTENMATGTPAFGEKVLKLSDKPAFSFQPSSKSNPFTSALPGNNNVFGMKPTFSFTPGS 1723

Query: 1760 TEP---PTHLAPSFNIPATQGXXXXXXXXXXXXXXEERTVNEQEENNAFDGIGQFQDRKV 1816
            ++P   PT  +  FN  A                  E ++ E++E+ +  G    Q+ KV
Sbjct: 1724 SQPESRPTFGSTGFNTTA-------EPESNRSSSQSEESIPEKQESASVQG----QNGKV 1772

Query: 1817 QEEGENLIEIAGASKDESKSNKRPIDEVGELKDDDDEVN 1855
             EE         A  + + + KRP D+    + DD+E +
Sbjct: 1773 AEE---------AGSNVTTTQKRPADD----QPDDEETH 1798

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score =  941 bits (2433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 660/1816 (36%), Positives = 1053/1816 (57%), Gaps = 130/1816 (7%)

Query: 21   LNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINS 80
            +  I+SF +    +V ++D  +V  L+ K  QF +LK++N++ +VTLDELK++S ++  +
Sbjct: 18   VTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRSEA 77

Query: 81   LKTEMEDVLRQNDEIRKERNDTSS-KFESVQREKTHLSNELESIKRKLSDLSEEKKEIQS 139
             K ++E +    + +RKE++     KF+ +  EK + S E+  +K +L++L ++ +  +S
Sbjct: 78   FKLQLEKINENTESLRKEKDAFEDEKFKLID-EKANASKEVNLLKSQLTELKQQNEIFRS 136

Query: 140  SQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISNDLNSKSQLER 199
            S+Q  +++L+E++ +LE  +  +       K LR  +LELE + QT+ SNDL  K++++R
Sbjct: 137  SKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEMQR 196

Query: 200  RTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQLEKTNNDV 259
             TQE+NLL+SN  WLEKEL+SK++++ SYRQ+ N+ +    ++LN IR++ ++E++++  
Sbjct: 197  LTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNSIRSELEIERSSSQT 256

Query: 260  LRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVKEELNN 319
            L+ + N+LS+ LQ+K+ ++K+L DSS+ EK++F+ E+TLKQRLIDLLE Q+ + K EL +
Sbjct: 257  LKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFKTELES 316

Query: 320  TRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITEEAGKEDG--- 376
             R  N S  NSD    + +E EK++++L  TK KL   E++ ++L    +E    DG   
Sbjct: 317  AR--NKSVSNSD---HVDAEREKIIEELIETKKKLEISESKAVKLEETVDELLSTDGERG 371

Query: 377  -------------ILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPIINS 423
                          +  K +GD  LLKK+LI+E+R KE LQ Q+E+F++ELEHKVP++NS
Sbjct: 372  AGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVLNS 431

Query: 424  FKERTDTXXXXXXXXXXXXXHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDLCRQ 483
            FKERT+               TS +K  K  EL     K+A+Y+ +IH L +QR DL  Q
Sbjct: 432  FKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDLAHQ 491

Query: 484  IQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDIIQLQ 543
            +Q+LL+  SV NDS GPL  EE  FI+ I+ N   +  E D+Q+I++ERLV F  +++LQ
Sbjct: 492  VQHLLIQVSVRNDSNGPLTPEETNFIKKII-NSSESPVEQDAQRIISERLVRFESMVELQ 550

Query: 544  EKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKIHEL 603
            EKN ELL   RNLADKLE+ E +SK+  K +E+ET+ EAKEAILTLQ     LES++  +
Sbjct: 551  EKNMELLNSIRNLADKLEAEEKESKSKSKEVESETVKEAKEAILTLQEYNKSLESQLEII 610

Query: 604  EKEREKFKNWTMDQETSPNNSVIQQLTETKREL---ESQTQDLQARISQVTRESTENMSL 660
             KER+ FK    D+ TS   S +   +   R L   E + ++L+  +S +T ES +N+ L
Sbjct: 611  AKERDAFKILASDKGTSNGPSNVN--SSENRHLVLAEEKIKELENHLSSLTEESAKNIKL 668

Query: 661  LNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNA 720
            LN+E+  LY +++  S+ L +E+SSRILAE+R KL+SNTL++ K END+LRKR  +LQ  
Sbjct: 669  LNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSLQEN 728

Query: 721  ISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIXXXXXXXXXXXXXXXXXXXX 780
            I KQDSKTQ+T+   +SCKS+LSA++++L+N + ER L                      
Sbjct: 729  ILKQDSKTQQTIESLISCKSQLSALQSQLNNSQSERDLLRSIQENLKKENESLSEERNNM 788

Query: 781  HIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSK 840
             I++TQLQTLQ ERE+LL+ET+K+ Q K + L+   ++   +   K + I       DS+
Sbjct: 789  RILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISDYISTKDSQ 848

Query: 841  IEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLD--E 898
             +WYQ K + L ++  +    L+ K  +++  + +++SL  ++EE++ R+  +N L+  E
Sbjct: 849  EKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFNALNYSE 908

Query: 899  SIND--DSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQ 956
            S+    ++LR+ELEK++I L DAYSQ+++YK + +++++S   +   L++S   ++ +I+
Sbjct: 909  SVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYTEKIE 968

Query: 957  NLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNKEIEAVKT 1016
             LT E+   +D+V +L++Q+SNLNNEL+ Q              +  L+    E++ +K 
Sbjct: 969  TLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQSELDNMKA 1028

Query: 1017 EYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNL 1076
            EYE K+SKIQ+DL+QQT YANTAQ NYEQELQKHADVSK IS LR +   YK + ETL  
Sbjct: 1029 EYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYKSETETLRN 1088

Query: 1077 ARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPT- 1135
            A    +KAL+++E +W  Q     ++L L++ RIEDL++Q+K+LYDQI+    +  KPT 
Sbjct: 1089 AAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFL--SKGKPTS 1146

Query: 1136 --DAKSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNS 1193
              D    S    ++L +LRRE+DIL+TK+ V+ R+ K+LRQK+ LI+ +L+ +R +L   
Sbjct: 1147 SEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIELSKL 1206

Query: 1194 KVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIA 1253
            +      S  ++  +E+M +LNQLNLLRESN TLRNE   +  +++EL++EL+ L G + 
Sbjct: 1207 QRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKVQ 1266

Query: 1254 PIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLK 1313
            P+ES++  L+ S++EK+ +I L  EE  RWK+RSQDI+ K++++   +++KL  ++  L+
Sbjct: 1267 PLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQ 1326

Query: 1314 AQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNAN 1373
             +++ K+ +  + + +F RL++QA EKL A+K +Q +   QLN+LK  K  LE  L +  
Sbjct: 1327 QEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQK 1386

Query: 1374 ARIQELEDAKVAENRNQLSMIKKLQEDTEENSKEL---ETKLEENAIS---YDSTVXXXX 1427
              ++ LE       +N+ S    LQE  E +  +L   E KLE+   S    +  +    
Sbjct: 1387 EEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELNERI 1446

Query: 1428 XXXXXXXXXXXXXXXXXXXXXXXXGTEQDDL----SKVVESMKRSXXXXXXXXXXXXTRE 1483
                                    G++  +L    SK+VE++K                E
Sbjct: 1447 ESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMISDKESE 1506

Query: 1484 VNQKIRE----FQEAQEAE------ETGLKPSNINIDEIKKQWEAEHNEEVSKKIREAEE 1533
            + ++  E      EA+E E         L P  +NIDEIKK+WE E+ ++ S++IRE+ E
Sbjct: 1507 LREQFEEEKASILEAKEQELREQLATQKLDPP-VNIDEIKKKWEEEYEQKTSQRIRESNE 1565

Query: 1534 ALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXXXXKSISQSGKMEDIFQKQLESRIQE 1593
             LKKRIRLPT                                  K+  I +K        
Sbjct: 1566 QLKKRIRLPTEE--------------------------------KINKIVEK-------- 1585

Query: 1594 KQKELENEYNKKLQEKLRELPXXXXXXXXXXXXL----RADIE---AQLREEFNHELQTI 1646
            K+ ELE E+   +Q+K  E+             +    + D+E    +++++F+ ++  I
Sbjct: 1586 KRLELEAEFEANVQKKAEEIAKSKSASNSNSTEVLEKHKQDLENLKQEMQKKFDEDIAQI 1645

Query: 1647 KKKSFEEGKQQAMMKTTLLERKLAKMESQL------------SETKQSVDSPPKHLSKMP 1694
            KK++FEEGKQQA MK+T LE+K+AK+E+Q+            S    +   P     K  
Sbjct: 1646 KKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHDSAIPINDNSSATPAESGPTTQDVKQL 1705

Query: 1695 NPLLGLPRKIEENSNPPYNPXXXXXXXXXXXXXXXXXXXFNPFTS-P---SPNKPLQ--- 1747
             P+L     I      P+NP                    NPF S P   +PN P +   
Sbjct: 1706 TPILNNQAAILPGKPLPFNPAHFAFGMPFGQTTSNSFQ--NPFNSQPPEQTPNSPKRPSE 1763

Query: 1748 ---GDEAEREPSSNET 1760
               G   E++P  N++
Sbjct: 1764 EPVGGSPEKKPKENDS 1779

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  917 bits (2369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/1558 (38%), Positives = 947/1558 (60%), Gaps = 35/1558 (2%)

Query: 11   TQNDEDTGERLNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDEL 70
            T  D      L  +++F+    +Q+  ID  I+T L +K+L FNELKS+N+++ VT+DE+
Sbjct: 13   TSGDNHNDVSLGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEI 72

Query: 71   KTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNELESIKRKLSDL 130
            KT S+K+   LK E+E++++ ND IR ER+    +     R+K  + NE+ES++ KLSDL
Sbjct: 73   KTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSDL 132

Query: 131  SEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISND 190
             +E++ ++  ++  + +L+E++KELE  +  S  S  + K+LR  +LELET  Q   S +
Sbjct: 133  DQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSKE 192

Query: 191  LNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDF 250
            L  +S+++  TQ L +LQ N  WLE+E++SK +Q +S R+K +  +  + ++    +N+ 
Sbjct: 193  LRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNEL 252

Query: 251  QLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQL 310
            QLEK+ N V+  KN EL+K LQEKL+++K LSDS   EK++F+ E+++KQ+LIDLLE+Q+
Sbjct: 253  QLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQV 312

Query: 311  NAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITEE 370
             +++ ELN + + +  ++ +   +   +ENEKL+++L   K    + E E LRL ++ +E
Sbjct: 313  KSLQGELNASLDKDNVELLASGERN--TENEKLIQELITLKENFEESERERLRLEALVQE 370

Query: 371  --AG--KEDGI--------LTSKSNG--DFILLKKQLIKEKRAKEHLQNQIESFIVELEH 416
               G   +D I        L +K +   D  +LKK+LIKE+  KE LQ Q+ESFIVELE+
Sbjct: 371  LIPGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFIVELEY 430

Query: 417  KVPIINSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQ 476
            K+P+INSFKERT               HTSNEK  + +E +  ++K+ + +  IH L++Q
Sbjct: 431  KIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQ 490

Query: 477  RLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEF 536
            R DL  Q+Q+LL+  SV  DS G L  EE+ FI+ I+ NDD   +ESDSQ++++ERLVEF
Sbjct: 491  RTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDD-PNSESDSQRVISERLVEF 549

Query: 537  RDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQL 596
             +I  LQEKN ELL+  R LA+KLES E      ++  EN+TI EAKEAI++LQ     L
Sbjct: 550  NNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANL 609

Query: 597  ESKIHELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELES---QTQDLQARISQVTRE 653
            ESK+  L KE + FK       +  N S+    T+  R   S   + + L+AR++ +T E
Sbjct: 610  ESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTVE 669

Query: 654  STENMSLLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKR 713
            S++N  +LN E+ +LY SK+ +SIEL +E+SS+ L EER KL+ +TL+L + EN QL KR
Sbjct: 670  SSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKR 729

Query: 714  SINLQNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIXXXXXXXXXXXXX 773
            S NLQ+   +QDS+T ET+N+ ++C SKL+ +ET+++NL+ E+ L               
Sbjct: 730  SQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKL 789

Query: 774  XXXXXXXHIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQL 833
                    IMV+QLQTLQ ERE  L E + + +  +D+L+  + + +     K +  + +
Sbjct: 790  SEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAEDM 849

Query: 834  EEDNDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTY 893
            E    ++I+WYQ+K++++  + + +   L  K   V   + E++ LEK++EE++ R+ +Y
Sbjct: 850  ENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQSY 909

Query: 894  NVLD----ESINDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNK 949
             VL     E+  + SLR+ELEK+KINL+D Y++I +YK L  TT++SL +++       +
Sbjct: 910  QVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNLLSTTEESLSQLTQDYASGKQ 969

Query: 950  AFSNQIQNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNK 1009
                Q++ L +EK+ L+D V+ L E ++ L   L   N+A           I+ L+  +K
Sbjct: 970  ELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETESK 1029

Query: 1010 EIEAVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKG 1069
                +K EY++++ K+Q+DL+QQ  +AN AQ NYE+ELQK ++VSKTISELREQ    + 
Sbjct: 1030 GSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKDRI 1089

Query: 1070 QVETLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTT 1129
             +  L  +  Q  + L++NE +W++QKE    QL+ S   +EDLS+QN LLYDQIEL++ 
Sbjct: 1090 AITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFSK 1149

Query: 1130 TGNKPTDAKSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTK 1189
              +   + ++  V   +IL  LRRERDIL TK+ V++R+ + LR  ++ ++ EL   + +
Sbjct: 1150 DNSDGVNGETAEV--REILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKRQ 1207

Query: 1190 LCNSKVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLR 1249
            L   + E    S +I QH++++E+LNQLNLLRESN TLRN  +  N KN+ELQ EL +LR
Sbjct: 1208 LSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITLRNAAEEENKKNRELQEELNQLR 1267

Query: 1250 GNIAPIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEI 1309
              I P+ESEL  L  S+ EK+Q++ L KEE +RWK+RSQ+I+ KH ++   D+++L+ ++
Sbjct: 1268 ERILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEKV 1327

Query: 1310 ESLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSL 1369
              L+ +L++  ++  + +++FNRL++QA EKL +SK++Q +   QLNEL++AK  LE   
Sbjct: 1328 SILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKF 1387

Query: 1370 NNANARIQELEDAKVAENRNQLSMIKKLQE---DTEENSKELETKLEENAISYDSTVXXX 1426
                 ++ EL++ ++  + N    ++ +Q+   D  E+S+ELE  L  +A    +     
Sbjct: 1388 EAEERKVHELQE-RLNAHGNDTETVESVQKELSDALEHSRELEQNL--SATLQQNEEITK 1444

Query: 1427 XXXXXXXXXXXXXXXXXXXXXXXXXGTEQDDLSKVVESMKRSXXXXXXXXXXXXTREVNQ 1486
                                     G   +DLS VVESM+RS            T E+ +
Sbjct: 1445 KLNDEIDSLKLELHSLKEQSAATAKGEISEDLSNVVESMRRSFEEEKINFLKEKTEELKK 1504

Query: 1487 KIREFQEAQ-EAEETGLKPSNINIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPT 1543
               E    Q    E   +P  +N +EIK+QWE+E  E + K+I EAEE LKKRIRLPT
Sbjct: 1505 LEEEKHTLQVNGNEPQQQP--VNYEEIKRQWESEQEESILKRIAEAEENLKKRIRLPT 1560

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 70/147 (47%), Gaps = 37/147 (25%)

Query: 1627 LRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKQSVDSP 1686
            L+  +E  L+E+F  E+Q +KKK+FEEGKQQA MK+TLLERK++K+ESQL      VDSP
Sbjct: 1600 LKKQLEKDLQEKFEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQL---HGKVDSP 1656

Query: 1687 PK---HLSKMPNPLLGLPRKIEENS--------NP-----------PYNPXXXXXXXXXX 1724
             K     S +P P   LP KI+E S        NP           P  P          
Sbjct: 1657 DKSSSETSSVPKP--NLPSKIDEKSVTTNQSVPNPLVSGEKVLKLDPSKPTFNFSSFSGG 1714

Query: 1725 XXXXXXXXXFNPFTSPSPNKPLQGDEA 1751
                      NPFTS   N    G  A
Sbjct: 1715 ----------NPFTSSPQNNDTMGTSA 1731

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/1796 (34%), Positives = 986/1796 (54%), Gaps = 113/1796 (6%)

Query: 10   STQNDEDTGERLNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDE 69
            ST  D  T E L  I SF    +EQ+ +I+  I+++L  K+ QF EL+S++++  V+L+E
Sbjct: 2    STAADTLTKEELTLIGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEE 61

Query: 70   LKTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNELESIKRKLSD 129
            L+  S  +IN L+T++ED++ QN    +E+     +    ++E   LS+  ++++ +L +
Sbjct: 62   LQKTSQGRINDLRTQLEDLIEQNASASEEKKKIEKELSDEKKESFQLSSTRDNLRAELKE 121

Query: 130  LSEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISN 189
            + E+   +Q   Q T+K+LD ++ + E+ K  +    ++ ++  +   +LE + Q+   N
Sbjct: 122  IQEKFDNLQKQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKYN 181

Query: 190  DLNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRND 249
            D  +++ + + +Q+L  +   K+ LE EL +K+++   Y       I  +R  ++ + N+
Sbjct: 182  DSLTETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENN 241

Query: 250  FQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQ 309
              + K+ ND L+++N  +S +L EK  +++ L++  N+EK +   E++LKQ +ID+L++Q
Sbjct: 242  CSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTEKEESQKELSLKQEMIDVLQTQ 301

Query: 310  LNAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCEN----ECLRLS 365
            +  ++++      +    V +D+ + L  E E+L       K KL++ E     E     
Sbjct: 302  VQKLQDDYTRILNTKQPIVQNDEERNL--EVEEL-------KQKLIETETQLNKELEERR 352

Query: 366  SITEEAGKEDGILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPIINSFK 425
            +IT +   E   L+++   D   +KK+LI+E+  KE LQNQ+E FIVELE KVP INSFK
Sbjct: 353  NITMQT--ESSTLSNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFK 410

Query: 426  ERTDTXXXXXXXXXXXXXHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDLCRQIQ 485
            +RTD              +   EKN    EL    +     K E   L+KQR DL  Q+Q
Sbjct: 411  QRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQ 470

Query: 486  YLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDIIQLQEK 545
            Y+L+  SV NDS GPL  EE++FIQ+IL N+ +  + SDSQ++++ERLV F++I++LQ+K
Sbjct: 471  YILIHTSVQNDSNGPLSAEEVRFIQDILDNESNEES-SDSQQVISERLVTFQNIVELQQK 529

Query: 546  NSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKIHELEK 605
            N +LL+  R LA KLE  E   ++  + +E + I+EAKEAI++LQS   +LE KI  L  
Sbjct: 530  NIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLND 589

Query: 606  EREKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMSLLNKEL 665
            E + +K+        P+  V  +      E     ++L+ R++    ES +  + LN E+
Sbjct: 590  ELDCYKSLP-----KPDTKVETEHLRLNEENTDLIKELETRLATSREESNKTFASLNNEI 644

Query: 666  QDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNAISKQD 725
             D+  + S    E   E++SR LAE+R KL+ N+L L+K EN+QL+KR   LQ+   KQD
Sbjct: 645  DDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQD 704

Query: 726  SKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIXXXXXXXXXXXXXXXXXXXXHIMVT 785
             +TQETL +YVSCK  LS  + EL+ ++ +  +                        +V+
Sbjct: 705  QRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVS 764

Query: 786  QLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSKIEWYQ 845
            QLQ+LQ ERE + + TK   Q ++D ++    ++  +   KD+ IK+LE +  S+IEWYQ
Sbjct: 765  QLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQ 824

Query: 846  NKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLDESIND--- 902
            NKI+ +++  ++    L EK  E+    YEIK L+K+++ ++ R+  Y VL+ S N    
Sbjct: 825  NKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTK 884

Query: 903  -DSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTDE 961
             ++L+ ELEKSKINL++AY+++ +YK+     ++ L+   + ++E+ K F  +I+ L  +
Sbjct: 885  METLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKD 944

Query: 962  KTSLEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNKEIEAVKTEYESK 1021
            +  L D  S+L EQ+++LNNELD QN+A           ++ L   N  IE V  +YE K
Sbjct: 945  RDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELK 1004

Query: 1022 LSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQF 1081
            LS +Q DL+QQ  YAN AQNNYEQELQKHA+++KTIS+LRE  HTY+ +++++       
Sbjct: 1005 LSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTN 1064

Query: 1082 EKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSGS 1141
            E+ L++NE  W  Q++S  +Q+     RIEDLSSQNKLL+DQ++L + + N   + +S +
Sbjct: 1065 EELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSEN-SYNQQSSA 1123

Query: 1142 VLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVENEKRS 1201
              N D++++LR +RDIL T+++V E + K LR K+S ++ EL   R KL   + + E   
Sbjct: 1124 TPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQYENTK 1183

Query: 1202 FIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELAA 1261
              +++HD +M +LNQLNLLRESN TLRNE + S  K K+LQ +LE LR  + P+E+E   
Sbjct: 1184 ISVEEHDNIMNQLNQLNLLRESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNR 1243

Query: 1262 LKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKTQ 1321
            LK  I+E EQ++   KEE +RWK+RSQDI+ KH+++   ++EKLE EI +LK  L DK +
Sbjct: 1244 LKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKK 1303

Query: 1322 QGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQELED 1381
            +  +  ++FNR+++QA E+L +SK +Q + I+Q+ +L+D    ++  L      IQ  E+
Sbjct: 1304 ENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTEE 1363

Query: 1382 AKVAENRNQLSMIKKLQEDTEE---NSKELETKLEENAISYDSTVXXXXXXXXXXXXXXX 1438
             K  +   Q   +  L+   EE   +SKE E K   +  S D                  
Sbjct: 1364 -KFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNASVKSSDEISSHLNDVIDSLNNELT 1422

Query: 1439 XXXXXXXXXXXXXGTEQDDLSKVVESMKRSXXXXXXXXXXXXTREVNQKIREFQEAQEAE 1498
                         G  Q DLS VVE MK+S            T E  +K+ E  +  EA+
Sbjct: 1423 HLKESKNNEATVTG--QPDLSNVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQ 1480

Query: 1499 ETGLKPSNI----NIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTXXXXXXXXXXX 1554
             T  +  N+    +I   ++QWE E+ E V K+I +AEE LK+RIRLPT           
Sbjct: 1481 ATDTQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLPT----------- 1529

Query: 1555 XXXXXXXXXXXXXXXXKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELP 1614
                                         ++++ S IQ+K+ ELE EY++K+ ++ +EL 
Sbjct: 1530 -----------------------------EEKINSVIQKKKNELEKEYDEKVNQRAKEL- 1559

Query: 1615 XXXXXXXXXXXXLRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMES 1674
                        L+ DI+ +L    + EL+  K K+FEEGKQQAMMKTT LE+K++K+ES
Sbjct: 1560 LSSEENKTFIEDLKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLES 1619

Query: 1675 QL------SETKQSVDSPPKHLSKMPNPLLGLPRKIEENSNPP-------YNPXXXXXXX 1721
            QL      +E K  V+     L K P+    +P K EE  + P        NP       
Sbjct: 1620 QLQGSNAANENKNDVEV----LLKTPSDENNVPSKQEETLSKPQLSKIQIANPLLSTGGT 1675

Query: 1722 XXXXXXXXXXXXF-------NPFTSPSPNKPLQGDEAEREPSSNETEPPTHLAPSF 1770
                                NPFTSP             + + N+   P    P+F
Sbjct: 1676 TLALNQSRAPSSLQNGSDSSNPFTSPF------------QQTKNDANIPAVTQPAF 1719

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/1394 (37%), Positives = 854/1394 (61%), Gaps = 41/1394 (2%)

Query: 1    MSDRNASMRSTQNDEDTGERLNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSEN 60
            MS R AS  S   D       + +A+F +    +V+ +D  +VT    K  +F+++K++N
Sbjct: 1    MSQRGASDSSISVD------YSKVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADN 54

Query: 61   IQITVTLDELKTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNEL 120
            +++++++D LK N  +KIN+ K ++E +L      ++E+  T  +   +  EK  LS E+
Sbjct: 55   MRLSISIDGLKCNFEQKINTFKEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEV 114

Query: 121  ESIKRKLSDLSEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELE 180
              ++ ++ +  +  + I S++Q   K+L+E++ +L   K  S+   +  K+LR + ++LE
Sbjct: 115  LKLRSQVEEAKQGMEIIASAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLE 174

Query: 181  TKQQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIR 240
               Q Y S +L  KS+++R  QELNL++SN DWL KEL SKN+Q  S+R+KTN+ +    
Sbjct: 175  FIIQGYKSQELREKSEIQRLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGY 234

Query: 241  NDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQ 300
              +N +++  +  + NN  L+ K  ELS  LQEKL++ K L+D  N+EK +F+ E++LKQ
Sbjct: 235  EQVNSLKSQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQ 294

Query: 301  RLIDLLESQLNAVKEELNNTRES-NYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCEN 359
            RLIDLLESQ++++K +L N  +S N + +++ +  QL+ E     K+L+ T+ + ++ E 
Sbjct: 295  RLIDLLESQVSSMKSDLENAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEA 354

Query: 360  ECLRLSSITEEAGKEDGILTSKSN-----------------GDFILLKKQLIKEKRAKEH 402
                L S+    GK +G+    SN                 GD  +LKKQL++E+R KE 
Sbjct: 355  TVNELLSVN---GK-NGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEE 410

Query: 403  LQNQIESFIVELEHKVPIINSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIKELKVKNEK 462
            LQNQ+ESF+VELEHK+PI+NSFKERTD               T+ +++ K  EL     K
Sbjct: 411  LQNQVESFVVELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNK 470

Query: 463  LAEYKDEIHILSKQRLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTE 522
            +  Y+ ++  L  QR DL  Q+QYLL+  SV +D+ GPL ++E++F++ I+ ++D A  +
Sbjct: 471  INNYESQVCSLIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEA-PK 529

Query: 523  SDSQKIVTERLVEFRDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEA 582
            SD+Q I++ERLV+F+ +I+LQ KN+ELL   R LADKLE  E KS+  LK++E +T+ EA
Sbjct: 530  SDTQGIISERLVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEA 589

Query: 583  KEAILTLQSQKVQLESKIHELEKEREKFK--NWTMDQETSPNNSVIQQLTETKRELESQT 640
            KEAIL+LQ    +LE ++  + KER+ FK  N    Q  S  +S  Q      ++L+   
Sbjct: 590  KEAILSLQEHVQRLEDQLKIVSKERDAFKLANSANKQGDSAPSSTYQ-----SKKLDEHI 644

Query: 641  QDLQARISQVTRESTENMSLLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTL 700
             +L+ R+  +  +S +N+ LLN E++ LY +KS +++ L +E+SS++LAEER KL+ +TL
Sbjct: 645  MELEKRLKNLAEQSQDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTL 704

Query: 701  DLAKAENDQLRKRSINLQNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKI 760
             L K EN +L KRS +LQ  + KQD KTQ T+++ ++ KS+LS + ++L+ L  ER    
Sbjct: 705  SLTKEENLELHKRSDDLQRVLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLR 764

Query: 761  XXXXXXXXXXXXXXXXXXXXHIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELK 820
                                 I+V+QLQTLQ+ER+ LL+E + + +  I+ L++  +E +
Sbjct: 765  KIEAELKNENEALTKENTTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETR 824

Query: 821  TEAIRKDQYIKQLEEDNDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLE 880
               +R+ +  ++    + S+ +W+Q K+++L +  ++   +L EK   +E  Q   KSL 
Sbjct: 825  EHLVRRTREYEEQRVSDTSQYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLT 884

Query: 881  KEIEENKIRLHTYNVLDES--IND--DSLRRELEKSKINLTDAYSQIQEYKKLYETTDKS 936
             ++EE ++R  +Y+VL  +  I D  ++LR+ LEK+ INL DAYSQI++YK + + +++S
Sbjct: 885  AKLEEAELRTQSYSVLANADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQS 944

Query: 937  LQEMSSQLDESNKAFSNQIQNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMXXXXXX 996
              E+S  L+ES   +   I  L  E+ SL D+++LL +Q+ +LN+ELD Q          
Sbjct: 945  AVEISKALEESQANYRKNIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSE 1004

Query: 997  XXXXISILQNNNKEIEAVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKT 1056
                +SILQ + + ++ +K+EYE K+SK+Q+DL QQ  YAN AQ NYEQELQKHADV+KT
Sbjct: 1005 LIKKLSILQGSQRSLDELKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKT 1064

Query: 1057 ISELREQLHTYKGQVETLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQ 1116
            IS LRE+   YK ++E    +  + + AL+ NE +W  Q   L  QL L+  R E+L++Q
Sbjct: 1065 ISLLREESQKYKSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQ 1124

Query: 1117 NKLLYDQIELYT-TTGNKPTDAKSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQK 1175
            N+LLYDQ+EL +  T +    A S S  + ++++TLRRERDIL+TK+ V+ R+ K+LRQ+
Sbjct: 1125 NRLLYDQVELLSKATSSDSEAAASMSAESRELIMTLRRERDILETKLDVSIREEKILRQR 1184

Query: 1176 ISLIDVELQEARTKLCNSKVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSN 1235
            + L   EL+  R +   ++       F  +  +++MEKLNQLNLLRESN TLRNE     
Sbjct: 1185 LGLAKTELENVRLEFSKTQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYL 1244

Query: 1236 SKNKELQSELERLRGNIAPIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQ 1295
             +++  Q+E+ +L+  + P+ES+L +L  +I E++Q+I L KEE  RWK+RSQDI+ K++
Sbjct: 1245 EQSQHFQNEIAKLQEQLQPLESQLKSLTITISERDQQISLLKEESSRWKQRSQDILHKYE 1304

Query: 1296 QLSSTDYEKLETEIESLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQL 1355
            ++   +++KL  E+  LK +LE K+ +  +S+E+F +LR+QA E+L   K ++     + 
Sbjct: 1305 RIDPVEHQKLADEVTELKNELEKKSLENLESQERFRKLRKQANERLDEFKAAKAKVESEF 1364

Query: 1356 NELKDAKLALEKSL 1369
              +  AK  LE  L
Sbjct: 1365 EAVSIAKAQLEAEL 1378

 Score = 62.4 bits (150), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 85/178 (47%), Gaps = 46/178 (25%)

Query: 1504 PSNINIDE--IKKQWEAEHNEEVSKKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXX 1561
            P+   IDE  +K + EAE+ ++  ++IREAEEALKKRIRLP+                  
Sbjct: 1529 PNAPLIDEETLKSKLEAEYEKKTLERIREAEEALKKRIRLPS------------------ 1570

Query: 1562 XXXXXXXXXKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLREL----PXXX 1617
                                  ++++   I+ +Q+ L+ E+  +++ +  EL    P   
Sbjct: 1571 ----------------------EERINQVIERRQRALDQEFELRVRARALELFKENPESF 1608

Query: 1618 XXXXXXXXXLRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQ 1675
                        +   +L  +F+ +L  ++KK+FEEGKQQ +MK  LLE K+AK+E Q
Sbjct: 1609 VGDTAKLIKEHQEEMDKLEAKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQ 1666

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/1753 (33%), Positives = 969/1753 (55%), Gaps = 154/1753 (8%)

Query: 24   IASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINSLKT 83
            IA+F +     V+S+ +++   +  K  +F +L+S+N++  V L+E K N + K   LK 
Sbjct: 9    IATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEKLKE 68

Query: 84   EMEDVLRQNDEIRKERNDTSSKFESVQ-------REKTHLSNELESIKRKLSDLSEEKKE 136
            E++ V+  N ++R E    S K  S++        E   L    E ++  +   +E  KE
Sbjct: 69   ELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNNIDRANERYKE 128

Query: 137  IQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISNDLNSKSQ 196
            +  S        DE++ ELE ++       ++ K L   ILELE K Q Y S++LN KS+
Sbjct: 129  LNGS-------YDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSE 181

Query: 197  LERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQLEKTN 256
            LER  QE+ LL+ N++WLE+EL++KNQ ++ YR+KT+ ++ +   ++ ++++D ++EK++
Sbjct: 182  LERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDLKIEKSS 241

Query: 257  NDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVKEE 316
             ++L +K +E ++ LQ  L++ K L D    EK++F  E+++K +LI L E+Q+ +++  
Sbjct: 242  KEILSKKLDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLEST 301

Query: 317  LNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITE------- 369
            L    ++  ++ N ++S +++   + L ++L L + KL   E +C+RL SI +       
Sbjct: 302  LQQKFKT--AEANEENSSEVV---KSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVS 356

Query: 370  --------------------EAGKED--GILTSKSNGDFILLKKQLIKEKRAKEHLQNQI 407
                                E G  D   I  S+  GD  +LK+QL++EKR KE LQNQ+
Sbjct: 357  LQTKGRKRTYSNDSNSNSSDELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQV 416

Query: 408  ESFIVELEHKVPIINSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIKELKVKNEKLAEYK 467
            ESF++ELEHK+P+INSF+ERT               H + E   K  EL+   +K+++  
Sbjct: 417  ESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDN 476

Query: 468  DEIHILSKQRLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQK 527
             ++ IL +QR DL  Q+QYLL+  S+ ND+   L ++EIKFI+N++ ND+ A+T +DSQK
Sbjct: 477  SQLEILLRQRTDLAHQLQYLLINISIINDNDHLLNEDEIKFIKNLVSNDNMAST-NDSQK 535

Query: 528  IVTERLVEFRDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNI---ENETINEAKE 584
            +++E L++F+DI QLQEKN EL++  R LA +LE NE K K+   N    +NE   EAKE
Sbjct: 536  VISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNEIFAEAKE 595

Query: 585  AILTLQSQKVQLESKIHELEKEREKFKNWTM-DQETSPNNS-VIQQLTETKRELESQTQD 642
            AILTL+     LE  +  + KER+ FK     D+E +  +S  + +  E K   E+  +D
Sbjct: 596  AILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETVVKD 655

Query: 643  LQARISQVTRESTENMSLLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDL 702
            L+ R++Q+T +S  +   L +EL  L+   S L++++ + +S++ LAEER K+  N+++L
Sbjct: 656  LENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMEL 715

Query: 703  AKAENDQLRKRSINLQNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIXX 762
               EN+QLR RS  L++++ +QD +TQ+T + YV   SK S++ET + NL+ E TL    
Sbjct: 716  LSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDR 775

Query: 763  XXXXXXXXXXXXXXXXXXHIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTE 822
                               IMVTQLQ+LQ ERE LL+  +   + +I  +     +L  +
Sbjct: 776  EISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQ 835

Query: 823  AIRKDQYIKQLEEDNDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKE 882
               +   I ++E++ +++ EWYQ KI+   +  + +   L  K  E+ER   + K+LEKE
Sbjct: 836  LSERVHEIDKIEKERNAQYEWYQKKIDEASQQQQQIQGQLQTKNDELERLHLQNKTLEKE 895

Query: 883  IEENKIRLHTYNVLD----ESINDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQ 938
            +E  +IR+HTY  ++    E+  ++ + +ELEK+KI L DAYSQ++E+K L + ++ +L+
Sbjct: 896  LEGAQIRIHTYETINQNNSENQEENDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALK 955

Query: 939  EMSSQLDESNKAFSNQIQNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXX 998
            E+++  +  ++ + + I+ LT+EKT +E +  +L++Q+ N+ NEL +Q++          
Sbjct: 956  ELNASFNAKDRDYRDAIKTLTEEKTEIEGRFEILKQQLENIKNELTVQSEEAESERKRLT 1015

Query: 999  XXISILQNNNKEIEAVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTIS 1058
              I+ LQ   + IE VK  +E KL K++ DL++QT+YAN AQ NYEQELQ+HADVSKTIS
Sbjct: 1016 QTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTIS 1075

Query: 1059 ELREQLHTYKGQVETLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNK 1118
            ELREQ    K   ++L       +  + +NE +  S+++    Q+DL+  RI+D++ QN+
Sbjct: 1076 ELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQ 1135

Query: 1119 LLYDQIELY----TTTGNKPTDAKSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQ 1174
            LLY+QI+L     +   N   D  +GS     ++++LRRERDILDTK+ V E +   L+Q
Sbjct: 1136 LLYNQIDLLNRAESVNENSSDDEANGSTA---LVLSLRRERDILDTKINVIETEKNSLQQ 1192

Query: 1175 KISLIDVELQEARTKLCNSKVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSS 1234
            K+  I  EL+  +      + E  + S +I  +  +   L QLNLLRESN TLRNEL  +
Sbjct: 1193 KLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQA 1252

Query: 1235 NSKNKELQSELERLRGNIAPIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKH 1294
              +  ++  +L+  R  + P++S L +    I+EK+ +I    +E  RWK R ++++EKH
Sbjct: 1253 LDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKH 1312

Query: 1295 QQLSSTDYEKLETEIESLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQ 1354
            Q+++  DY KLE  +   K  L++K Q+  +  ++FNRL++QA EKL  SK  Q S  EQ
Sbjct: 1313 QKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQ 1372

Query: 1355 LNELKDAKLALEKSLNNANARIQELEDAKVAENRNQLSMIKKLQE---DTE--------- 1402
            ++ L   K  + K L           D K  EN   LS +   +E   D E         
Sbjct: 1373 ISNLISEKDDIRKQL-----------DVKTEENSELLSELNNFREKQNDLETLREELNKE 1421

Query: 1403 -ENSKELETKLEENAISYDSTVXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTEQDDLSKV 1461
               S+ELE KL +N I   S                                EQ +  + 
Sbjct: 1422 ISKSEELEVKL-QNEIESSSLASRNTNKEIEELQKVIDDLKTQLAANSTDADEQTN--RN 1478

Query: 1462 VESMKRSXXXXXXXXXXXXTREVN-------QKIR-EFQEAQEAEETGLKPSNINIDEIK 1513
            VE++KR             T E N       +KIR EFQE  E  +T L   N++++ ++
Sbjct: 1479 VEAIKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQE-NEKPDTEL---NVDVEALR 1534

Query: 1514 KQWEAEHNEEVSKKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXXXXKSI 1573
            KQWE +  E + K+I EAE+ LKKRIRLP+                              
Sbjct: 1535 KQWEEDSEELIQKRIAEAEDNLKKRIRLPS------------------------------ 1564

Query: 1574 SQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPXXXXXXXXXXXXLRADIEA 1633
                      ++++   I++++ ELE+E+++K+++K R+L             L+  +E 
Sbjct: 1565 ----------EEKINKIIEKRRSELESEFDQKIRDKARDL-LMNDHSNEFNNELKEALEK 1613

Query: 1634 QLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSE----TKQSVDSPPKH 1689
            +L+E F  ELQ  +KK+FEEGKQQA MKTTLLERK+ K+ESQ+ E    ++++ D  P+ 
Sbjct: 1614 ELKERFEDELQAARKKAFEEGKQQATMKTTLLERKIQKLESQIQEKEKDSEETQDVKPEE 1673

Query: 1690 -----LSKMPNPL 1697
                 + K+P  L
Sbjct: 1674 NSTPSVKKIPETL 1686

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/1364 (36%), Positives = 825/1364 (60%), Gaps = 39/1364 (2%)

Query: 27   FFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINSLKTEME 86
            F      ++ ++D  +V ++  K  +F +L++EN++ +VT+DEL+++S +K+ + K ++ 
Sbjct: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81

Query: 87   DVLRQNDEIRKERNDTSSKFESVQ----REKTHLSNELESIKRKLSDLSEEKKEIQSSQQ 142
             +L++ + +R E    S++FE ++     EK    N+ E+++ +   L ++K+ ++SS+ 
Sbjct: 82   LLLQELESLRGE----SAQFEKMKLELTSEKQRALNDSETLRVRKEALEQQKQALESSKN 137

Query: 143  RTLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISNDLNSKSQLERRTQ 202
               ++L+E++ EL   K  ++    E ++LR   L+LE++ +   S DL  K++L R +Q
Sbjct: 138  DVARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQ 197

Query: 203  ELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQLEKTNNDVLRQ 262
            EL+L +SN +WLE +L  KN ++ +YR  T + ++ +   L  +  + Q     N  LR+
Sbjct: 198  ELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLETLEQELQASTRTNKSLRE 257

Query: 263  KNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVKEELNNTRE 322
             N  ++ DL+ +L  +K L+D+ NSEK++F+ E++LK+RL+DLLE Q+ ++K +L     
Sbjct: 258  HNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLELRST 317

Query: 323  SNYSDVNS------------DDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITEE 370
            +   D  S                Q + E+E  ++ L+ T   LV  + E  RL S    
Sbjct: 318  AGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKES-RLKS---- 372

Query: 371  AGKEDGILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPIINSFKERTDT 430
            +  E     +   GD  LLK+Q+I EKR KEHLQNQ+E+F+VELE KVP+++SFK+R D 
Sbjct: 373  SAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRNDM 432

Query: 431  XXXXXXXXXXXXXHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDLCRQIQYLLVT 490
                           S +K +   +L+    ++ +++ +I  L++QR DL RQ+QYLL+ 
Sbjct: 433  LEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQ 492

Query: 491  NSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDIIQLQEKNSELL 550
             SV +DSKGPL  EEI F++ IL+  D  + E D+QK+++ERLVEFRDI++LQ KNS+LL
Sbjct: 493  ASVRSDSKGPLTTEEIAFVRRILEQGD-LSLERDTQKVISERLVEFRDIVELQSKNSDLL 551

Query: 551  RVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKIHELEKEREKF 610
            R  RNLADKLES E +SK   K +EN+ I EAKEAI+TLQ    +LES+I  L KER+ +
Sbjct: 552  RTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDAY 611

Query: 611  KNWTMDQETSPNNSVIQQ-LTETKRELESQTQDLQARISQVTRESTENMSLLNKELQDLY 669
            K   +   T+  N + +  L  +K ++ ++  DL+  +     E+ +NM +LN E+Q+L 
Sbjct: 612  K--AIQPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELL 669

Query: 670  DSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNAISKQDSKTQ 729
              K+ L+IE+ +E++S+ LAEER K+   +L L K EN++L KR   +Q+ + KQD+KTQ
Sbjct: 670  RQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKTQ 729

Query: 730  ETLNDYVSCKSKLSAIETEL--SNLKLERTLKIXXXXXXXXXXXXXXXXXXXXHIMVTQL 787
            ETL+  + C+SKL+ +E+EL  S  K+E                          I+VTQL
Sbjct: 730  ETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNLT--ILVTQL 787

Query: 788  QTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSKIEWYQNK 847
            QTLQ ER+ LL ET+KS + K+DAL+   ++L+T+  RKD+      + NDS+ +WYQ K
Sbjct: 788  QTLQGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEK 847

Query: 848  IETLRKDHESVMSSLNEKQIEVER-FQYEIKSLEKEIEENKIRLHTYNVLDES----IND 902
            I++L +  + V S L E Q +  R  + + K LE  ++E + +  +Y+VL+++       
Sbjct: 848  IDSLNETLKVVTSQL-ESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQT 906

Query: 903  DSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTDEK 962
            ++LR ELEKSKI L DAYSQI+E++  Y++ +++L  +++  +      S    N+  ++
Sbjct: 907  EALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNMKKKE 966

Query: 963  TSLEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNKEIEAVKTEYESKL 1022
              L  +V  L+ Q+SNLNNEL  Q +            +  LQ+  + + ++K  YE +L
Sbjct: 967  DELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQL 1026

Query: 1023 SKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQFE 1082
             K+ +DL+QQ  +AN AQ NYEQELQ+HADVSKTIS+LRE+   YK Q   L  +  Q E
Sbjct: 1027 GKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQSSIEQLE 1086

Query: 1083 KALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSGSV 1142
            K L E++  W +QKE    QL   N RIEDL+ QN LL DQ++L     N          
Sbjct: 1087 KTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQSEPQE 1146

Query: 1143 LNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVENEKRSF 1202
               +++ +LRRERDIL TK+ V++R   +  +K+  I+ EL  A+ +L + +  + + S 
Sbjct: 1147 KVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEELSSLQALSSQNSI 1206

Query: 1203 IIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELAAL 1262
            +  +H++++E+LNQLNLLRESN TLR+E+     + +EL+ +++ L+ ++ P+ESELA+L
Sbjct: 1207 MADEHNKLLEQLNQLNLLRESNITLRSEVQKKTQRCQELEGQIDNLQQSLQPLESELASL 1266

Query: 1263 KFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKTQQ 1322
            K S++ K+ +I L  EE +RWK+RSQDI+ K +++   +++KL  E+   KA+L  K  Q
Sbjct: 1267 KRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKADQ 1326

Query: 1323 GADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALE 1366
             ++ E++F RL++QA+E+L A+K  Q++   +L + ++A+  +E
Sbjct: 1327 NSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNME 1370

 Score = 79.0 bits (193), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 98/199 (49%), Gaps = 48/199 (24%)

Query: 1496 EAEETGLKPSNINIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTXXXXXXXXXXXX 1555
            E EE G K + ++I+ +KKQWE ++ ++  K+I E+ E L+KRIRLPT            
Sbjct: 1514 ELEENG-KHTPVDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPT------------ 1560

Query: 1556 XXXXXXXXXXXXXXXKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLREL-- 1613
                                    E+   K +E+R    + ELE E+  KLQ++  EL  
Sbjct: 1561 ------------------------EEKINKIVETR----KSELEQEFEAKLQKRASELAN 1592

Query: 1614 ----PXXXXXXXXXXXXLRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKL 1669
                P                ++A L  E + E+  ++KK+F+EGKQQA MK+  LE+K+
Sbjct: 1593 EKPQPASFTEVMKRHKQEMEKLKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKI 1652

Query: 1670 AKMESQL-SETKQSVDSPP 1687
            AK+E+Q+ +   ++V S P
Sbjct: 1653 AKLEAQVKASGTEAVPSAP 1671

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/1387 (34%), Positives = 843/1387 (60%), Gaps = 31/1387 (2%)

Query: 22   NAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINSL 81
            +A+ASF +   E + ++   +   +  K+ +F +L++EN++ +VT+DEL+++S+ K+ + 
Sbjct: 19   DAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGAC 78

Query: 82   KTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNELESIKRKLSDLSEEKKEIQSSQ 141
            K ++  +L++ + +R E      +      E+    N+ ++++ +   L ++K+ +++++
Sbjct: 79   KDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARNEALEQQKQVLEANK 138

Query: 142  QRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISNDLNSKSQLERRT 201
                ++L+E++ ++  ++  +     E + LR   LELE + + Y S +L  K+   + +
Sbjct: 139  NDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKADFHQLS 198

Query: 202  QELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQLEKTNNDVLR 261
            Q+++LL +N +WLE +L+ KN ++ +YRQ+T + ++ +   L     D Q        LR
Sbjct: 199  QKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAATKTIKTLR 258

Query: 262  QKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVKEEL--NN 319
            ++N +   +L+ +   +K L+D   S K++F+ E++LKQRL++LLE Q++A+K EL   N
Sbjct: 259  EQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKSELEFKN 318

Query: 320  TRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITEE--AGKEDGI 377
            + +++     ++   Q+  E+E + K  QL + +L     +  +L    E+  +  E  I
Sbjct: 319  SPQASTDAATTESQSQI--EDELVHKTQQLEESEL-----KIQKLEQTVEQLLSADEKTI 371

Query: 378  LTSKS----NGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPIINSFKERTDTXXX 433
              S+S      D  +LKKQ+I E+R KE LQNQ+E+F+VELE+KVP+++SFK+R D    
Sbjct: 372  SGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRNDVLEK 431

Query: 434  XXXXXXXXXXHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDLCRQIQYLLVTNSV 493
                        S +K+    +LK    ++ + + +I  L++QR DL RQ+QYLL+  +V
Sbjct: 432  ELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLLIQVTV 491

Query: 494  SNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDIIQLQEKNSELLRVT 553
              DS GPL  EE  F++ ++ N ++   + D+Q I++ERLVEF++I++LQ KN++LL   
Sbjct: 492  RGDSHGPLSAEETAFVKKVV-NMENTQPDGDAQGIISERLVEFKNIVELQAKNADLLHTV 550

Query: 554  RNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKIHELEKEREKFKNW 613
            RNLA++LE+ E K K+  + IEN+TI EAKEAI+TLQ    +LE++I  + +ER+ +K  
Sbjct: 551  RNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRERDAYKAI 610

Query: 614  TMDQETSPNNSVIQQLTETKRELESQTQDLQAR-----ISQVTRESTENMSLLNKELQDL 668
                    +N  ++ +        S+  DL+ R     +S   RE+  N+ LL  E Q+L
Sbjct: 611  QSQTSHEGSNGGLRDVNAKA----SENSDLKIRELEELLSAAKREAEANVKLLMTENQEL 666

Query: 669  YDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNAISKQDSKT 728
              SKS L + + +EKSSR+LAEER K+  ++L L K EN++L KR + L+N ++KQD++T
Sbjct: 667  ARSKSELVVNVEKEKSSRLLAEERLKISKSSLLLTKQENEELNKRGLVLENNLAKQDTRT 726

Query: 729  QETLNDYVSCKSKLSAIETELSNLKLERTLKIXXXXXXXXXXXXXXXXXXXXHIMVTQLQ 788
            QET+++ + CKS+L+ +  EL N   +  L                       I+VTQLQ
Sbjct: 727  QETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNELTILVTQLQ 786

Query: 789  TLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSKIEWYQNKI 848
            TLQKER+ LL ++  + + KID+L+   ++L+T   +K   +      +DS+  WYQ KI
Sbjct: 787  TLQKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSRWYQEKI 846

Query: 849  ETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLDES----INDDS 904
            + L +  +S  S LN K   ++  Q +   L  ++ + + +  +Y+VL+++       D+
Sbjct: 847  DALNECLKSTTSDLNSKTQMIQELQSQQSLLTSKLRDAETKSQSYSVLNQTDDVLTQTDA 906

Query: 905  LRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTDEKTS 964
            LR ELEK++INL DA+SQ+ EYK LY +T ++L  M++ L+ S +  + +++ L  E+ +
Sbjct: 907  LRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETLKKERDA 966

Query: 965  LEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNKEIEAVKTEYESKLSK 1024
            L +  ++L++Q++NLN+ELD Q   +             +++N   + ++K +Y+ +LSK
Sbjct: 967  LSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQYQLELSK 1026

Query: 1025 IQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQFEKA 1084
            + +DL+QQ +YAN AQ NYEQELQ+HADVSKTIS+LRE+   +K +V +L  +  + +K+
Sbjct: 1027 LTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASITELKKS 1086

Query: 1085 LKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSGSVLN 1144
            L+ENE+ W +QK+    Q  LS+ RIEDLS+QN+LL+DQI L  T      D        
Sbjct: 1087 LEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISLKDTDSIPINDELKSEA-- 1144

Query: 1145 NDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVENEKRSFII 1204
             +++ TL+RE DIL TK+ +A+RD   L+QK+   + EL  A++++  S+V ++ RS +I
Sbjct: 1145 RELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRKSQVTSDTRSIMI 1204

Query: 1205 QQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELAALKF 1264
            +++ +++E+LNQ+NLLRESN TLRNEL   + +N++L+  +E L+  + P+E+++  L+ 
Sbjct: 1205 EENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTLQR 1264

Query: 1265 SIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKTQQGA 1324
            S+  K+++I L  EEV+RWK+RSQDI+ K++++   +++KL  E+   +A+     QQ +
Sbjct: 1265 SVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKLAEELSQARAEAAANAQQRS 1324

Query: 1325 DSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQELEDAKV 1384
            + E++F RL++QA+E+L  ++ +Q++   +L E ++++ ALE +L+    + + L+++  
Sbjct: 1325 ELEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQESIK 1384

Query: 1385 AENRNQL 1391
            A   N++
Sbjct: 1385 ATEENEI 1391

 Score = 67.0 bits (162), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 102/231 (44%), Gaps = 67/231 (29%)

Query: 1508 NIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXX 1567
            +I+ +KK+WE E+ +   K+I EA E L+KRIRLPT                        
Sbjct: 1522 DIENLKKEWEEEYEQRTIKRIEEANEILRKRIRLPT------------------------ 1557

Query: 1568 XXXKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLREL------PXXXXXXX 1621
                        E+   K +E+R    ++EL+ E+  KLQ++  EL      P       
Sbjct: 1558 ------------EEKINKIIENR----KRELDEEFEAKLQQRTSELAGEKPLPATFTEVM 1601

Query: 1622 XXXXXLRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKQ 1681
                     ++A ++ E + E+   KKK+F+EGKQQA MK+  LE+K+AK+E+Q     +
Sbjct: 1602 KRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFLEKKIAKLEAQAKAAAE 1661

Query: 1682 -----SVDSPPKHLSKMPNPLLGL----------------PRKIEENSNPP 1711
                 +V+SP +     P+P+  +                PR I  +  PP
Sbjct: 1662 KPDDTTVNSPDRKQLDKPSPIAEISHQEDKTHIAEELAEGPRPITTSPIPP 1712

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/1425 (34%), Positives = 823/1425 (57%), Gaps = 75/1425 (5%)

Query: 24   IASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINSLKT 83
            +A F     + ++ I+ D++  + +KL    + KSEN++IT TLD+LK+ S  K+ S K 
Sbjct: 10   VADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESFKI 69

Query: 84   EMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNELESIKRKLSDLSEE------KKEI 137
             +  + +  ++ + ER      FE    EK  L      + +++ +L +E      +KE+
Sbjct: 70   HISQLAKALEDGKDER----LHFE---EEKRRLIEGNSQVTKRIIELEQEIEVERQQKEL 122

Query: 138  Q-SSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISNDLNSKSQ 196
              +S+Q   + L+E+++EL   KA  N +    K+LR  ++  ET+ QT  + +L SKS+
Sbjct: 123  ADASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSKSE 182

Query: 197  LERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRN---DFQLE 253
            + R  QE+ LL+ N DWL  +L++K  Q   +R+ T   ISE+++   ++ N   + ++ 
Sbjct: 183  ILRMEQEITLLRENNDWLTNQLNTKTVQLNEFREST---ISELQDSQLKVSNMESELEIA 239

Query: 254  KTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAV 313
            +T+N  L+Q  + L + L++KL + K + D  N  K++ + E++LKQR+ID LE  + ++
Sbjct: 240  RTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESL 299

Query: 314  KEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITEE--- 370
            K+E++ T+       N D S     E ++L+++L   K++L   E+ C++L    +E   
Sbjct: 300  KKEMDATKN------NMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTS 353

Query: 371  -------------AGKEDGI-LTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEH 416
                         A  E  + +  K  GD  +LKKQL+ EKR K+ L+ Q+E+F+VELEH
Sbjct: 354  NIKLEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEH 413

Query: 417  KVPIINSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQ 476
            K+P++NSFKER++               T  +++ K  +L      +  Y+ +I  LSKQ
Sbjct: 414  KIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQ 473

Query: 477  RLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEF 536
            R+DL  QIQYLLV  S+ ++  GPL  EE++F++N L N    T  SD+Q I+T+RLVEF
Sbjct: 474  RVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKN-LTNSQEITKTSDTQGIITDRLVEF 532

Query: 537  RDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQL 596
            R +++LQ+KNSELL   RNLAD+LE  E ++K+ ++ +E+ET+ EAKE ILTL      L
Sbjct: 533  RSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNL 592

Query: 597  ESKIHELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTE 656
            E+++  L KER+ +K  +++  +  N    + +T    + + + +DL+ R++ V +E+  
Sbjct: 593  ENQLVILSKERDAYKALSVNASSGTNTP--KAITYPSPDNDDKVKDLETRLTAVIQEAEN 650

Query: 657  NMSLLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSIN 716
            N    + E  +L      +S+    EK+SR LAE+R  LL +TL+L+K + ++L+KRS +
Sbjct: 651  NAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSD 710

Query: 717  LQNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIXXXXXXXXXXXXXXXX 776
            LQ+ ++KQD +TQET++  +  KS LS+I++ELS LK E+                    
Sbjct: 711  LQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKE 770

Query: 777  XXXXHIMVTQLQTLQKERENLLDETKKSCQNKIDALQ-NAQNEL-KTEAIRKDQYIKQLE 834
                 +++ QLQTLQ+ERE LL ET+ S + K+  L+      L + E I K+     + 
Sbjct: 771  SVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKN--TTGIA 828

Query: 835  EDNDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYN 894
             + + +  W+Q KI+ L  +     ++L EK+ ++++ Q  I     +++E + R  +Y 
Sbjct: 829  SNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYT 888

Query: 895  VLDESIND-----DSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNK 949
            +L  +++D     ++LR+ELEK  + L+D+YSQI+ +K L E + +S+ E+S   +E+ K
Sbjct: 889  MLS-NVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQK 947

Query: 950  AFSNQIQNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNK 1009
                 I  L +E+  L+  V++L +Q+ +LNNE+  Q              IS LQ   +
Sbjct: 948  ESQKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKE 1007

Query: 1010 EIEAVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKG 1069
             ++  K +YE K++ IQKDL+ QT YAN +Q +YE ELQKHADVSKTI+ LR +  +YK 
Sbjct: 1008 SVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKS 1067

Query: 1070 QVETLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTT 1129
             +ETL        + LK +E  WN QK    ++L +   R+++LS+QNKLLYDQIEL   
Sbjct: 1068 DLETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELLNK 1127

Query: 1130 TGNKPTDAKSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTK 1189
            T ++     S      D+LI+LRRERD+L+TK+ VA  +  +L+Q++ +   E+++  T+
Sbjct: 1128 TEDRDNSHDSS-----DLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQ 1182

Query: 1190 LCNSKVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLR 1249
            L   K  + + + +++Q + +M++L+QL+LLRESN TLR+E  S   +   L+S+L+   
Sbjct: 1183 LSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECN 1242

Query: 1250 GNIAPIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEI 1309
              +AP++S +++L+  I+ KEQE+  +KEE  RWK RSQDI+ K++++   ++ KL+ EI
Sbjct: 1243 DRLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEI 1302

Query: 1310 ESLKAQLEDK--TQQGA-----DSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAK 1362
              +K +L+    T Q       D E KF R+R QA+++L ASK  + S   ++N++ +AK
Sbjct: 1303 NDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAK 1362

Query: 1363 LALEKSLNNANARIQELED-----AKVAENRNQL--SMIKKLQED 1400
              +E  L       +ELE+      + AE + Q   S + KLQED
Sbjct: 1363 SQVEADLGKCKTACKELEERLQVVTQEAETKEQTFNSQLSKLQED 1407

 Score = 75.5 bits (184), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 109/262 (41%), Gaps = 74/262 (28%)

Query: 1506 NINIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXX 1565
            +I+ID +K +WE E+ ++  +KI+ AEEALKKRIRLPT                      
Sbjct: 1546 DIDIDALKNEWEKEYEKQTLEKIKLAEEALKKRIRLPT---------------------- 1583

Query: 1566 XXXXXKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPXXXXXXXXXXX 1625
                              Q++++  ++ ++  LE  + +K+ EK ++L            
Sbjct: 1584 ------------------QQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIGNDAITLE 1625

Query: 1626 XLRADIEA---QLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKQS 1682
              RA++ A    +R++F  +L  IK+KSFEEGKQQ  +K   LE K+  +E Q S  K  
Sbjct: 1626 KHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQKSTIKPV 1685

Query: 1683 VDSPPKHLSKMPNPLLGLPRKIEENSNPPYNPXXXXXXXXXXXXXXXXXXXFNPFTSP-- 1740
             +      +    P+ G        S+  +                      +PF++   
Sbjct: 1686 ENDTSNMSAAFQAPVFG--------SHSTFT---------------------SPFSTSEI 1716

Query: 1741 SPNKPLQGDEAEREPSSNETEP 1762
            SPNK    D A  +P     EP
Sbjct: 1717 SPNKRPIDDTATEQPEKRHKEP 1738

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/1727 (32%), Positives = 946/1727 (54%), Gaps = 142/1727 (8%)

Query: 24   IASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINSLKT 83
            +ASF D S + V+++D  I+  LN++  +FN +++E I+I+  L+  K  +   I  LK 
Sbjct: 24   VASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQIKISTELEVTKKTNNTTIKKLKN 83

Query: 84   EMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNELESIKRKLSDLSEEKKEIQSSQQR 143
            E+ +++   + + KE+ D   K    + +K    +ELES   ++  L E   E+QS +Q 
Sbjct: 84   ELTELIDSYESVCKEKEDAYKKIAEEEEKKIDNRDELESKLIQIHSLEENVSELQSKKQE 143

Query: 144  TLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISNDLNSKSQLERRTQE 203
             +K LD+R+ EL   +      ++E  K R+ IL+LE + Q    NDL+ ++QLER +QE
Sbjct: 144  LIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKINDLSQRTQLERLSQE 203

Query: 204  LNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQLEKTNNDVLRQK 263
            L  +   K WLE+ L  K +Q+ SYR+K+     +++  LN ++N+    K+ N VL+++
Sbjct: 204  LETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNELDQMKSTNCVLQER 263

Query: 264  NNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVKEELNNTRES 323
             +ELS  L++    +K +  S N++K     E+TLKQ+LI +L+SQLN ++ E  N    
Sbjct: 264  TDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNELQRENGNELSL 323

Query: 324  NYSDVNSDDSK--QLISENEKLLKDLQLTKHKLVQCENECLRLS---SITEEAGKEDGIL 378
              SD  S   K      E   L   L   + + V+ E + LR S   +    +   D + 
Sbjct: 324  TVSDTASSSRKDSDFTREINDLKNQLNHVQERNVELEFK-LRKSEDYTAVSNSTSSDDLR 382

Query: 379  TS--KSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPIINSFKERTDTXXXXXX 436
             S  K+  D  +LKK+L  E+  +E+ +  +E F+ +LE ++P + +++ R         
Sbjct: 383  NSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTLEAYRHRAAAREEELK 442

Query: 437  XXXXXXXHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDLCRQIQYLLVTNSVSND 496
                     + EK+    EL     ++   + EI +++KQR DL  Q+Q+ LV NSV+ND
Sbjct: 443  EATLLLEKANKEKSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVAND 502

Query: 497  SKGPLRKEEIKFIQNILQNDDSAT-TESDSQKIVTERLVEFRDIIQLQEKNSELLRVTRN 555
            S GPL  EE+KFI+NI+Q DD     E+D+QK+++ERL +F+DII+LQ+KN ELL+ TR 
Sbjct: 503  SAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTKFKDIIELQQKNMELLKTTRE 562

Query: 556  LADKLESNENKSKNYLKN-IENETINEAKEAILTLQSQKVQLESKIHELEKEREKFKNWT 614
            LA KLE  E+K K   K+ IE ETI EAKEAILTLQ+    L +KI  L KE E +K  +
Sbjct: 563  LATKLEE-EDKIKQAEKSRIEEETIAEAKEAILTLQNYNSSLTAKIAALTKELETYKVLS 621

Query: 615  MDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMSLLNKELQDLYDSKSS 674
              +++S      +Q  + + E     ++L+ RI+ + +ES EN ++LN ++  L +  + 
Sbjct: 622  NTEDSSTPADFDKQREQREIEHTQLVKELETRIASIIQESKENANILNDKIFALDEKNNH 681

Query: 675  LSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNAISKQDSKTQETLND 734
            +SIEL REKS++ LAEER KLL  ++D+   EN++L+KR  +L+N + +QD +T ET+N 
Sbjct: 682  ISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKRLNSLRNVVVEQDKRTHETINS 741

Query: 735  YVSCKSKLSAIETELSNLKLERTLKIXXXXXXXXXXXXXXXXXXXXHIMVTQLQTLQKER 794
             +  +S+L+ +E + +  + E  L                       ++VT+LQTLQ ER
Sbjct: 742  LIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQSER 801

Query: 795  ENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQ-YIKQLEEDNDSKIEWYQNKIETLRK 853
            E+LL  T+     +++ L+   N+L+ +    ++ Y   +EE  + K ++ Q K ++L++
Sbjct: 802  EHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENYGSLMEETTELKDDFRQKK-KSLKE 860

Query: 854  DHESVMSSLNEKQIEVER-FQYEIKSLEKEIEENKIRLHTYNVLDESINDD--------S 904
            +  +V    +E  +E ER  ++E   L K+++E    +  Y    ++ +DD        S
Sbjct: 861  EMSNVEKRYSEI-VEKERETKWENTRLTKQLKEKTELIEKY----KAASDDEGKLEEISS 915

Query: 905  LRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTDEKTS 964
            L++EL+  K  LT++YSQ + Y+K  E  ++S+ +++ Q+     AF  +I  +   K +
Sbjct: 916  LQKELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKEAAFKERITEVELAKNN 975

Query: 965  LEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNKEIEAVKTEYESKLSK 1024
            + D  ++L+ Q+ +LNNEL++Q +             + L+   K +E  K +YE KL  
Sbjct: 976  IADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTKGLEQSKRDYEDKLKS 1035

Query: 1025 IQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQFEKA 1084
            + KDL++Q  YAN AQNNYEQELQ HA+VSKTIS+LREQ   Y+ ++  L ++    ++ 
Sbjct: 1036 LMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAELTISATDAKRL 1095

Query: 1085 LKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSGSV-- 1142
            L EN+ +W  Q++   +Q++    RIE+ S QNK+L++Q +L TT  N   +A+S  V  
Sbjct: 1096 LNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKL-TTQANDEDNAESSGVNS 1154

Query: 1143 --LNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVENEKR 1200
               +N ++++LR ERD+L  ++ V E + K+LR++++ I+ + +    +L   K E    
Sbjct: 1155 IEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRATDLELQKIKEETHNY 1214

Query: 1201 SFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELA 1260
              +++QH  VM +L QL+LLRESN TLRNE     SKN+ LQ+E+E L   + P+E+EL 
Sbjct: 1215 PDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKLLPLETELQ 1274

Query: 1261 ALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKT 1320
             L   I+EK++++ +  EE  RWK+RSQDI+ K+Q++   ++E L  E   L+AQLE+K+
Sbjct: 1275 TLTNLIEEKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQLEEKS 1334

Query: 1321 QQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNEL--------------KDAKLALE 1366
            ++  +   +F +L++QA EKL ASK+SQ+S   Q+N+L              K+ KL+LE
Sbjct: 1335 KENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLETEKEGKLSLE 1394

Query: 1367 K----SLNNAN--ARIQ-ELEDA-------------------KVAENRNQLSMIKKLQED 1400
            K    ++ N++    IQ +LE+A                   ++ EN N  S IKKLQE+
Sbjct: 1395 KRLEVTMKNSHDIVSIQSQLEEALMKSKDFETKFINSVESSKQIEENLN--SEIKKLQEE 1452

Query: 1401 TEENSKELETKLEENAISYDSTVXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTEQDDLSK 1460
                S +L+ +L    ++  +T                             G   D    
Sbjct: 1453 ----SSKLQEELAHEKLTTSTT-----------------EIGNVDQDTVDGGVSND---- 1487

Query: 1461 VVESMKRSXXXXXXXXXXXXTREVNQKIR-EFQEAQEAEETG-LKPSNINIDEIKKQWEA 1518
            +VESMK+S            T E  +K++ E  + +   ET  ++P +I+ + I+KQ E 
Sbjct: 1488 IVESMKQSFEEEKIKFIEEQTTEFKKKLQAEINKLKAEYETKQIEPVSIDENAIRKQIEE 1547

Query: 1519 EHNEEVSKKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXXXXKSISQSGK 1578
            E+ +  S++I+EAEE LK+RIRLPT                                   
Sbjct: 1548 EYEQATSQRIKEAEENLKRRIRLPT----------------------------------- 1572

Query: 1579 MEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPXXXXXXXXXXXXLRADIEAQLREE 1638
                 ++++   I +++ +LENE+  K++ + +EL             ++ +I+ +L  +
Sbjct: 1573 -----EEKINKVIDKRRTQLENEFQNKVEARAKEL-LTGDEKNEFFDRMKKEIQEELARK 1626

Query: 1639 FNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKQSVDS 1685
            +  ELQ +KKK+F+EG+QQ +MKT+ LE+K+ K+ES L   K +  +
Sbjct: 1627 YEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKLESDLQNAKSNTGA 1673

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/1387 (33%), Positives = 783/1387 (56%), Gaps = 50/1387 (3%)

Query: 24   IASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINSLKT 83
            +A+       QV+ +   +V  L  +   F +L++EN ++ V++   ++     + +L+ 
Sbjct: 21   LAARLGLEQGQVQQLGEQLVRTLWGREQAFRQLEAENTRLKVSIGAAESACEHGVEALRE 80

Query: 84   EMEDVLRQNDEIRKERNDTSSKFESVQRE-KTHLSNELESIKRKLSDLSEEKKEIQSSQQ 142
              + +  +    ++ + +  S   +        +  +LE  +R+++     ++++    +
Sbjct: 81   RQQQLAAEAGAQQRGQGEAGSAGRAGGPSVPERVQQQLEETERRVAAGDSARRDLARLLE 140

Query: 143  RTLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISNDLNSKSQLERRTQ 202
              +  LD   +ELE V   +       K+LR   +ELE   Q+  S  L  +++++R  Q
Sbjct: 141  EKISDLDASQQELERVLGVN-------KELRRHEMELEFTVQSQRSQSLREQAEIQRLQQ 193

Query: 203  ELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQLEKTNNDVLRQ 262
            EL L++SN +W   +L+ KNQQ  SYR+KTN  I   + +LN ++N+ ++E  N   LR 
Sbjct: 194  ELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHANVAALRS 253

Query: 263  KNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVKEELNNTRE 322
            KN ELSK LQ+ L + K L+DS +SEK++F+ E+ LKQRLI+LL  Q+  +K++L    +
Sbjct: 254  KNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDLEKAYD 313

Query: 323  SNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITEE--------AGKE 374
               +   SD      SE E+LL DL  TK KL   +    RL    +E        +G  
Sbjct: 314  VAKNGGMSD------SERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGR 367

Query: 375  DGI----LTSKSNG--------DFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPIIN 422
            +GI    + S S G        D   L+KQL++E+R KE LQ Q+ESF+VELEHK+P++N
Sbjct: 368  NGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPVLN 427

Query: 423  SFKERTDTXXXXXXXXXXXXXHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDLCR 482
            SFK+R +               T+ E++ K+ ++K    K+ +Y+ ++  L +QR DL R
Sbjct: 428  SFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLAR 487

Query: 483  QIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDIIQL 542
            Q+Q LL+  SV +DS GPL  EE++F++ +    DSAT  SD+Q I++ RLVEF+ +++L
Sbjct: 488  QVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATG-SDTQAIISNRLVEFKSVVEL 546

Query: 543  QEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKIHE 602
            Q+KN+ELL   R LA KLE  E+K+++ +K++E  T+NEAKEAIL+LQ     LE ++  
Sbjct: 547  QQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLET 606

Query: 603  LEKEREKFKNWTMDQETSPNNSV---IQQLTETKRELESQTQDLQARISQVTRESTENMS 659
            +  ER+ FK    +     NNS+   +       +E+      L+AR+  +  ES ++  
Sbjct: 607  VTTERDSFKLLVSE---GKNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQHAK 663

Query: 660  LLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQN 719
            +LN+E++ LY S S L+IEL RE+SSR LA+E+  L+  +L+L K EN  L+ R+ +LQ 
Sbjct: 664  MLNEEIKALYKSNSQLAIELERERSSRELADEKLSLIQKSLELVKGENADLQNRAGSLQA 723

Query: 720  AISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIXXXXXXXXXXXXXXXXXXX 779
             + +QD++ Q T+ ++VS KS+L +I ++L+ L+ ER                       
Sbjct: 724  LLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKDNND 783

Query: 780  XHIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDS 839
              +++ QL+T QKER++L++ET+K  + +I+ L    +  K +  RK +   +L   + +
Sbjct: 784  SQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSST 843

Query: 840  KIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVL--- 896
            + +W+Q+K+++L+++  S   +L  K  E++  +  + S   ++E   +     +++   
Sbjct: 844  QCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLVLES 903

Query: 897  DESINDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQ 956
            D +    SL ++L+++   L+ AYS+I+ YK     T++    +S    + NK  S Q  
Sbjct: 904  DHASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERP--SLSYNAVQDNKDGSKQAA 961

Query: 957  -NLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNKEIEAVK 1015
             +L  E T L   +++  +++  L +EL+ +              I+ L  + + IE  K
Sbjct: 962  ISLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEAK 1021

Query: 1016 TEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLN 1075
             +Y+ K++++Q DL++Q    N A+  Y+  LQK A++S+ I  LR+   +YK ++    
Sbjct: 1022 ADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFK 1081

Query: 1076 LARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPT 1135
             A  +  K L+ NE  W+ QK  +   LDL++ RIE+LS+QN+LLYDQIEL + + +   
Sbjct: 1082 SAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIELLSRSPSSSL 1141

Query: 1136 --DAKSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNS 1193
              D K  S    ++++TLRRERDIL+TK+ V++R+ KMLRQ++ L   EL   R +L  S
Sbjct: 1142 EPDTKISSD-ARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSES 1200

Query: 1194 KVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIA 1253
            K    + +   Q  +E+ EKLNQLNLLRE N +LRNE +  +  N+ LQ+E+  L+  + 
Sbjct: 1201 KGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQ 1260

Query: 1254 PIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLK 1313
            P+E ++ +L  ++ EKEQ++ L KEE  RWK+RSQDI+ K++++   +Y KL +EIE LK
Sbjct: 1261 PMEEQIKSLTATLTEKEQKLALLKEESDRWKQRSQDILHKYERIDPEEYRKLASEIEVLK 1320

Query: 1314 AQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNAN 1373
            A+LE K+ +  DS+E+F +LR+QA E+L   K ++     +L      K  LE  L+ A 
Sbjct: 1321 AELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSEAR 1380

Query: 1374 ARIQELE 1380
             +I  LE
Sbjct: 1381 EKITSLE 1387

 Score = 72.0 bits (175), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 102/230 (44%), Gaps = 88/230 (38%)

Query: 1508 NIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXX 1567
            N++ +KK+WE E+ ++  ++IREAEEALKKRIRLP+                        
Sbjct: 1531 NLEALKKKWEEEYEQQTLQRIREAEEALKKRIRLPS------------------------ 1566

Query: 1568 XXXKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEK----LRELPXXXXXXXXX 1623
                            ++++   I+ KQK LE E+  K+       L+E P         
Sbjct: 1567 ----------------EERINQVIERKQKALEQEFTTKVNATALALLKENPDSIASD--- 1607

Query: 1624 XXXLRADI-----------EAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKM 1672
                +AD+           +  L ++F  +L  +KKK+FEEG+QQ +MK  LLE K++K+
Sbjct: 1608 ----KADLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKISKL 1663

Query: 1673 ESQLSETKQSVDSPPKHLSKMPNPLLG--LPRKIE-ENSNP-----PYNP 1714
            ESQ               +K P   LG  +P KI  EN+ P     P  P
Sbjct: 1664 ESQ---------------AKAP---LGTNVPTKIPLENTQPLAQQVPVKP 1695

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  537 bits (1384), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 526/1721 (30%), Positives = 865/1721 (50%), Gaps = 178/1721 (10%)

Query: 24   IASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINSLKT 83
            I+S  D  LE++ + D D++  + DKL +    K ++  ++  ++EL+T +  K+ SL  
Sbjct: 36   ISSILDVPLEKLHTTDYDLILAVKDKLDELRNSKDQSNVVSNDINELQTLADNKLTSLGG 95

Query: 84   EMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNEL----ESIKRKLSDLSEEKKEIQS 139
            ++  V  +  E+  + N   ++F           NEL    E +  K+S+L+        
Sbjct: 96   KLATVETEKKELIDKVNGYETQF-----------NELKIKNEGLNLKVSNLN-------- 136

Query: 140  SQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISNDLN---SKSQ 196
                          ELE  K  SN+               ET++  Y+         +S+
Sbjct: 137  -------------IELENWKNNSNN--------------FETEKLNYVXXXXXLSIRESE 169

Query: 197  LERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQLEKTN 256
            ++R  QE+  L  NK       SS ++Q+L  +++ N     +  +LN   +  +LE+  
Sbjct: 170  IQRLKQEVTFLNENK-------SSLSEQWLKEKEEFNKAKLLLEKNLNN--STIKLEEAT 220

Query: 257  N---------DVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLE 307
                       VL  KNN+L+K  +  + +IK L D+    K D + EI +K +LIDLL+
Sbjct: 221  TTLKSMEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQ 280

Query: 308  SQLNAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSI 367
             QL++ +EEL    E N       D   L S+NE L  D+Q    K+ + +NE   L+S+
Sbjct: 281  GQLSSTQEELRQNVELNSKFTKFPD---LESQNETLKSDIQDLTLKIEELQNENFNLNSM 337

Query: 368  TEEAGKED-------------GILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVEL 414
              +   E                L SK N    LLKKQ+ +EK  K+HLQ QIESFI+EL
Sbjct: 338  INQMSNEQNNSNNSSSIDSNLPTLYSKIN----LLKKQVTQEKLEKKHLQTQIESFIIEL 393

Query: 415  EHKVPIINSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIKELKVKNEKLAEYKDEIHILS 474
            E+K+PII+SF+E+                 TSNEKN    +L   + KL  Y+  I  L 
Sbjct: 394  ENKIPIISSFQEKNQALENELTNLTLLLNKTSNEKNTIQNKLNNYDSKLLTYQSNIKELI 453

Query: 475  KQRLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQN-DDSATTESDSQKIVTERL 533
            +QRLDL  Q+++LL+  +V NDS GPL +EEI+FI  I  N +D   +E  SQ +++ERL
Sbjct: 454  RQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISERL 513

Query: 534  VEFRDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQK 593
            V F +I +LQ KN ELL   R+L++ LE+ EN   N  K  +N+TI +AKEAILTLQ   
Sbjct: 514  VTFSNIEELQAKNMELLNSIRSLSENLENIENA--NSHKEFQNKTIADAKEAILTLQYHN 571

Query: 594  VQLESKIHELEKEREKFK---NWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQV 650
              LESK+  LE ER+ FK   N  +  ++S  N  +   T  +   E   + LQ  I ++
Sbjct: 572  DILESKVKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETN-EKSIEKLQTLIEEL 630

Query: 651  TRESTENMSLLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQL 710
              E  +N   L  ++      KS+L+I L +EKSS  L  E+  L  +  D+ K EN +L
Sbjct: 631  KAELKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKEL 690

Query: 711  RKRSINLQNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIXXXXXXXXXX 770
             KR  NLQN I KQ+SK  + +N Y++ ++++S ++T+LS  K E+   +          
Sbjct: 691  NKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSEL 750

Query: 771  XXXXXXXXXXHIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYI 830
                       IM++QLQ+LQ ER  LLD+T+K   +KI  L+N   +L      K   I
Sbjct: 751  IKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEI 810

Query: 831  KQLEEDNDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRL 890
            ++L   N+S+  WYQN I+ L+K + ++ + L  K   +     +I+ LE +       +
Sbjct: 811  QKLSISNESQCTWYQNTIDDLKKINSAIKTELTSKNSLISDLNTKIELLESQ----SYTI 866

Query: 891  HTYNVLDESINDDS-LRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNK 949
             T      S ND S + ++L+ +K++L++AY+Q++EYK+LY +T++SL+ + S  +    
Sbjct: 867  DTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESNFESVKN 926

Query: 950  AFSNQIQNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNK 1009
               ++I  L  E  +L+       +++S L+ +L  +              I+ L    K
Sbjct: 927  LMDDKISKLLSENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQITRLNKFKK 986

Query: 1010 EIEAVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKG 1069
            +     +EYE K+SK+Q  L+ +  +A+ AQ  YE  L K     ++I E +EQ+     
Sbjct: 987  DSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFKEQIEKLNQ 1046

Query: 1070 QVETLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIEL--- 1126
            ++  +     +    L ENE+ W  ++++ +  L+ S  +I++L++QNKL  DQ+EL   
Sbjct: 1047 RIVIIESDLEKKTSLLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVDQLELLNK 1106

Query: 1127 -YTTTGNKPTDAKSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQE 1185
             +++  +    +++  + N      LR +RD+L+TK+++AERD+K    K+  +  EL  
Sbjct: 1107 DFSSMDSSQLSSETKHMFNR-----LRADRDVLETKLSIAERDSKNNASKLESLRDELAN 1161

Query: 1186 ARTKLCNSKVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSEL 1245
             + KL +S+ +  + S +I+ H++++ +LNQ+ L +ESN TLRN++   N KNK LQ++L
Sbjct: 1162 VQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKL 1221

Query: 1246 ERLRGNIAPIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKL 1305
                  ++ +  EL ++K S+ +KE +I L KEE ++W+ R++++  +  ++      KL
Sbjct: 1222 NEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKL 1281

Query: 1306 ETEIESLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLAL 1365
             TE+++LK   E K +Q A+ EE+FN L++QA E+L ASK  Q S  +Q+NELK +   +
Sbjct: 1282 STELDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNI 1341

Query: 1366 EKSLNNANARIQELEDAKVAENRNQLSMIKKLQEDTEENSKELETKLEENAISYDSTVXX 1425
            E +L++   +  +L++     + N++   +KL  + E   K L+T  E N+    S    
Sbjct: 1342 ELALSSEQKKSMDLQNTL---SDNEVKYTQKLS-NIESELKALKT--ENNSFKLSSEKEK 1395

Query: 1426 XXXXXXXXXXXXXXXXXXXXXXXXXXGTEQDDLSKVVESMKRSXXXXXXXXXXXXTREV- 1484
                                       +    ++ ++ESMK+             T E+ 
Sbjct: 1396 MELTDEVDSLKKSLVEAQSKLSAIGSDSTDSTMNAMIESMKKEFEEEKLKLLEDKTNELE 1455

Query: 1485 -------NQKIREFQEAQEAEETGLKPSNINIDEIKKQWEAEHNEEVSKKIREAEEA--- 1534
                   ++ ++E++E  E  ++     +I I+E +   +    E     +   EEA   
Sbjct: 1456 AQWKLEKDKLLKEYEEKIEDLQSARTDQSIKIEEFQSLKKEWEEEYEKATLERIEEAKET 1515

Query: 1535 LKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXXXXKSISQSGKMEDIFQKQLESRIQEK 1594
            LKKRIRLP+                                  K+  + +K        +
Sbjct: 1516 LKKRIRLPSET--------------------------------KINRVIEK--------R 1535

Query: 1595 QKELENEYNKKLQEKLREL-PXXXXXXXXXXXXLRADIEAQLREE----FNHELQTIKKK 1649
            + ELENEY  KLQEKL E+              LR +I+ +++ +    F ++L   KKK
Sbjct: 1536 KHELENEYEVKLQEKLNEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKK 1595

Query: 1650 SFEEGKQQAMMKTTLLERKLAKMESQLSET----KQSVDSP 1686
            SFEEGKQQ+ MKTTLLERK++K+ESQLSE     KQS  +P
Sbjct: 1596 SFEEGKQQSSMKTTLLERKISKLESQLSEAIENDKQSDKNP 1636

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  413 bits (1061), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 451/1552 (29%), Positives = 782/1552 (50%), Gaps = 123/1552 (7%)

Query: 24   IASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINSLKT 83
            I+ +     + ++ ++  I+  L  ++ +F   + E  ++ V +DE+K+    +I+ L  
Sbjct: 5    ISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRISKLN- 63

Query: 84   EMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNELESIKRKLSDLSEEKKEIQSSQQR 143
               ++L ++ E   E+N   SK E + R    L NE     RK+  L+   K++ +S+  
Sbjct: 64   ---ELLGESSE---EKN--VSKKE-LSRLHNLLKNERSKCARKIDALN---KQLNASKNT 111

Query: 144  TLKILDERL--KELEMVKAASNHSD-------SECKKLRSTILELETKQQTYISNDLNSK 194
              K+ DER   +E E++KA   ++D        E K LR  +LE+E   QT  SN L+ K
Sbjct: 112  ITKLNDERGVKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSLK 171

Query: 195  SQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQLEK 254
             + +   QE  L+  NK W+E++LS ++++ L       + +  +   LNR +ND++   
Sbjct: 172  LKYDTVVQEKELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVS 231

Query: 255  TNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVK 314
            TNN  L  +N +LS  +++K+L+IK L D+ N EK DFS E+TL++ + DLL SQL +  
Sbjct: 232  TNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSF- 290

Query: 315  EELNNTRESNYS-----DVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITE 369
                   E NYS       N D  K   S++  ++  L  TK +L + ++EC RL +I  
Sbjct: 291  -------EKNYSLSAREKDNDDPCKN--SQHANVVDKLIDTKLQLEKSKDECQRLQNIVA 341

Query: 370  EAGKEDGIL----------TSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVP 419
            +  +ED              +K   D   LK+QLIKE+  K  LQNQ+ESFI ELE K P
Sbjct: 342  DCIEEDEAAFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTP 401

Query: 420  IINSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLD 479
             + SFKERT++               S  K    KEL    +K+   +  IH L KQRLD
Sbjct: 402  ELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLD 461

Query: 480  LCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDI 539
            L RQ++ LL+  S       PL  +E+  ++ +L++ D    E DSQ I+TERLVEF + 
Sbjct: 462  LARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGD-VPNEKDSQIIITERLVEFNNT 520

Query: 540  IQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESK 599
             +LQEKN ELL   R LADKLE++E K    L  +EN+TI EAK+AI+ L+     LES+
Sbjct: 521  NELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESR 580

Query: 600  IHELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELES--QTQDLQARISQVTRESTEN 657
            I  L +ER+ +K        S N + I      K E  +  + ++L++ +S    E++  
Sbjct: 581  IDILSRERDSYKLLA-----SANGNKIYADAANKTEAANLKKIKELESELSLTKVENSAV 635

Query: 658  MSLLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINL 717
            +  LNKEL     S+S+  I L    + ++LA E+  LL   +D  K    +L K+  + 
Sbjct: 636  VQRLNKELLTCKKSQSNGQIALQEFSNFKVLAIEKENLLQTRIDDLKT---KLEKQRSSA 692

Query: 718  QNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIXXXXXXXXXXXXXXXXX 777
             ++I       +  L+ Y   K+K  ++  E+SNL  + T                    
Sbjct: 693  PSSIHGSIGSEETELSQY---KNKTKSLMCEISNLSKKNTDLRCMKESLTRDLERCCKEK 749

Query: 778  XXXHIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDN 837
                + +T+ +T   E++   D  +     KI  L+    EL      K Q I+ L+   
Sbjct: 750  MQLQMKLTESETSHNEQKLKSDSKQVQYNTKIKNLEKNCEELNNRLHSKVQEIETLQTSK 809

Query: 838  DSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLD 897
            +S+++W QN I+   K+ +S+ + L+EK+  + +   E+K LE E+++ K++   Y +L+
Sbjct: 810  NSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDLEIELQKTKLQ---YKLLN 866

Query: 898  ESIN----DDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSN 953
             S +    + +L++ELE+S+I+L DA+SQI+ Y+++  T + +L+E++ QL ++ +    
Sbjct: 867  NSSDANTLETALKKELERSQIDLKDAHSQIEAYEEIISTDENTLKELNDQLTKTKEELKV 926

Query: 954  QIQNLTDEKTSLEDKVSLLREQMSNLNN-ELDLQNQAMXXXXXXXXXXISILQNNNKEIE 1012
            + Q+L +E  + E+++S LR ++  +   +  L+  A+             L N  + I+
Sbjct: 927  KSQSLDEENNAKEEEISFLRRELDEIRGLQPKLKEGALRLVQQSEK-----LGNQTQRIQ 981

Query: 1013 AVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVE 1072
            A+         KI K      ++     + Y+ +L+ + D+S  +  L  ++  Y+ +++
Sbjct: 982  AMN-------EKIDKMTTIVELHQEVETSQYQAKLKANKDLSALVLRLENEVLDYQTELK 1034

Query: 1073 TLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGN 1132
                +    ++ L ++E  W  +K     +L  +  + E L  +N  L ++I+    TG 
Sbjct: 1035 KTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENSALVEKID--DGTGE 1092

Query: 1133 KPTDAKSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCN 1192
               D +   +++  +  +LR ER+ L+TK+   +RD  + +QK + ++  + + +     
Sbjct: 1093 NNGDKEYLKLVS--LFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKSVNDMQQTHLV 1150

Query: 1193 SKVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNI 1252
            S+ + +  + II + +++M+++ Q+N+L+E+NT L+  L     KN+ +  E   L+  I
Sbjct: 1151 SRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIYKEHTSLQYEI 1210

Query: 1253 APIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESL 1312
            + ++ +LA  K  +     ++ + + E+ +WK+R  ++ ++ ++    + EKL  EI  L
Sbjct: 1211 SQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDETEKLFNEISDL 1270

Query: 1313 KAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNA 1372
            KA+L +     AD  +KFNRL++QA EKL ASK  Q +   +++ELKD K  LE+SL++ 
Sbjct: 1271 KAKLLNAQNANADLNDKFNRLKKQAHEKLDASKKQQTALTNEVDELKDMKNELEESLHSE 1330

Query: 1373 NARIQELEDAKVAENRNQLSMIKKLQEDTEENSKELETKLEENAISYDSTVXXXXXXXXX 1432
             +++ ELE AK+ ++  Q   + K QE  E+ SK L  ++E                   
Sbjct: 1331 ESKVLELE-AKLKKHLVQAEGVSKDQE--EDTSKPLMEEIE------------------- 1368

Query: 1433 XXXXXXXXXXXXXXXXXXXGTEQDDLSKVVESMKRSXXXXXXXXXXXXTREVNQKIREFQ 1492
                                 E  D S  +E MK              T E  +K+ E  
Sbjct: 1369 -----------LLKRELQVFKETSDSSDTIEKMKEIMEAEKNKIIEEKTTEFERKLEEAT 1417

Query: 1493 EAQEAEETGLKPSNI-NIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPT 1543
                 + TG    N  N++E+KKQW  ++ EE  ++I+EAEE LKKRIRLP+
Sbjct: 1418 ----GKNTGATIENGENMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPS 1465

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score =  398 bits (1023), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 427/1548 (27%), Positives = 779/1548 (50%), Gaps = 114/1548 (7%)

Query: 24   IASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINSL-- 81
            I+ F     E ++ I    +  L  K+ +F   + E  ++ V +DE+K+    +I+ L  
Sbjct: 5    ISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISKLTK 64

Query: 82   ---KTEMEDVL------RQNDEIRKERNDTSSKFESVQREKTHLSNELESIKRKLSDLSE 132
               ++  E V+      R  D++++ER+  + K +++ ++   L+   E+IK KL D  E
Sbjct: 65   LLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNKQ---LNASHETIK-KLED-EE 119

Query: 133  EKKEIQSSQQRTLKILDERLKELEMVKAASNHS-DSECKKLRSTILELETKQQTYISNDL 191
              KE  SS Q  L+  D           ++ H  D E K L+  +LE+E   Q   SN +
Sbjct: 120  GAKEEASSWQDGLRNDD-----------STKHVLDKENKLLQRKLLEMENILQVCKSNAV 168

Query: 192  NSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQ 251
            + + + +  +QE  L   NK W E+ LSS NQ+ L       + +  +   LN+ + + +
Sbjct: 169  SLQFKYDTASQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENE 228

Query: 252  LEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLN 311
               T N  L  +N +LS  ++EKLL+IK L D++N+EK +FS E+TL++++ DLL SQL 
Sbjct: 229  SVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLT 288

Query: 312  AVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITEEA 371
            +  E  ++ R     D     + + I   E+L+      K KL + + EC  L +I  + 
Sbjct: 289  SF-ERGHSLRPKEKGDDKLCKNPEHIDVAEELID----AKLKLEKSKEECQLLKNIVSDC 343

Query: 372  GKEDGILT---------SKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPIIN 422
             +E+G             K   +   LK+QL+KE+  K  +QNQ++ F++ELEHK P + 
Sbjct: 344  IEENGTTVNTNTAAPTVGKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALV 403

Query: 423  SFKERTDTXXXXXXXXXXXXXHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDLCR 482
            SFKERT+                S  K    K+L    +K+  Y+  IH L +QRLDL R
Sbjct: 404  SFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLAR 463

Query: 483  QIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDIIQL 542
            Q++ LL   S    +  PL  +E+  ++ +L+++++   E DSQ I+TE+LVEF++I +L
Sbjct: 464  QVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVN-ERDSQIIITEKLVEFKNIDEL 522

Query: 543  QEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKIHE 602
            QEKN ELL   R LADKLE+NE ++   +  IEN+TI EAKEAI+ ++S   +L  +++ 
Sbjct: 523  QEKNMELLDCIRILADKLETNEGEADKTVAKIENQTIKEAKEAIIEMESINSKLALRVNI 582

Query: 603  LEKEREKFKNWTM--DQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMSL 660
            L +ER+ +K      D +T  +   I + T      E + ++LQ+++S    ES+  +  
Sbjct: 583  LTRERDSYKLLASANDNKTHADTEGITEAT-----YEKKIRELQSKLSSTRVESSAIIQN 637

Query: 661  LNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNA 720
            LN +L     S++   I L   ++ ++L  E+  +L   ++  K + ++ R     L  A
Sbjct: 638  LNGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAMLQERINHLKTQLEKQR-----LSAA 692

Query: 721  ISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIXXXXXXXXXXXXXXXXXXXX 780
               QD K    L D    ++K+ +++ E+SNLK E T  I                    
Sbjct: 693  PPVQDYKYS-NLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLERCCKEKMQL 751

Query: 781  HIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSK 840
            H+ +++ +T   E+  +    +     +I  L+    EL      K+Q IK L+   +S+
Sbjct: 752  HVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIKTLQSSKNSQ 811

Query: 841  IEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRL-HTYNVLDES 899
            ++W QN I+   K+ +SV + L+ K+  + R   EI++L  E+   K++     N  D +
Sbjct: 812  LKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQYKFLSNTSDTN 871

Query: 900  INDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLT 959
              + +LR+EL++++I L DA+SQI+ Y+++  T +  L+E++ +L ++ +    +IQ   
Sbjct: 872  TLEPTLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKKAKEDCETKIQLEN 931

Query: 960  DEKTSLEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNKEIEAVKT-EY 1018
             EK + E+++S LR+++  +        + +          + +LQ+     +A +  E 
Sbjct: 932  KEKGAKEEELSHLRKELDEI--------RCLQPKLREGASYL-VLQSEKVGDQAQRIQEM 982

Query: 1019 ESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLAR 1078
            ++K+ K+   ++    Y     + Y+ EL+ + D+S+ +  L ++   Y+ +++    + 
Sbjct: 983  KNKIDKMAAIIEA---YQKEESSQYQSELKTNKDLSEWVMRLEKEAFDYQTELKKTKKSL 1039

Query: 1079 GQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAK 1138
               ++ L  +E  W  +K     +L  +  + E L  +N +L ++I+  T   N  ++ K
Sbjct: 1040 YSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIDGATEGSN--SNEK 1097

Query: 1139 SGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLID---VELQEARTKLCNSKV 1195
               +++  +   LR ER  L+TK+   +RD  +LRQK + ++    +LQ A T +  +KV
Sbjct: 1098 YLELVS--LFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSIGDLQRANT-VPRNKV 1154

Query: 1196 ENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPI 1255
            +    + II +++++++++ Q+N+LRE+N  L   L +   KN+ +  EL  ++  I+ +
Sbjct: 1155 QCP--AVIIDEYEKIIKEIAQVNILRENNAILHKSLKNVTEKNEAIYKELINMQEEISRL 1212

Query: 1256 ESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQ 1315
            +  L   K  +     ++   + E+ + K+R QD+ ++ +     + EKL   I  L+ +
Sbjct: 1213 QGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVK 1272

Query: 1316 LEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANAR 1375
            L +     AD E KFNRL++QA EKL ASK  Q +   +LNELK+ K  LE++L+N  ++
Sbjct: 1273 LLNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKDKLEENLHNEESK 1332

Query: 1376 IQELEDAKVAENRNQLSMIKKLQEDTEENSKELETKLEENAISYDSTVXXXXXXXXXXXX 1435
            + +LE  K+ E+  Q+  + K                + ++I++   V            
Sbjct: 1333 VVDLE-LKLKEHGLQVGEVSK----------------DHDSIAFKPFVEEIESLKKELQV 1375

Query: 1436 XXXXXXXXXXXXXXXXGTEQDDLSKVVESMKRSXXXXXXXXXXXXTREVNQKIREFQEAQ 1495
                                +D S   E +K +            T++  +K+++     
Sbjct: 1376 FRNA----------------NDASDAFEKIKNNMEEEKNKIIDEKTKDFEKKLQDAVNKS 1419

Query: 1496 EAEETGLKPSNINIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPT 1543
            ++ E+ ++ S  +I+ +KK+W  E+ EE  K+I+EAEE LKKRIRLP+
Sbjct: 1420 KSNESEVENSE-HIEALKKEWLKEYEEETVKRIKEAEENLKKRIRLPS 1466

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  373 bits (958), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 391/1390 (28%), Positives = 716/1390 (51%), Gaps = 90/1390 (6%)

Query: 24   IASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINSLKT 83
            I+ F     E ++ I+  ++  L  K+  F   + E  ++ V +DE+K+    +I+ L  
Sbjct: 5    ISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRISKLS- 63

Query: 84   EMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNEL----ESIKRKLSDLSEEKKEIQS 139
                         K  N++S +     +E +HL ++L    E  +RK+  L+   K++ S
Sbjct: 64   -------------KLLNESSEQKNIASKELSHLQDQLMQDRERCRRKIDALN---KQLDS 107

Query: 140  SQQRTLKILDER-LKELEMVK--------AASNHSDSECKKLRSTILELETKQQTYISND 190
            S+    ++ DE+  KE  M++        +  N  D E K LR  ++E+E   Q   SN 
Sbjct: 108  SRDAIKRLNDEKDAKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNS 167

Query: 191  LNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDF 250
            ++ + + +   QE  L+  NK W E++LSS N + L+      + I  +   L + + D 
Sbjct: 168  VSLQLKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADR 227

Query: 251  QLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQL 310
            +   + + +L  +N +LS  ++EK+L+IK L D++  EK +FS E+TL++ + DLL SQL
Sbjct: 228  ESALSYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQL 287

Query: 311  NAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKD-LQLTKHKLVQCENECLRLSSITE 369
             + +      R+ +  ++  DD       +   + D L  TK +  + ++EC RL +I  
Sbjct: 288  ASFE------RDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIIS 341

Query: 370  EAGKEDGILTSKSNG----------DFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVP 419
            +  +ED   T  +NG          D  +L+KQLIKE+  K  LQNQ+E FI+ELEHK P
Sbjct: 342  DFVQEDKA-TVDTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTP 400

Query: 420  IINSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLD 479
             + SFKERT +               S  K    +EL    +K+   +  IH+L KQRLD
Sbjct: 401  ELVSFKERTKSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLD 460

Query: 480  LCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDI 539
            L RQ++ LL+  S    +  PL K+++  ++ IL++  S   E+D+Q I++ERLVEF +I
Sbjct: 461  LARQVKVLLLNTSAIQKTTLPLSKDDLISLRKILESG-SDVNENDAQAIISERLVEFNNI 519

Query: 540  IQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESK 599
             +LQEKN ELL   R LADKLE +E K    L  +E +TI EAK+AI+ L++  +++ES+
Sbjct: 520  NELQEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESR 579

Query: 600  IHELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMS 659
            I+ L +ER+ +K     +E + N +  +  TE     E + ++L+A +S    ES+  + 
Sbjct: 580  INILLRERDSYKLLASSKENNVNVNA-KNFTEISH--EKKIKELEAELSSTKVESSAVIQ 636

Query: 660  LLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQN 719
             L KEL           I     ++ ++LA+E+  +L   ++  K +   L K+ +++ +
Sbjct: 637  NLRKELTTYKKLLCDKKIASQDFENFKMLAKEKESILETRVNNLKTD---LEKQKLSVPS 693

Query: 720  AISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIXXXXXXXXXXXXXXXXXXX 779
             +  QD+K +++  + +  ++K   +  E+S+LK E    +                   
Sbjct: 694  FV--QDNKVRDS-TELLQSRTKTEILMHEISSLKKETANSMVLKESLTRDLERCCKEK-- 748

Query: 780  XHIMVTQLQTLQKERENLLDETKKSCQNK-------IDALQNAQNELKTEAIRKDQYIKQ 832
                  QLQ   KE E  L+E K +  +K       I  L+ +   L+ E   K Q IK 
Sbjct: 749  -----IQLQMKLKESEISLNEQKVNFDSKGIKYDARIKQLEESLERLRIELKSKAQEIKS 803

Query: 833  LEEDNDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHT 892
            L+   DS+++W QN I+   +  +SV++ L+ K+  V     +I++L+ E+ ENK++   
Sbjct: 804  LQSSKDSQLKWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLKYEF 863

Query: 893  Y-NVLDESINDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAF 951
              N  D S    +LR+ELE++++ L DA+SQ++ Y+++  T +K+L+E++SQL    + +
Sbjct: 864  LNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQLASMKEDY 923

Query: 952  SNQIQNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNKEI 1011
              +I+    EK + E+++SLLR ++  + +   LQ + +             L+N  ++I
Sbjct: 924  DARIELECKEKLANEEELSLLRRELDEIRS---LQPK-LKEGTVCLVKQSEKLRNQAEKI 979

Query: 1012 EAVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQV 1071
            + +K    +K+ K+  ++    +Y     + ++  ++ + ++S+ ++ L ++    + ++
Sbjct: 980  QEMK----AKIDKMNWNVQ---VYKKEKTSQFQSIMKANKELSELVTRLEKEATDSQMEL 1032

Query: 1072 ETLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTG 1131
            + L  +  + +  L  +E  W  +K     +L  +  + E L  +N +L ++I   T   
Sbjct: 1033 KKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIGSVTEGS 1092

Query: 1132 NKPTDA-KSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKL 1190
            +   D  K  S  +N     LR ER+ L+TK+   +RD  +++QK + ++  + + +   
Sbjct: 1093 DGNEDYLKLVSFFSN-----LRHERNSLETKLTTCKRDLALVKQKNASLEKNINDLQIDQ 1147

Query: 1191 CNSKVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRG 1250
              S+ E +  + II + +++ +++ Q+NLL+E+N  L+  L +   KN+E+  EL   + 
Sbjct: 1148 PASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIYEELTIRQE 1207

Query: 1251 NIAPIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIE 1310
             ++ ++S+L   K  +     +I + + E+ + K+R  D+  + +++     EKL +EI 
Sbjct: 1208 EVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIEKLNSEIS 1267

Query: 1311 SLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLN 1370
              KA+L D      + E KFNRL++QA EKL ASK  Q +   +L ELK  +  LE+ LN
Sbjct: 1268 DFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRDKLEQDLN 1327

Query: 1371 NANARIQELE 1380
            + N +  +L+
Sbjct: 1328 SKNFKTVDLD 1337

 Score = 50.8 bits (120), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 44/66 (66%), Gaps = 6/66 (9%)

Query: 1484 VNQKIREFQEAQE-----AEETGLKPSNI-NIDEIKKQWEAEHNEEVSKKIREAEEALKK 1537
            +N++ +EF++  E     ++ TG    N  NI+ +KK+W  E+ EE  ++IREAEE LKK
Sbjct: 1401 INERTKEFEKKLEEIVSKSKSTGKVADNSENIETLKKEWLKEYEEETIRRIREAEENLKK 1460

Query: 1538 RIRLPT 1543
            RIRLP+
Sbjct: 1461 RIRLPS 1466

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score =  358 bits (920), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 374/1383 (27%), Positives = 714/1383 (51%), Gaps = 77/1383 (5%)

Query: 24   IASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINSLKT 83
            I+ F +   E ++ +   ++  L  K+ +F   + E  ++ V +DE+K+    +I+ LK 
Sbjct: 5    ISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKLKQ 64

Query: 84   EMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNELESIKRKLSDLSEEKKEIQSSQQR 143
             +++   Q +  ++E N      + +  E++    E++++K++L    E  +E+      
Sbjct: 65   LLDESSEQKNTAKEELNGLK---DQLNEERSRYRREIDALKKQLHVSHEAMREVND---- 117

Query: 144  TLKILDERLKE-LEMVKAASNHSDS-------ECKKLRSTILELETKQQTYISNDLNSKS 195
                 ++R+KE  ++ ++    +DS       E K LR  ++E+E   Q   SN ++ + 
Sbjct: 118  -----EKRVKEEYDIWQSRDQGNDSLNDDLNKENKLLRRKLMEMENILQRCKSNAISLQL 172

Query: 196  QLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQLEKT 255
            + +   QE  L+  +K  +E++LSS +++ L+     ++ +  +   L +++++++   T
Sbjct: 173  KYDTSVQEKELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVFT 232

Query: 256  NNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVKE 315
             N  L  +N +LS+ ++EK+L++K L D+++ EK +FS E+TL++ + DLL SQL ++++
Sbjct: 233  YNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEK 292

Query: 316  ELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITEEAGKED 375
            +      S  +   +DD+     E+  ++ +L  TK +L + +NEC RL +I  +  KE+
Sbjct: 293  DC-----SLRAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKEE 347

Query: 376  -GILTS--------KSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPIINSFKE 426
               +T+        K   D  +LK+QLIKE+  K  LQNQ+E FI+ELEHK P + SFKE
Sbjct: 348  EATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKE 407

Query: 427  RTDTXXXXXXXXXXXXXHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDLCRQIQY 486
            RT +               S  K  + +E+    +K+   +  IH L KQRLDL RQ++ 
Sbjct: 408  RTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKL 467

Query: 487  LLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDIIQLQEKN 546
            LL+  S   ++  PL ++E+  ++ IL++ +    E+DSQ I+TERLVEF ++ +LQEKN
Sbjct: 468  LLLNTSAIQETASPLSQDELISLRKILESSN-IVNENDSQAIITERLVEFSNVNELQEKN 526

Query: 547  SELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKIHELEKE 606
             ELL   R LADKLE+ E K    L+ +EN+TI EAK+AI+ L++   ++E++I+ L +E
Sbjct: 527  VELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRE 586

Query: 607  REKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMSLLNKELQ 666
            R+ +K     +E   N + +  +   +   E + ++L+A +S    E++  +  L KEL 
Sbjct: 587  RDSYKLLASTEENKANTNSVTSMEAAR---EKKIRELEAELSSTKVENSAIIQNLRKELL 643

Query: 667  DLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNAISKQDS 726
                S+      L   ++ + LA+E+ ++L   +D  KAE   L K+   + + I  +  
Sbjct: 644  IYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAE---LEKQKSWVPSYIHVEKE 700

Query: 727  KTQETLNDYVSCKSKLSAIETELSNLKLERTLKIXXXXXXXXXXXXXXXXXXXXHIMVTQ 786
            +    L+     + K+ ++E E+S LK E    I                     + + +
Sbjct: 701  RASTELS---QSRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKE 757

Query: 787  LQTLQKERENLLDETKKSCQ--NKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSKIEWY 844
             +      EN +D + K  Q   KI  L+N    L+++   K Q I+ +    DS+++W 
Sbjct: 758  SEI--SHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWA 815

Query: 845  QNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLDE----SI 900
            QN I+      +S+++ L+ K+  +E+   EI++L+KE+ + K +   Y  LD+    S 
Sbjct: 816  QNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQ---YKFLDQNSDAST 872

Query: 901  NDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTD 960
             + +LR+ELE+ ++ L DA SQIQ Y+++  + + +L E+ ++L ++ + +  +I+    
Sbjct: 873  LEPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKENYDAKIELEKK 932

Query: 961  EKTSLEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNK---EIEAVKTE 1017
            EK + E+ +S LR ++  +     LQ +            +  +Q + K   E+E ++  
Sbjct: 933  EKWAREEDLSRLRGELGEIRA---LQPKL-------KEGALHFVQQSEKLRNEVERIQKM 982

Query: 1018 YESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLA 1077
             E    KI+K      +      + Y+  ++++ D+S+ +  L +     + ++     +
Sbjct: 983  IE----KIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIRLEKDAADCQAELTKTKSS 1038

Query: 1078 RGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDA 1137
                +  L ++E  W  +K     +L  +  + E L  +N +L ++++            
Sbjct: 1039 LYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKVDDTAANNGDKDHL 1098

Query: 1138 KSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVEN 1197
            K  S+ +N     LR ER+ L+TK+   +R+   ++QK   ++  + + +     S+ E 
Sbjct: 1099 KLVSLFSN-----LRHERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQTLSEKEY 1153

Query: 1198 EKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIES 1257
            +  + II +  ++ +++ Q+N+L+E+N  L+  L +   KN+E+  +L   +  I+ ++ 
Sbjct: 1154 QCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQEEISRLQR 1213

Query: 1258 ELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLE 1317
            +L   K  +     +I + + E+ + K+R QD+ ++ +     D EKL  EI  LK +L 
Sbjct: 1214 DLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEISDLKGKLS 1273

Query: 1318 DKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQ 1377
                  AD E KFNRL++QA EKL ASK  Q +   +LNELK  K  LE+ L+  NA++ 
Sbjct: 1274 SAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDLHFENAKVI 1333

Query: 1378 ELE 1380
            +L+
Sbjct: 1334 DLD 1336

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  342 bits (876), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 381/1433 (26%), Positives = 739/1433 (51%), Gaps = 103/1433 (7%)

Query: 21   LNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINS 80
            LN +A+  + +   +++I+  ++  +N KLL   +   E  ++  T+D  K+  + + ++
Sbjct: 4    LNNLATSLEVTATDLETIEPTVLEKINAKLLSSEQ---EKDRLNATIDNFKSKMSSQFDT 60

Query: 81   LKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNE-LESIKRKLSDLSEEKKEIQS 139
            +K ++E + ++ + + +++    SK   +Q E+ +  ++ +        D+ +E +  + 
Sbjct: 61   VKNDLELLQKEKELLIQDKKQLESK--CIQWEQQYAQHQDISKTDLASDDVIKENETFKR 118

Query: 140  SQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISNDLNSKSQLER 199
              Q     L    K+L    AA     +   +L++  +++ T+   + S     KS+ ER
Sbjct: 119  DHQLLTSDLMNLSKKLSSCDAALEKKSTAYLELQNDNIDIRTQLNNFKSETKGLKSKYER 178

Query: 200  RTQEL----NLLQSNKDWLE---KELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQL 252
            + ++     N   S K + E   KELS  + ++ + +  ++  +   ++ L+ +   ++L
Sbjct: 179  KVKDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSSNELRNAKDALHSLEKQYEL 238

Query: 253  EKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNA 312
                N   +++NNEL+  + ++L + K+L +  N  K  F+ E+TL Q   DLL+  +  
Sbjct: 239  LLEENKAFKERNNELTTTVSDELFKKKSLENDLNELKESFTREMTLTQHENDLLKEHIEY 298

Query: 313  VKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITEEAG 372
            +K   N T+E+      +  +  L  E ++LL +L   K  L + E E + L+   E+  
Sbjct: 299  LK---NTTKET------TGGTSTL--EKDRLLHELVDIKKSLEKSELENVHLNDFIEQYL 347

Query: 373  KEDGILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPIINSFKERTDTXX 432
             E+    S S+ + +LLK+QLIKEKR K++LQ Q+E F++ELE+++P +NS K+R  T  
Sbjct: 348  TENE--ESTSDNELVLLKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLE 405

Query: 433  XXXXXXXXXXXHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDLCRQIQYLLVTNS 492
                        T  E + +IKEL  +N +L E  + I++L  QR+DL  Q+Q+LL+   
Sbjct: 406  QELMQITGLLEETERESDIRIKELTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLD 465

Query: 493  VSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDIIQLQEKNSELLRV 552
            +    +  L  +EI F++ I+++ +S   +SDSQKI++ERLV+F DI  LQ++N ELL  
Sbjct: 466  LKKHQQHLLTPDEITFLRKIIKSRNSQN-DSDSQKIISERLVKFHDISVLQKQNMELLTT 524

Query: 553  TRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKIHELEKEREKFKN 612
            TRNLA++LES++ KS      ++  T NE+KE I  LQ     L SK+ +L+KE++ +K 
Sbjct: 525  TRNLAEQLESSDTKS------VQKITRNESKEKIAKLQESINGLTSKLEKLQKEKDAYKL 578

Query: 613  WTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTREST-------ENMSLLNKEL 665
             ++       N+  Q  TE   EL SQ Q  + +++++ R S+       E   +LN+ +
Sbjct: 579  LSL------QNTGEQTPTE---ELRSQLQKKEEQLTKLERMSSLDSHLAEEKAKVLNQSI 629

Query: 666  QDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRS------INLQN 719
              L   K  L+  + +E S R +AE++ K+L ++L+L   + D   K+       +N  N
Sbjct: 630  IKLKKEKYDLNNAIIKETSQRAIAEKKSKMLEDSLELLHKKYDLAVKKYEHYETLLNDHN 689

Query: 720  AISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIXXXXXXXXXXXXXXXXXXX 779
            A + + S+  ET       ++K+S ++ E+ + K  + L +                   
Sbjct: 690  AENIKHSRENET------TQAKISILQKEIESYK--QNL-LQYSKDNENTLSKLAAATQE 740

Query: 780  XHIMVTQLQTLQKERE---NLLDETKKSCQNKIDALQNAQNELKTEAIR---KDQYIKQL 833
               + ++L T++ E E   NL+ E +++   + D++  ++  LK   I+   K + +K  
Sbjct: 741  KETLGSRLSTVKNELEQKINLMQE-RETYYKEHDSI--SERLLKKSKIQLEDKIKEVKDF 797

Query: 834  EEDNDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTY 893
            E   +S+I WYQ ++++L   ++ +   LN++  ++   + +I  LEK + +N     + 
Sbjct: 798  EAKKNSQINWYQKRLDSLTTTNDKLQVELNKELTKINIQRLKISDLEKTLSQNTNGSSSL 857

Query: 894  NVLDESINDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSN 953
              +D+         + EK K  L +   +I +Y+ L    +++   +   L++  +   +
Sbjct: 858  PRVDQ---------DFEKLKNELKEKQLEINQYRDLLNLAEETKNRLQKDLNKQRQIVDD 908

Query: 954  QIQNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNKEIEA 1013
             ++     K  L+ +++ L ++ S++N+ L  Q                I+Q+   E E 
Sbjct: 909  AMEG----KEQLDQQLAELTQECSSMNSLLQKQKAKCEDDQK-------IIQDKATETEN 957

Query: 1014 VK---TEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQ 1070
            +K   +  E+K++ ++ ++ ++T      +N Y+++L K ++ S  I ++  +   YK  
Sbjct: 958  LKNSLSSLENKITTLENEMVEKTKSFEEKENTYKEQLHKLSESSTLIEKMEAENKAYKTS 1017

Query: 1071 VETLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTT 1130
            ++ L      +E A+         +K +   Q+D     I++L+ Q  +   +    T+ 
Sbjct: 1018 LDGLKANIAAYEDAISAYRQKLLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFITSE 1077

Query: 1131 GNKPTDAKSGSVLN-----NDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQE 1185
            G+  ++    +V+N     N++++ LRRERD LD K+ +++R+   LR+++  +   L E
Sbjct: 1078 GSTTSNDTDETVVNDTSDKNELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDE 1137

Query: 1186 ARTKLCNSKVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSEL 1245
             R      + E        +QH E +++LN+LN L+E+N  L+ +L  ++ +N  + ++L
Sbjct: 1138 TRQSFKGLESEVSGEMTTTEQHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKL 1197

Query: 1246 ERLRGNIAPIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKL 1305
            E L+  + P++ ++  LK SI EK+Q++ L  EE  RWK RS++I+ K QQ+   ++ KL
Sbjct: 1198 ELLKNEMNPLKDKVERLKNSIMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKL 1257

Query: 1306 ETEIESLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLAL 1365
              E+ +LK QL+ KT+   D  ++FNRL++QA EKL A+K    S   ++ +L DAK  L
Sbjct: 1258 MEELSTLKTQLDTKTKDNEDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKL 1317

Query: 1366 EKSLNNANARIQELED--AKVAENRNQLSMIKKLQEDTEENSKELETKLEENA 1416
            E  L+    RIQE+E    +  +N + ++ ++K   D+ ENSK++E  L+E  
Sbjct: 1318 EIDLDEERKRIQEVESQLKQKPDNPDVITALEKELSDSVENSKKIEENLQETV 1370

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 67/129 (51%), Gaps = 10/129 (7%)

Query: 1627 LRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKQS-VDS 1685
            LR ++E +LR +F++EL  +KKK+F EGKQQ+ MKTTLLERKL+K+ESQ S ++   ++S
Sbjct: 1541 LRKEVERELRVKFDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQASPSRTPDLES 1600

Query: 1686 PPKHLSKMPNPLLGLPRKIE---------ENSNPPYNPXXXXXXXXXXXXXXXXXXXFNP 1736
              K  ++        P KI          ++S     P                    NP
Sbjct: 1601 SQKENTEGATKTTLGPSKINLLPFSMSNTDDSIEKQVPQGEKVLQINRRSLEPSFGSSNP 1660

Query: 1737 FTSPSPNKP 1745
            FT P+ NKP
Sbjct: 1661 FTLPTQNKP 1669

 Score = 42.0 bits (97), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 32/43 (74%), Gaps = 2/43 (4%)

Query: 1501 GLKPSNINIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPT 1543
            G +P  I+I+++K +WE +  E + ++I +AEE LKKRIRLP+
Sbjct: 1463 GSEP--IDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPS 1503

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score =  339 bits (870), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 437/1727 (25%), Positives = 805/1727 (46%), Gaps = 198/1727 (11%)

Query: 158  VKAASNHSDSECKKLRSTILELETKQQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKE 217
            V+A + ++ +    +   IL L+ + +   S  L S+S+ ER  ++  L++ +  WLE+ 
Sbjct: 85   VEAQAPNNATSISNINDEILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEEH 144

Query: 218  LSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEKLLQ 277
            L    ++ ++ +Q     + E   +++ +R++  + K NND+L  KN ELS+++QEKL++
Sbjct: 145  LVKTTEELMTQKQSI-LKMEEKDQEIDNLRHEVSILKKNNDLLLGKNQELSENVQEKLIE 203

Query: 278  IKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVKEELNNTRESNYSDVNSDDSKQLI 337
            IK  SD  ++++++F  EI LK R+   LE+QL  +++E +   E N S           
Sbjct: 204  IKQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQQEKSIQNEDNTSR---------- 253

Query: 338  SENEKLLKDLQLTKHKLVQCENECLRLSSITEEAGKEDGILTSKSNGDFILLKKQLIKEK 397
            +E++K+++ L  T+ +L    NEC RL S   E         +  NG++      L KE 
Sbjct: 254  AESQKIMEQLIDTRKQLKDSRNECTRLKSYVNE-------FINDVNGEYSSSSSLLKKEL 306

Query: 398  RA----KEHLQNQIESFIVELEHKVPIINSFKERTDTXXXXXXXXXXXXXHTSNEKNAKI 453
                  K++L+ Q+E+FI ELE KVP+I+S +++                  S E+ +  
Sbjct: 307  LKVKEQKDYLETQVENFITELEIKVPVIDSLEKKNKDLEKELSDVTSLVDRISIERESLE 366

Query: 454  KELKVKNEKLAEYKDEIHILSKQRLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNIL 513
            KE +    K       I  L+ QR DL  QIQ+LL+       +   L K+E  FI+ + 
Sbjct: 367  KEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLT 426

Query: 514  QNDDSATTESDSQKIVTERLVEFRDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKN 573
            +ND  A   +DSQ I++ERL++F DI +LQ++N ++L   R+LA +LE  E   +     
Sbjct: 427  ENDTYARN-NDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHT 485

Query: 574  IENETINEAKEAILTLQSQKVQLESKIHELEKEREKFKNWTMDQETSPNNSVIQQLTETK 633
            IE +T+ EAK+A+L LQ     LE K+    KER+ +K   + +  SP+++   +  +  
Sbjct: 486  IERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVYK--LLSKGKSPSSNKPSECNDID 543

Query: 634  RELESQTQDLQARISQVTRESTENMSLLNKELQDLYDSKSSLSIELGREKSSRILAEERF 693
            +     T  LQ  + Q     T+ +  L +  +D+ + K  L   + + +S++  AE + 
Sbjct: 544  KH---TTGKLQNELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKMESAKEYAEGKA 600

Query: 694  KLLSNTLDLAKAENDQLRKRSINLQNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLK 753
            +L+ N L + +     + +++ +LQ  +S++++K  E   D     S+ + ++   ++ +
Sbjct: 601  ELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTSQYNLLQIRFTDTQ 660

Query: 754  LERTLKIXXXXXXXXXXXXXXXXXXXXHIMVTQLQTLQKERENLLDETKKSCQNKIDALQ 813
                                       + + TQ QT QKE   +++E K + + KI  L+
Sbjct: 661  ------------------------SQSNSLRTQHQTTQKELFEVVEE-KNALKVKIHELE 695

Query: 814  NAQNELKT-EAI-------RKDQY-----------------IKQLEEDNDSKIEWYQNKI 848
             ++NE K  +A        R  +Y                 I+ +E     ++ WYQ   
Sbjct: 696  ISRNECKGIQATVELKLNERLTEYQLHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQKNF 755

Query: 849  ETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLDESINDDSLRRE 908
             T + + E  +    +K+ E  R     +S    +E  K     +  L     D S+R+ 
Sbjct: 756  PT-QTETEIGLPVDMKKEGETGR-----QSNRDTLESQKSGSPGFTDLG---TDSSVRKS 806

Query: 909  LEKSKINLTDAYSQIQEYKKLYETTDKS-LQEMSSQLDESNKAFSNQIQNLTDEKTSLED 967
                 + +     + +E KK    TD S +  +   + +  K    QI+ L  +K  L+ 
Sbjct: 807  TSLPVMQVGRTEEESKEAKKCDALTDSSQVVGLPENVTKKEKDLIAQIEQLASDKKELKT 866

Query: 968  KVSLLREQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNKEIEAVKTEYESKLSKIQK 1027
             +  +R +  +L+++L L+  +           +  +  NN   E  K   E  L  ++ 
Sbjct: 867  SLQAIRAEYQHLHDQLQLEKNSFDTEKASLNNELDKIMENNSLTEVAKKSLEDDLHDVEM 926

Query: 1028 DLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQFEKALKE 1087
             L              E+E QKH + + T+SE +E L   +  +E ++  R +  K+  E
Sbjct: 927  KL--------------EEERQKHEETNATLSE-KELL--CEKMIEEISGYREELSKS-AE 968

Query: 1088 NETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSGSVLNNDI 1147
             + +    +E L + LDL+N RI+DL +QN LL++Q  L  T   + T  K       DI
Sbjct: 969  MQVDIQHTRE-LEDLLDLANKRIDDLCTQNNLLHEQ--LNATLDLEDTQNKDDI---KDI 1022

Query: 1148 LITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVENEKRSFIIQQH 1207
            ++ ++RERD L  K+A+ ER+ ++LR++ + +  EL +A +K    +  N   S ++  H
Sbjct: 1023 IVCMKRERDTLQKKLAIVEREGEVLRERCAGLKSEL-DAVSK--GQQWHNLPLSNLLTGH 1079

Query: 1208 DEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELAALKFSIQ 1267
            ++++++L +++LLRE+N +L  E++     N  L  EL ++R    P++ +    +   +
Sbjct: 1080 EKILDELKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFK 1139

Query: 1268 EKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEK-LETEIESLKAQLEDKTQQGADS 1326
            EK+QEI L K+E+ RWKKR Q ++  H+Q  +   E   + EI+SLK  +E++T++    
Sbjct: 1140 EKDQEISLYKDEIERWKKRWQQMV--HRQDDTLGLEANFKNEIDSLKGLIEERTKEKEKL 1197

Query: 1327 EEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQELEDAKVAE 1386
             EKF  L++QA EKL A+K+   +    L+E+K + L LE+ +   + +I+E+E   + E
Sbjct: 1198 SEKFQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIE-LTLKE 1256

Query: 1387 NRNQLSMIKKLQEDTEENSKELETKLEENAISYDSTVXXXXXXXXXXXXXXXXXXXXXXX 1446
            N  +    +KL   +E+  KE E KL       + T+                       
Sbjct: 1257 NLEKFDKDEKLV--SEKTFKENEAKL-------NKTITMLQKLNETLNQEVVSLREEINV 1307

Query: 1447 XXXXXGTEQDDLSKVVESMKRSXXXXXXXXXXXXTREVNQKIREFQE---AQEAEETGLK 1503
                   + D+ ++++ +MK               RE+N+K    +    ++++E     
Sbjct: 1308 LRK----KDDETNQLISTMKLDFEREKDRLIEEKVRELNEKFESGRNEVLSKQSENVTND 1363

Query: 1504 PSNINIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXX 1563
             +  N+D++K++   +  E+  ++I EA+E LK+ IRLP+                    
Sbjct: 1364 NTGSNVDKLKQELRKDWEEQTLQRIEEAKENLKRHIRLPS-------------------- 1403

Query: 1564 XXXXXXXKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPXXXXXXXXX 1623
                                +++++  I++++ ELE++++K+++EK   +          
Sbjct: 1404 --------------------EEKIQRIIEKRRAELESDFDKRVEEKANLIALADKADMSP 1443

Query: 1624 ---XXXLRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETK 1680
                  +R ++E  + ++   +L+TI+ K+FEEGK+QA MKTTLLERKL+K+ESQ+++  
Sbjct: 1444 DELKQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKLESQVAKDN 1503

Query: 1681 QSVDSPPKHLSKMPNPLLGLPRKIEENSNPPYNPXXXXXXXXXXXXXXXXXXXFNPFTSP 1740
            +S     K +S +    +  P+  ++N+                          NPFTSP
Sbjct: 1504 ESGSKVRKSISGLTKIDVNSPQLYKDNTGTRTEAVLKLRPTAKVDSGKDVSNDSNPFTSP 1563

Query: 1741 SPNKPLQGDEAEREPSSNETEPPTHLAPSFNI-PA-TQGXXXXXXXXXXXXXXEERTVNE 1798
            +     Q       P++    P  H+AP+F+  P  + G                 T + 
Sbjct: 1564 T-----QELSKSNSPAA---LPIVHMAPTFSFTPGKSTGTVNKELNKTAQATFGAPTFSN 1615

Query: 1799 QEENNAFDGIGQFQDRKVQEEG----ENLIEIAGASKDESKSNKRPI 1841
               + AF G   F      + G    E L EI      +++S KRP+
Sbjct: 1616 FGTSTAFGGFSGFGKTTNDQSGFKPFEALKEI------DNESIKRPV 1656

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score =  270 bits (689), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 289/1081 (26%), Positives = 542/1081 (50%), Gaps = 86/1081 (7%)

Query: 130  LSEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISN 189
            L +EK   Q ++   LK+L+ER+ +++ +KA  N    E K L     +L  + +T    
Sbjct: 63   LQKEKLASQETKNELLKLLEERINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDE 122

Query: 190  DLNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRND 249
             L  ++QL++ T  L+L    K   E E  SK + + SY+ +       +  +L  I N+
Sbjct: 123  KLLLRTQLDKVTFTLSLTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNE 182

Query: 250  FQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQ 309
             ++    N  L ++N ELSKDL+ K+ +IK+L +S  +   DF +E  L+ +LI+ L++Q
Sbjct: 183  LRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQ 242

Query: 310  LNAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITE 369
            +  ++E+L +  +  + D  +    Q + ++E LL+ ++    KL   E E L L    E
Sbjct: 243  IKTLQEQLESLSDEKFDDPGT----QKLDKHE-LLRQIKNLNEKLEISERERLSLVHSME 297

Query: 370  E----------------AGKEDGILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVE 413
            E                +G+ +  L+   +GD  +L+K  +KE++ K  L+ Q+   + E
Sbjct: 298  EFQNIPEEESSSVSSHASGRNNSALS--LSGDVNILRKHFLKERQQKRQLEEQMRQILQE 355

Query: 414  LEHKVPIINSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIKELKVKNEKLAEYKDEIHIL 473
            LE  +P ++S+KER+               H   E   K  EL+ K  + +  +  I+ L
Sbjct: 356  LERNMPSLSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSL 415

Query: 474  SKQRLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERL 533
            + QR  L RQ++YLL+    +      L +++++ +   L   ++A   SDS+KI+ ERL
Sbjct: 416  AFQRTVLARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAA-NTAEAMSDSEKILLERL 474

Query: 534  VEFRDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQK 593
             +F+++ +LQ +N +LL+V+R LA K E  E  +   + + E+ETIN+AKEAIL LQ   
Sbjct: 475  AQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYS 534

Query: 594  VQLESKIHELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRE 653
             +LES+I EL  E    K    ++E+      I  +++ + +  S T DL  ++S   + 
Sbjct: 535  QKLESQIKELSDELAVQKKEKTEKES------ISAMSKIEDDASSHTIDLGKQLSANLKH 588

Query: 654  STENMSLLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKR 713
            S + +  LN E+++L+ + + ++I L +EKS+R LAE+R+ LL   + L K+E ++L++ 
Sbjct: 589  SKDIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEELQEE 648

Query: 714  SINLQNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIXXXXXXXXXXXXX 773
               LQ  I  ++ +   +  DY+SCKSKLS  E E+++L+ E  L I             
Sbjct: 649  VNKLQQNILDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEAL 708

Query: 774  XXXXXXXHIMVTQLQTLQKERENLLDETKKSCQN--KIDALQNAQNELKTEAIRKDQYIK 831
                    + VTQ+ +L  E + LL ETK    +  KI AL+  Q   + + ++  Q + 
Sbjct: 709  LNERNNLRMTVTQMNSLNNELQTLLKETKSGYDDKLKISALKCTQTNNQLQLVQ--QRMS 766

Query: 832  QLEEDNDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLH 891
            +L+  NDS+I+WY+  I+ L+ +   +   L +K+ ++E F   +++++ E       L 
Sbjct: 767  ELKSQNDSEIKWYKATIDDLKANVFELNEELKQKEEKIEEFSKTLENVQNE-------LT 819

Query: 892  TYNVLDESINDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAF 951
              N  D S    +L +EL + K  L  +  +++EY+ +  T+ +S +  S Q ++  KA 
Sbjct: 820  LANSKDVSEEKRALEKELSEVKSQLEKSNLEVKEYENVISTSKRSFENKSIQYEDRIKAL 879

Query: 952  SNQIQNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNKEI 1011
            ++++ +   E+T+L++ +S L+ +M    +EL                      +NN  +
Sbjct: 880  ASKLDSELRERTTLQENLSTLQARMVVQQDELT---------------------SNNNTL 918

Query: 1012 EAVKTEYESKL----------SKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELR 1061
              ++  Y+S L          ++++  +  +T   ++   +YE+ +Q+++++SK +  LR
Sbjct: 919  SELRVSYDSLLLEQKTFKDKEAELRSVIAVKTGNYDSLSKSYERIMQENSELSKVVELLR 978

Query: 1062 EQL--HTYKGQVETLNLARGQFEKA---LKENETNWNSQKESLLEQLDLSNSRIEDLSSQ 1116
            E++   T  G+ E      G  E     +K+ +  W+ +K+    ++ ++N         
Sbjct: 979  EEVKNRTSNGEKE------GDLEDTESIIKKGQDVWDEEKKVF--EVQITNLNERLSELL 1030

Query: 1117 NKLLYDQIELYTT-TGNKPTDAKSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQK 1175
             +       L +   GN    A++ +  N + L  LR ER  L  K+  A+++ + +R K
Sbjct: 1031 EENESLLARLESQDKGNNSPSAETNAAGNEETLAALRSERTSLIEKLTAAQKEERSVRHK 1090

Query: 1176 I 1176
            +
Sbjct: 1091 L 1091

 Score = 63.2 bits (152), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 67/263 (25%), Positives = 107/263 (40%), Gaps = 78/263 (29%)

Query: 1520 HNEEVSKKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXXXXKSISQSGKM 1579
            + EE+ KK+ +AEE LKKRIRLPT                                    
Sbjct: 1224 YEEEIQKKVSQAEENLKKRIRLPT------------------------------------ 1247

Query: 1580 EDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPXXXXXXXXXXXXLRADIEAQLRE-- 1637
                ++++   I++++ ELE+ + +K++E+ + L             +  +IE   RE  
Sbjct: 1248 ----EEKINGIIEKRKSELESSFEQKIKEEAKSL--LLHSDDDKIKKIYKEIEESGRETL 1301

Query: 1638 --EFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQ----------LSETKQSVDS 1685
              EF+ +L  ++KK+FEEGKQ  +MK+  LERK++ +E Q              K++V S
Sbjct: 1302 QQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQLKEKNKLNNNSKNLKENVSS 1361

Query: 1686 PPKHLSKM-PNPLLGLPRKIEENSNPPYNPXXXXXXXXXXXXXXXXXXXFNPFTSPSPNK 1744
              +H S +  NP   L +   E  N P                       NPFTS     
Sbjct: 1362 TDEHNSSIQGNPFFNLGK---EQMNVP--------RFTSESSTMSTTSSLNPFTSFE--- 1407

Query: 1745 PLQGDEAEREPSSNETEPPTHLA 1767
                   + E  ++E   P H+A
Sbjct: 1408 -------QAETKTHEEHLPPHIA 1423

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score =  256 bits (654), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 270/1040 (25%), Positives = 520/1040 (50%), Gaps = 80/1040 (7%)

Query: 380  SKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPIINSFKERTDTXXXXXXXXX 439
            S+ N +  +L  +L +E  +K+ L+ Q+  F+ ELE   PII SFK++++          
Sbjct: 286  SELNNNISILSNRLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQ 345

Query: 440  XXXXHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDLCRQIQYLLVTNSVSNDSKG 499
                H + +K    +E++   ++L +   +  IL ++R DL RQ+QYLL+ N    DS  
Sbjct: 346  LHLEHVTKDKETIFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLL-NGFVKDSDD 404

Query: 500  PLRKEEIKFIQNILQND--DSATTESDSQKIVTERLVEFRDIIQLQEKNSELLRVTRNLA 557
            PL   E  +I+ IL  D  +  T+ +DSQ I+++R+++F+ I++LQ++N  LL   R L+
Sbjct: 405  PLTSSEFSYIKEILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLS 464

Query: 558  DKLESNENK--SKNYLKNIENETINEAKEAILTLQSQKVQLESKIHELEKEREKFKNWTM 615
            D+ E+ E K  S + +     E INEAK+ +L LQ     LE+K+  L  + +  +++T 
Sbjct: 465  DRAETLERKLESGDSI-----EAINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTS 519

Query: 616  DQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMSLLNKELQDLYDSKSSL 675
              +    NS +           +  Q L+ +   +  ES+E +  L  ++ +L  SKS L
Sbjct: 520  IGDGEFGNSDLSD--------GNNIQALKNKYDSLMAESSETIGHLYSQINNLQQSKSDL 571

Query: 676  SIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNAISKQDSKTQETLNDY 735
            + E     +S+ L E+R K+  + LDL+K EN  LR R  N   A+ +++ +T +T+  Y
Sbjct: 572  AKECESLINSKHLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKY 631

Query: 736  VSCKSKLSAIETELSNLKLERTLKIXXXXXXXXXXXXXXXXXXXXHIMVTQLQTLQKERE 795
            + C +KL  I+ +L N  +E+ +                        ++ QL+ LQK ++
Sbjct: 632  LDCVAKLDVIQRQLENTLVEKDILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQD 691

Query: 796  NLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSKIEWYQNKIETLRKDH 855
              L + + S QNKID L+    EL+ +   K+        +  +++EWYQ K ++L   +
Sbjct: 692  EQLKDIQVSLQNKIDDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSN 751

Query: 856  ESVMSSLNEKQIE----VERFQYEIKSLEKEIEE----NKIRLHTYNVLDESINDDSLRR 907
            +    +LNEK IE    +E    + ++L+  ++E    NK+      V D +    +L  
Sbjct: 752  D----ALNEKMIECASTIETLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTGALET 807

Query: 908  ELEKSKINLTDAYSQIQ---EYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTDEKTS 964
            EL  S+  LTD   +++      + Y++  K L E  S+L+  NK               
Sbjct: 808  ELATSRTRLTDTSRELEISSNTIRQYQSEIKVLNERQSELENENK--------------H 853

Query: 965  LEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNKEIEAVKTEYESKLSK 1024
            L D++++LR+++++   E + + +A+          +S L+    E+  ++ +Y +++ K
Sbjct: 854  LRDEIAILRDELTHNGGEFEREKEAL-------MKKLSNLEIRQAELTKLEEDYTAEIEK 906

Query: 1025 IQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQFEKA 1084
            ++ DLD+Q +     +  +++E++   +V    +E      TY+ ++E + + +    K 
Sbjct: 907  LKLDLDKQAMLGKEIKLAHDEEVR---EVQNRNTE------TYRNELELVEIRQT---KV 954

Query: 1085 LKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSGSVLN 1144
              E E    S+ + L EQ++L   R++  S +  LL +Q++L      K +D     V  
Sbjct: 955  FVEKEKELESRIKILNEQIELDKERMKQFSDEESLLREQVKLL--ADEKASDLVDAGVSP 1012

Query: 1145 --NDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVENEKRSF 1202
               D++  L  E+  L++K+  ++ +   LR++++  + E+      + N   E  K+  
Sbjct: 1013 EYTDLVRKLSDEKKNLESKLFASQSEKNRLREQLTKTESEI-----AVLNMNYEQAKKEV 1067

Query: 1203 IIQQHDE---VMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESEL 1259
              + ++E     E + QL  L+ESN +L NE+  +  +N E+ +EL  L+     +ES+L
Sbjct: 1068 AAEVNNESGRAEEHIAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQL 1127

Query: 1260 AALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTD-YEKLETEIESLKAQLED 1318
               +  +  K+ ++   + E  R K  S D+ +   + SS++    L++ + +L  Q+++
Sbjct: 1128 DEARNVLSSKDMKLMELQTECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDN 1187

Query: 1319 KTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQE 1378
                  + E++F RL+RQA+E+L ASK++ +S  + +  L   K AL+  +  +   + E
Sbjct: 1188 LKHANTELEDRFGRLKRQARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNE 1247

Query: 1379 LEDAKVAENRNQLSMIKKLQ 1398
            L  AK+ E+    +++K+L+
Sbjct: 1248 LR-AKIQEHIETSAVMKELK 1266

 Score = 56.6 bits (135), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 87/194 (44%), Gaps = 41/194 (21%)

Query: 1582 IFQKQLESRIQEKQKELENEYNKKLQEKLRELPXXXXXXXXXXXXLRADIEAQLREEFNH 1641
            +++++ +  ++ K  ELE ++  +++ K +EL             L+ +IE + +     
Sbjct: 1418 LYKEKSDQMMRAKMDELEEQFQNRVRNKEKEL-----------NALKDEIEEKCKTGHED 1466

Query: 1642 ELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKQSVD-----SPPKHLSKMPNP 1696
             L  +KK++FEEGKQQA MK ++LERK+AK+E++   TK   D       P+ ++  PN 
Sbjct: 1467 TLIAVKKRAFEEGKQQATMKMSILERKIAKLEAESKATKSGSDMSVSEDAPRFVT--PN- 1523

Query: 1697 LLGLPRKIEENSNPPYNPXXXXXXXXXXXXXXXXXXXFNPFTSPSPNKPLQGDEAEREPS 1756
                  K+++ +N P+                      NPFT+P            R  +
Sbjct: 1524 ----NNKVQQ-ANQPF-------LATAGSGFSVQSSESNPFTTP----------VSRGAA 1561

Query: 1757 SNETEPPTHLAPSF 1770
                   +  AP+F
Sbjct: 1562 HTNASSQSKFAPTF 1575

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
           (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  181 bits (459), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 121/348 (34%), Positives = 199/348 (57%), Gaps = 25/348 (7%)

Query: 403 LQNQIESFIVELEHKVPIINSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIKELKVKNEK 462
           L++ I++++ ELE ++P+I +FK   +                 N+K   +K +    + 
Sbjct: 214 LKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMKKT 273

Query: 463 LAEYKDEIHILSKQRLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTE 522
           + E    I  L  QR DL  Q+QYLL+ +S+ ND+ GPL K EI F+QN++ N D     
Sbjct: 274 INEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLI-NKDKQRLS 332

Query: 523 SDSQKIVTERLVEFRDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEA 582
           SD Q ++++RL++F+DI+ LQEKN EL +  RNLA  LES E++ KN  +N +N+TINEA
Sbjct: 333 SDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEA 392

Query: 583 KEAILTLQSQKVQLESKIHELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELESQ--- 639
           KE IL+LQ     L+ +I  L+ +  +       Q + PN+          +E E Q   
Sbjct: 393 KETILSLQEYNNVLKLEIGTLQSKISEL------QSSIPNS----------KESEKQHFN 436

Query: 640 -----TQDLQARISQVTRESTENMSLLNKELQDLYDSKSSLSIELGREKSSRILAEERFK 694
                 +DL++++S+++  S   +  LNK++Q+LY+ ++ + I L +EKSS ILA E+  
Sbjct: 437 YHSNLVKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLT 496

Query: 695 LLSNTLDLAKAENDQLRKRSINLQNAISKQDSKTQETLNDYVSCKSKL 742
           LL N+ DL   EN++L  ++  L+  +++++      LNDY+ CK+ L
Sbjct: 497 LLQNSYDLLTLENEELSSKNSMLEQQLNEEEKNLNSVLNDYIKCKTNL 544

 Score = 65.1 bits (157), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 77/163 (47%), Gaps = 56/163 (34%)

Query: 1514 KQWEAEHNEEVSKKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXXXXKSI 1573
            K  + E+  ++ K++ EAEEALK++IRLP+                              
Sbjct: 1093 KVLKTEYEGDIQKRVAEAEEALKRKIRLPS------------------------------ 1122

Query: 1574 SQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPXXXXXXXXXXXXLRADIEA 1633
                      ++++ + I+ K  +LE +Y KKL+    E                 DIE 
Sbjct: 1123 ----------EEKINTIIESKVADLEEDYKKKLETVSAE---------------STDIE- 1156

Query: 1634 QLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQL 1676
            ++++EF   L   KKK+FEEGKQQA MKT  LE K+AK+ESQL
Sbjct: 1157 KIKQEFEDNLVNAKKKAFEEGKQQASMKTKFLENKIAKLESQL 1199

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1554

 Score =  179 bits (453), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 183/626 (29%), Positives = 328/626 (52%), Gaps = 60/626 (9%)

Query: 8   MRSTQNDEDTGERLNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTL 67
           M +   +E T   ++ I+SFFD      +S+D   +  +  K     +L  EN  ++  +
Sbjct: 1   MSTDSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAY---DLMKENSFVSAAI 57

Query: 68  DELKTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTH-------LSNEL 120
           D++K     KIN++  +  ++  +N +++++ +      E +  EK         L++E+
Sbjct: 58  DDIKHVYEGKINTISQKYFNLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEI 117

Query: 121 ESIKRKLSDLSEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELE 180
             IK  L  +  +   +++ +++T  +L++   EL+        S +E   L+  I   E
Sbjct: 118 TLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQ-------DSLTENSALKEQIGVFE 170

Query: 181 TK-----QQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKEL--SSKNQQYLSYRQKTN 233
            K     Q+ +++N  N K Q       + LL+ N  +LE +   + KN++  S  +   
Sbjct: 171 GKLDSMTQELWLANTENKKLQ-----TGMKLLRENNLYLEIKCKETDKNKKLYSSAEDA- 224

Query: 234 TIISEIRNDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFS 293
              S +++ L  + ++    K+    L+  N  LS DLQ KL +IK L D+ NS K++F+
Sbjct: 225 ---SRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFA 281

Query: 294 AEITLKQRLIDLLESQLNAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHK 353
            EITLKQR+ +LL +++ + K+++               SK L +  +K++++L   K K
Sbjct: 282 KEITLKQRVNELLHNEIASYKKQIERL-----------TSKNLETPEKKIIQELVDLKEK 330

Query: 354 LVQCENECLRLSSITEEAGK--EDGILTSKSNGDFI--LLKKQLIKEKRAKEHLQNQIES 409
           LV  E EC  L S  ++     E  +++   N   +  +L++QL+KEKR K+ LQ Q+ES
Sbjct: 331 LVNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVES 390

Query: 410 FIVELEHKVPIINSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIKELKVKNEKLA---EY 466
           F+VELE K+P+I+SFKER  +              T+ E++ K +EL    +K++   ++
Sbjct: 391 FLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQF 450

Query: 467 KDEIHILSKQRLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQ 526
            DE   L +QR DL  Q+QYLL    +  D+K P  ++E   ++ I+ N+++   ++DS 
Sbjct: 451 NDE---LLRQRSDLAHQVQYLL----LCIDNKSPFTEKEATLVKKIVSNENTE-NDTDSH 502

Query: 527 KIVTERLVEFRDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINE-AKEA 585
           KI+++RL+ F+++ +LQ+KN ELLR TR L   LE  E + +  L+  +N  I E AK  
Sbjct: 503 KIISKRLLHFQNVKELQQKNMELLRTTRQLVQTLERQEQEQQKTLRITDNNKIVESAKST 562

Query: 586 ILTLQSQKVQLESKIHELEKEREKFK 611
            + L+     LESKI+ + +ER+ +K
Sbjct: 563 SVDLEKHIKTLESKINIISQERDSYK 588

 Score = 96.3 bits (238), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 61/162 (37%), Positives = 99/162 (61%)

Query: 1208 DEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELAALKFSIQ 1267
            +EVME   +L  L ESN  L  E+++    N+ L S+L  ++  + P+E E+  LK  + 
Sbjct: 1060 EEVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVA 1119

Query: 1268 EKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKTQQGADSE 1327
            EKEQ + + +EE+ RWK RSQ I+++ + +    + K   +I++L+ QLE    + A   
Sbjct: 1120 EKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLT 1179

Query: 1328 EKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSL 1369
            ++F+RL++QA EKL A+K  Q +   Q+NEL + K+ LEKSL
Sbjct: 1180 DRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSL 1221

 Score = 82.4 bits (202), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/158 (39%), Positives = 85/158 (53%), Gaps = 46/158 (29%)

Query: 1524 VSKKIREAEEALKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXXXXKSISQSGKMEDIF 1583
            + K+I EAEE LKKR+RLP+                                        
Sbjct: 1362 ILKRITEAEENLKKRMRLPS---------------------------------------- 1381

Query: 1584 QKQLESRIQEKQKELENEYNKKLQEKLRELPXXXXXXXXXXXXLRADIEAQLREEFNHEL 1643
            ++++ + I++++K LE E+    + KLREL              RA IE +LRE+FN EL
Sbjct: 1382 EEKINAVIEKRRKVLEQEF----ETKLRELGLNADGNGVVTDT-RAQIEKELREKFNLEL 1436

Query: 1644 QTIKKKSFEEGKQQAMMKTTLLERKLAKMESQ-LSETK 1680
              IKKK+FEEGKQQ+MMK+TLLERKL+K+ESQ LS TK
Sbjct: 1437 AEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTK 1474

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  164 bits (416), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 240/905 (26%), Positives = 415/905 (45%), Gaps = 164/905 (18%)

Query: 804  SCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSKIEWYQNKIETLR---KDHESVMS 860
            +  +KI  L      L  +   K++ +KQ  E ++ +I+WYQ  I+ L    K+  + + 
Sbjct: 682  TLSSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKII 741

Query: 861  SLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLDESINDDSLRRELEKSKINLTDAY 920
             LN+K          ++ L ++   NK     Y V  E      L+ EL   K  L  + 
Sbjct: 742  ELNDK----------LRLLSEKSLSNK----PYPVGTEL---KELQNELNGMKAALEVSE 784

Query: 921  SQIQEYK-------KLYETTDKSLQEMSSQLDESNKAFSNQIQNLTDEKTSLEDKVSLLR 973
            SQ   YK         Y  +  S Q   S+L   N+A S Q + L ++ T  E++   ++
Sbjct: 785  SQATLYKDTLERNQNFYNNSTLSFQNTISELQSKNEALSKQHETLQNQITETENQSKGIQ 844

Query: 974  EQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNKEIEAVKTEYESKLSKIQKDLDQQT 1033
             +   + + L  +  A+          ++ L ++ ++I  +K EY++++ KI+ +L  Q+
Sbjct: 845  LEHQTIIDRLTSEKTALEEK-------LNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQS 897

Query: 1034 IYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQFE---KALKENET 1090
                  + N+E  L      SK      ++L +Y  Q+E LN    +      AL E   
Sbjct: 898  ----DTRLNFESAL-----TSK-----EKELTSYAVQIEQLNTEIAKLNSDIAALTEPAE 943

Query: 1091 NWNS---QKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSGSVLNNDI 1147
               +   +++SL ++L L+N RIE L++QN +LYD     T +G +  DA +    N D+
Sbjct: 944  ARKTLIKERDSLGQELKLANQRIESLAAQNSILYD-----TFSGMRHVDADAEP--NEDL 996

Query: 1148 ---LITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLC---NSKVENEKRS 1201
               +I LR ERD+  ++   A+RD K+L++ +     E+ E     C   +     EK  
Sbjct: 997  RNLVINLRIERDMHQSQETTAQRDVKLLKKNLK----EITEKLAITCPEIDEPTNTEKDD 1052

Query: 1202 F-IIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELA 1260
            F +   H+++M +L  L   +E N  L   + S N   + LQ E+ RLR      ESE  
Sbjct: 1053 FSLTVTHEKIMRELEGLTNTKEENLYLDESIKSLNEDKRTLQEEVSRLR------ESEEL 1106

Query: 1261 ALK----FSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQL 1316
            A K     S QE +Q+I   ++E  +WK   Q + E     ++T+ + L+ ++E+ KA +
Sbjct: 1107 AKKNSSAISEQEWQQKIETYQQESEKWKLMCQQMSEN----TATEIQNLQQQLETFKADI 1162

Query: 1317 EDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARI 1376
            + KTQ+  D  ++F RL++QA EKL ASK + DS   +L+ELK    AL++ LNN     
Sbjct: 1163 QLKTQENDDLNDRFTRLKKQAHEKLNASKATSDSLAIELSELKTVNDALQEKLNN----- 1217

Query: 1377 QELEDAKVAENRNQLSMIKKLQEDTEENSKELETKLEENAISYDSTVXXXXXXXXXXXXX 1436
               ++    ++ +  ++I +L+E+ ++ +K LE +L  +  S +  +             
Sbjct: 1218 ---QETNSVDSESNAALILQLKEENKQ-AKSLELELRHSVDSSEKLI-----------AD 1262

Query: 1437 XXXXXXXXXXXXXXXGTEQDDLSKVVESMKRSXXXXXXXXXXXXTREVNQKIREFQEAQE 1496
                               +D +  +E +K              T E+ ++        E
Sbjct: 1263 MTKELTTLKENPIQGSVNVEDYTHRLEQLKSEFEDEKRVLIEKTTSELTERF-------E 1315

Query: 1497 AEETGLKPSNINIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTXXXXXXXXXXXXX 1556
             E+  L  +N N++E++K  E E   +  ++I EA+E LKK IRLPT             
Sbjct: 1316 REKKELMNNNANLEELRKPLEEEWERKTLQRIEEAKENLKKHIRLPT------------- 1362

Query: 1557 XXXXXXXXXXXXXXKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQE-----KLR 1611
                                       ++++E  I +++ +LE ++  K+ E     KL 
Sbjct: 1363 ---------------------------EEKIERVIAKRKAQLEEQFQTKVAEQANLLKLS 1395

Query: 1612 ELPXXXXXXXXXXXXLRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAK 1671
            EL             +R +I+ +L E+F    + +KKK+FEEG+QQA MKTTLLERK+AK
Sbjct: 1396 EL--SNKTADELEKEVREEIKTRLEEDF----ELLKKKAFEEGRQQASMKTTLLERKIAK 1449

Query: 1672 MESQL 1676
            +E++L
Sbjct: 1450 LEARL 1454

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score =  141 bits (355), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 169/623 (27%), Positives = 314/623 (50%), Gaps = 62/623 (9%)

Query: 163 NHSDSECKKLRSTILELETKQQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKELSSKN 222
           N   +E  +L   I ELE K +    N+L++K +LE+ +   N L+S    LE +LS+ N
Sbjct: 71  NRVTNEKTQLADKISELEVKLEQEKCNNLHTKLELEKMSITYNSLESKNRELESDLSAMN 130

Query: 223 ---------QQYLSYRQKTNTIISEIRNDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQE 273
                    +QY     K   +  E+ N    ++ND  + +T  D L +  N+   +L+E
Sbjct: 131 DNENTLHDEEQY-----KNQCLNREVIN----LKNDILILETKYDKLLKGYNDTKDNLKE 181

Query: 274 KLLQIKTLSDSSNSEKRDFSAEITLKQRLI---DLLESQLNAVKEELNNTRESN--YSDV 328
           K+ ++  L  S       F +E  LK  +I   D L + L    E L N RE N   SD+
Sbjct: 182 KISELLALDTS-------FKSETKLKDEIIEEKDYLIANLTNEIESLKN-REINEHSSDI 233

Query: 329 NSDDSK--QLI---SENEKLLKDLQLTKHKLVQCENECLRLSSITEEAGKEDGI--LTSK 381
           N +  K   +I    E ++LL +  +   K+ + + +  RL++   E   + GI  +++ 
Sbjct: 234 NIEYGKNSSIIVDKQEYQRLLNEALINNEKIDEYDLKVARLTATVNEFQSKTGINFVSTD 293

Query: 382 SNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPIINSFKERTDTXXXXXXXXXXX 441
              DFI+LKK++ K +  ++ LQ ++E  I ELE+  P +N+  ++ +            
Sbjct: 294 DFCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKINELELLLSKEKNT 353

Query: 442 XXH-------TSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDLCRQIQYLLVTNSVS 494
             H         NEK   I  LK+ +       D+I  L ++  DL  QIQ++L++NS+ 
Sbjct: 354 SEHFKTTIKEIENEKKNIISRLKLSD-------DKIETLREENNDLTNQIQFMLISNSIQ 406

Query: 495 NDSKGPLRKEEIKFIQNILQ--NDDSATTESDSQKIVTERLVEFRDIIQLQEKNSELLRV 552
           ND  G L + EIKFI+ + +   + S     +SQ I+++RL+ F  +I LQ+KN EL++ 
Sbjct: 407 NDKYGELTENEIKFIKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMELIKT 466

Query: 553 TRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKIHELEKEREKFKN 612
            R +  KL++ E++ +   +   ++ +NEAKE IL + S+  +L+ KI EL+++     N
Sbjct: 467 LRLITKKLDNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQLN--AN 524

Query: 613 WTMDQETSPNNSVIQQ---LTETKRELESQTQDLQARISQVTRESTENMSLLNKELQDLY 669
             +  E + + SV+ +    TE  R +     +L+  I + T++++  +S+   +L  LY
Sbjct: 525 RPVSHEKNGHESVLAENKLYTEGDRLI---LDELKNNIPEFTKQASNIISMNFDQLTSLY 581

Query: 670 DSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNAISKQDSKTQ 729
           +    L+ +  +   SR + +++  LL +  D     N++L++    +++ I ++D    
Sbjct: 582 NKNLELTADRLKAYQSRDITQKKLDLLQDKYDYLSISNEKLKEHMEVIKDTIRRKDETLN 641

Query: 730 ETLNDYVSCKSKLSAIETELSNL 752
            T+ ++V CK+ L ++  ++++L
Sbjct: 642 STIANHVDCKASLLSVTNDMNSL 664

 Score = 36.2 bits (82), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 76/143 (53%), Gaps = 9/143 (6%)

Query: 1238 NKELQSELERLRGNIAPIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQL 1297
            N++LQ +L     +I  ++ E+  L  SI E ++       E+   + R +++  K ++ 
Sbjct: 908  NRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITLLRNRCKELENKLKEA 967

Query: 1298 SSTDYEKLETEIESLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNE 1357
            S      L+++    K + E K+++  ++ ++FNRL++QA  +L +SK  Q++  EQ++ 
Sbjct: 968  S------LQSD---FKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISS 1018

Query: 1358 LKDAKLALEKSLNNANARIQELE 1380
            LK     ++  L   +  +QELE
Sbjct: 1019 LKKDLAEVQSKLEVQSKTVQELE 1041

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 93.2 bits (230), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 137/560 (24%), Positives = 265/560 (47%), Gaps = 110/560 (19%)

Query: 195 SQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQLEK 254
           S+LE+R + +N   S  + L+ EL +KN++Y   +Q+ +  I + +++LN +++     +
Sbjct: 64  SELEKRFEVIN---SINEQLKNELYTKNKEYFQIKQECDVKIEDYKSNLNELKH-----R 115

Query: 255 TNNDVLRQKNNELSKDLQEKLLQI--KTLSDSSNSEKR---DFSAEITLKQRLIDLLESQ 309
            + ++L+ KNN      ++K++ +   ++++S  ++K+   DF    TL+ + ++  + Q
Sbjct: 116 LSKEILQNKNN------KQKIINVYEHSINESLENDKKYVKDFEKLETLESKFLETYD-Q 168

Query: 310 LNAVKEEL------------NNTRESNYS---DVNSDDSKQLISENEKL----------- 343
           +N +K ++            N   E +Y    D N +  +  I  NEKL           
Sbjct: 169 MNIMKNKIYFNTQPATPIAENEPSEESYDVEVDNNYNSWRTSIEYNEKLNIKKVVYKLQE 228

Query: 344 -LKDLQLTKHKLVQC----ENECLRLSSITEEAGKEDGILTSKSNGDFIL-------LKK 391
            L+ +     +L++     ENE + +S     +   +    + SN DF         +K 
Sbjct: 229 RLETVSTMNKELLKIIKLSENEEMNISLQNLNSNNNNLYNDTHSNNDFEFDINNIDDIKT 288

Query: 392 QLIKEKRAKEHLQNQIESFIVELEHKVPII--NSFKERTDTXXXXXXXXXXXXXHTSNEK 449
           +LIKEK  K  L+ +   F+ ++E K+P +  NS +  T+              H S   
Sbjct: 289 ELIKEKYEKSLLEKKFNDFLFDIESKLPYLQNNSVENETNNGNKIEEQKIIHE-HDS--- 344

Query: 450 NAKIKELKVKNE----KLAEYKDEIHILSKQRLDLCRQIQYLLVTNSVSN-DSKGPLRKE 504
                 LK++N+    KL +++  +  L +QR DL  QI YLL+T S  N D+   L + 
Sbjct: 345 ------LKLENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTEN 398

Query: 505 EIKFIQNILQNDDSATTESDSQKIVTERLVEFRDIIQLQEKNSELLRVTRNLADKLESNE 564
           E+ FI+N++    + T  +++Q I++ERL++F ++  L  KN +L+ + R L +K+ES E
Sbjct: 399 ELNFIRNLVA-QPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIE 457

Query: 565 NKSKNYLKNIENE--TINEAKEAILTLQSQKVQLESKIHELEKEREKFKNWTMDQETSPN 622
            ++     ++E +  +I+EAK+ ++ L+ + V+                          N
Sbjct: 458 KQNSQKFGDLEMDFKSIDEAKQRMIVLKEENVK--------------------------N 491

Query: 623 NSVIQQLTETKRELESQTQDLQARIS------QVTRESTENMSLLNKELQDLYDSKSSLS 676
             +I Q+   K+ LE +   L + ++      ++ RE T     L K  Q L +  + LS
Sbjct: 492 KDIINQIISEKKLLEDKIHGLNSTVTELNKSMEIKREPTLKNLELQKTNQSLLEKNNQLS 551

Query: 677 IELGREKSSRILAEERFKLL 696
           IE+    +   + +E+F LL
Sbjct: 552 IEISNASNENKILKEKFDLL 571

 Score = 33.5 bits (75), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 40/63 (63%), Gaps = 7/63 (11%)

Query: 1308 EIESLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEK 1367
            EI+ LK Q+E K+++  +S ++F RL++QA++KL   K ++       N+L++    LEK
Sbjct: 752  EIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTE-------NKLREDYCDLEK 804

Query: 1368 SLN 1370
            S N
Sbjct: 805  SKN 807

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
            (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 42.7 bits (99), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 99/184 (53%), Gaps = 5/184 (2%)

Query: 1204 IQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGN-IAPIESELAAL 1262
            IQ+ ++++   NQ   ++  N+ L + L+  N+    + +EL  L    I  +E+E   L
Sbjct: 544  IQESNDLLADENQK--IKMENSNLSSLLNKINTDKNSISNELSDLHSKEILELETEKTKL 601

Query: 1263 KFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDY--EKLETEIESLKAQLEDKT 1320
               ++E E++++ T E+ +   K  Q+ ++   + ++ +     L+ + E+LK   E+K+
Sbjct: 602  LEQLEEGERKLKETNEKHNEQIKWFQNKIDNFNEETTKNQFNNALKNDYENLKKSFEEKS 661

Query: 1321 QQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQELE 1380
            ++  ++ +KF+RL+RQA E+L ASK +Q    + +  L+D +   ++ ++     I  L 
Sbjct: 662  KEVEEANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINNLN 721

Query: 1381 DAKV 1384
            +A V
Sbjct: 722  NALV 725

 Score = 35.0 bits (79), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 59/246 (23%), Positives = 119/246 (48%), Gaps = 28/246 (11%)

Query: 194 KSQLERRTQELNLLQSNKDWLEKELSSKNQQYL------SYRQKTNTIISEIRNDLNRIR 247
           K +++R + + NLL++N  WL + L    + YL       Y  K +  +    N L  ++
Sbjct: 21  KREIKRLSDKYNLLENNYKWLNERLVRDQKNYLIDTHDVKYSSKNDNKLYNSHNKLLELQ 80

Query: 248 NDFQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLE 307
            +F +  ++N+ L  + NE S +  +K   +  + D+ N+EK      + L ++ ++LL 
Sbjct: 81  KEFLI--SHNEKLSDRLNENSIEFNDKFNSV--VIDNLNNEKN-----LILFEKKLNLLN 131

Query: 308 SQLNAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSI 367
            + + +   + + ++   +D+N+    +  S NEK++K        +   E++  +L++I
Sbjct: 132 ERYSII---IKDQKDVIDNDINNSKYLEFKSLNEKIIKQ----NSNMKSMESKIEKLNAI 184

Query: 368 TE------EAGKEDGILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPII 421
                   E   E+    S    D  +LKK L+ EK +   LQ ++ S ++EL  K+P +
Sbjct: 185 IHNFIDINEFDNENTNKYSLDLNDNKVLKKLLVHEKNSNLKLQEELNSILLELNFKLPSL 244

Query: 422 NSFKER 427
            S KE+
Sbjct: 245 TSLKEK 250

>KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {ON}
            Anc_4.238 YDL058W
          Length = 2220

 Score = 38.9 bits (89), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 127/449 (28%), Positives = 207/449 (46%), Gaps = 75/449 (16%)

Query: 1011 IEAVKTEYESKLSKIQKDLDQQT---------IYANTAQ-NNYEQELQKHADVS-KTISE 1059
            IE +KT+++ +L   QK  D Q          I + +++ +  E EL+   D + K +SE
Sbjct: 1649 IEEMKTDFDKRLEAQQKLADDQVKEVEELKLIISSKSSKLDAKEAELKNTKDTNEKLLSE 1708

Query: 1060 LREQLHTYKGQVETLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKL 1119
            L+ Q+ T + ++     A  + E   KE E   NSQ E+L E++ L+  + +D  S    
Sbjct: 1709 LKLQISTLENKISAKEKALAETESTGKEKEKQLNSQLEALQEEVKLAGKKAKDSVSG--- 1765

Query: 1120 LYDQIELYTTTGNKPTDAKSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLI 1179
            L  Q+ L         +  S  V +N    TL+ E   L   +A+ E   K++ +K  ++
Sbjct: 1766 LETQLNLVKKDVESKNNENSKLVADNK---TLQLENSKL---LAIKE---KIIEEKNGIV 1816

Query: 1180 DVELQEART---KLCNSKVENEKRSFIIQQHDE-------VMEKL-NQLNLLRESN---- 1224
            D +L EART   KL +      K   +I+  +E        MEK  NQL LL ES     
Sbjct: 1817 D-DLAEARTVADKLKDECAATSKELQLIKSSEEETKTEISAMEKSKNQLELLLESFKAKV 1875

Query: 1225 TTLRNELDSSNSKNKELQSELER-----------LRGNIAPIESELAALKFSIQEKEQEI 1273
            + L  +L   +S  +E +  LE+           L  ++  +ESE   L   I   E+E 
Sbjct: 1876 SGLEKDLSQKDSILEETRLALEKYTSENESKQKDLEAHVKQLESEKDRLASEI---EEER 1932

Query: 1274 RLTKEEVHRWKKRSQDIMEKHQQLSS--TDYE--------KLETEIESLKAQLEDKTQQG 1323
            +L  E      K +Q I+E   QLS+    YE        KLET+I  L  +L+  T++ 
Sbjct: 1933 KLATE------KSNQKIIELESQLSTLKLQYEKDVNEVQTKLETKISQLSDELDSITKEK 1986

Query: 1324 ADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQELEDAK 1383
             + + K + L  + +   +AS  + +  IE+L+E  + K + EK    +   +Q+  DAK
Sbjct: 1987 MEVQNKLHSLTEENESIKEASTTANNKEIEKLHE--EIKFS-EKKAAESRKVLQDEYDAK 2043

Query: 1384 VAENRNQLSMIKKLQEDTEENSKELETKL 1412
            V +  ++   IK L ++  E   EL TKL
Sbjct: 2044 VKKLADE---IKALGKERREREGELTTKL 2069

>TPHA0J01570 Chr10 (360114..363170) [3057 bp, 1018 aa] {ON}
           Anc_8.761 YMR231W
          Length = 1018

 Score = 38.1 bits (87), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 73/139 (52%), Gaps = 22/139 (15%)

Query: 845 QNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHT-YNVLDESINDD 903
           Q+  +T   + + +++ L EK  ++   Q +I  L+KE+ +  ++L T YN+ DE I + 
Sbjct: 328 QDTSDTYYLNSDGILNKLTEKPYDM---QIDI-VLQKEMFQFALKLATAYNLSDEYIKEI 383

Query: 904 SLRRE---LEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTD 960
             R       K+K+   DA    +EY K ++  + S  E+ ++L  SNKA SN +QNLTD
Sbjct: 384 HKRYGDYLFNKNKV--ADA---TEEYIKAFDVVETS--EIIAKLGMSNKADSNNLQNLTD 436

Query: 961 EKTSL-------EDKVSLL 972
              SL        D V+LL
Sbjct: 437 YLCSLVKTSKANADHVTLL 455

>TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4.238
            YDL058W
          Length = 1657

 Score = 37.4 bits (85), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 93/352 (26%), Positives = 168/352 (47%), Gaps = 43/352 (12%)

Query: 900  INDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLT 959
            +N+ +L  EL+  K+ + +    IQE +K  ET   +L ++ +  DE+ K    QIQ+L 
Sbjct: 1207 LNNTNLVSELDALKVTVGEKNGNIQELEKKKETASSALSKIKADFDETEKRLKAQIQSL- 1265

Query: 960  DEKTSLEDKVSLLREQMSNLNNELDLQNQAMXXXXXXXXXXISILQNNNKEIEAVKTEYE 1019
              +T  E KV    ++        D+  Q            IS+   + K+IE VK++ +
Sbjct: 1266 --QTKHERKVQDFDKERQLFAEGSDMVTQEYSKKINTLEEQISV---SEKQIEEVKSQLQ 1320

Query: 1020 SKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVS-----KTISELREQLHT-------- 1066
            +   K  ++L   +I A+   N+ + E  K A  S     K +++  ++L T        
Sbjct: 1321 AS-EKTVRNLKSDSI-ASQQTNDIKVESLKSALASSEKQAKEVTQKYDKLKTSSDENASS 1378

Query: 1067 YKGQVETLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIEL 1126
             KGQ+E L  A     +A + N  + N  KE L   ++  N ++E L  +N +L  +++ 
Sbjct: 1379 LKGQIERLTEAVKSETRAKEINAKDLNQLKEKLQCFVETMN-KLETLEKENAVLDQRVK- 1436

Query: 1127 YTTTGNKPTDAKSGSVLNNDI-LITLRRERDILDTKV---AVAERDAKMLRQKISLI--D 1180
                  K  + K  +V N ++ L TL  E+  L  K+   +++  D + LR++ + +   
Sbjct: 1437 ------KLKNEKEETVKNLEVKLETLSSEKQSLKEKLQGQSISLNDNESLREENNSLKKK 1490

Query: 1181 VELQEARTKLCNSKVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELD 1232
            +E  E  T  C+  +E E +S I+ QH+E ++ LN +      N+TL++ELD
Sbjct: 1491 IESLEELTDACDKSLE-ESKSMIV-QHEEGIKSLNSI------NSTLKSELD 1534

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON}
           Anc_4.237
          Length = 1096

 Score = 37.4 bits (85), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 78/154 (50%), Gaps = 6/154 (3%)

Query: 833 LEEDNDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHT 892
           +E +N S  E  QN I+T +     VM+ +  K+ ++ER+  +  S+EKEI+E  + +  
Sbjct: 298 IEHNNQSCQELRQN-IKTFQTKIAEVMAKIESKKEKIERYTADGASIEKEIDEKVVTVSQ 356

Query: 893 YNVLDESINDD--SLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKA 950
            +   ++  D    +R+  E  K N  +A   I + +   +T DK+++ +   L    K 
Sbjct: 357 KDQEHQATRDSLREVRKVFETEKSNQREAEQNITQCRNRIKTLDKTIEHLEQDL---KKE 413

Query: 951 FSNQIQNLTDEKTSLEDKVSLLREQMSNLNNELD 984
                + + +E+ SLE +   LR+++S+L   +D
Sbjct: 414 MGGDKEQMREEQISLEHESDQLRKELSDLQISMD 447

>CAGL0K10890g Chr11 (1063220..1064422) [1203 bp, 400 aa] {ON} highly
           similar to uniprot|Q03558 Saccharomyces cerevisiae
           YHR179w OYE2 NADPH dehydrogenase or uniprot|P41816
           Saccharomyces cerevisiae YPL171c OYE3
          Length = 400

 Score = 35.8 bits (81), Expect = 1.1,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 53/96 (55%), Gaps = 7/96 (7%)

Query: 654 STENMSLLNKELQDLYDSKSSLSIEL---GREKSSRILAEERFKLLSNTLDL-AKAENDQ 709
           S E +    K +  ++ +KS   ++L   GR     +LA +  +  S T +  A  E ++
Sbjct: 91  SEEQLVEWRKIIDAIHSNKSFAWVQLWALGRLAMPNLLARDGLRFDSATDNYYASPEQEE 150

Query: 710 LRKRSINLQNAISKQDSKTQETLNDYV-SCKSKLSA 744
           L K+S NLQ+ +S++D K  + +NDYV + K+ +SA
Sbjct: 151 LAKKSNNLQHGLSREDIK--QYVNDYVQASKNAISA 184

>KAFR0A04090 Chr1 complement(821972..824524) [2553 bp, 850 aa] {ON}
            Anc_8.718 YOR270C
          Length = 850

 Score = 34.3 bits (77), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 57/116 (49%), Gaps = 19/116 (16%)

Query: 1170 KMLRQKISLIDVELQEARTKLCNSKVEN--EKRSFIIQQHDEVMEKLNQLNLLRES---- 1223
            ++LR  +    VEL    T +C++K +   +K +FII  H +++ K  ++  + ES    
Sbjct: 203  RVLRGNLFFKHVELP---TPVCDTKTKGHVDKNAFIIFSHGDLIIK--RIKKIAESLDAK 257

Query: 1224 ------NTTLRNELDSSNSKNKELQSELERLRGNIAPIESELAALKFSIQEKEQEI 1273
                  N  LR+E    N  NK L    + LR  +A +ESEL A+   + +  QEI
Sbjct: 258  LYSIDKNAELRSE--HLNGVNKTLDDLYQVLRTTVATLESELYAVSKELNKWFQEI 311

>Ecym_8356 Chr8 (713086..718521) [5436 bp, 1811 aa] {ON} similar to
           Ashbya gossypii ADL022C
          Length = 1811

 Score = 34.3 bits (77), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 90/178 (50%), Gaps = 27/178 (15%)

Query: 586 ILTLQSQKVQLESKIHELEKERE--KFKNWTMDQETSPNNSVIQQLTETKRELESQTQDL 643
           I+ L  +  +LE+KI ++ ++ +  +FK+  +D + S  +S  + L E   EL SQ Q  
Sbjct: 331 IVLLLEEGNKLEAKIRQMSEDYKTLEFKSGQLDGQVSILSSEKRSLNEKVEELSSQLQSS 390

Query: 644 QARISQVTRESTENMSLLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLA 703
           +A I+ +  E       L+ ++ D              EK   I  ++   LL+  L+  
Sbjct: 391 KAEINTLKGE-------LSSKIDDA-------------EKRDEI--QQELTLLNKQLNEL 428

Query: 704 KAENDQLRKRSINLQNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLE-RTLKI 760
           K EN+  ++++I L   ++ QD+   ++ ND  + KSKLSA+  +L  L  E +TLK+
Sbjct: 429 KFENEAFKQKNITLTIQLADQDAVVGKSFND--TFKSKLSALNGQLEELVTENQTLKL 484

>Ecym_5345 Chr5 complement(699527..703627) [4101 bp, 1366 aa] {ON}
            similar to Ashbya gossypii AER045C
          Length = 1366

 Score = 34.3 bits (77), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 82/296 (27%), Positives = 142/296 (47%), Gaps = 64/296 (21%)

Query: 67   LDELKTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNELESIKRK 126
            LDE ++ S+ +I SLK+E+E ++ +   + ++ N+   +   +QRE      E+E  K K
Sbjct: 940  LDEARSTSSLEIASLKSEIETLVAEKSILDQKSNNLEVQLGKIQRELELAKVEVEDSKTK 999

Query: 127  LSD-----------LSEEKKEIQSSQ-QRTLK---ILDERLKELEMVKAASNHSDSECKK 171
            LSD           L ++   I S + Q+ LK   +  +  K    +K   N  +S  KK
Sbjct: 1000 LSDENSRLHENLKNLKDQLSSITSERDQQKLKSESLAGDLTKVSAEIKKLQNDYESLIKK 1059

Query: 172  LRSTILELETKQQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQY------ 225
            L+ T  +L++       N+   +SQ+ER T EL           K +S++N +       
Sbjct: 1060 LKVTNSDLDS------CNERLKQSQIERDTLELEF---------KTISTQNSELQKKIED 1104

Query: 226  LSYRQKTNTI-ISE--IRNDLNRIRND-FQLEK---------TNNDVLRQKNNELSKDLQ 272
            L+   K+NT  +SE   +ND    ++D F+LE+          N D  + K +EL ++L 
Sbjct: 1105 LTLENKSNTASLSEDIFQNDSTVDKSDEFELEELRTALKNVTANYDAAKAKVDELERNL- 1163

Query: 273  EKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVKEELNNTRESNYSDV 328
                  + LS+   S+  D++    LK+     L+SQ+   K +L+NT E+NY+D+
Sbjct: 1164 ------RVLSE--KSKNNDYNDNSELKK-----LQSQIADYKGKLSNT-ETNYTDL 1205

>TDEL0B01940 Chr2 complement(343685..347938) [4254 bp, 1417 aa] {ON}
            Anc_8.442 YDR227W
          Length = 1417

 Score = 34.3 bits (77), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%)

Query: 821  TEAIRKDQYIKQLEEDNDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLE 880
            TE I +DQ+++ + ED  + +E    +IE  RK   ++   + +K++ +      +++ E
Sbjct: 1322 TEDIGEDQFVRTIIEDATNALEEKDKQIEAARKLILALSREVMQKELSITSLSGRLRAAE 1381

Query: 881  KEIEENKIRLHTYNV 895
             EI+E K+ L  Y V
Sbjct: 1382 HEIKEQKLTLDDYAV 1396

>NCAS0C02840 Chr3 (537144..539483) [2340 bp, 779 aa] {ON} Anc_8.400
           YLR241W
          Length = 779

 Score = 33.9 bits (76), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 21/68 (30%)

Query: 280 TLSDSSNSEKRD-----FSAEITLKQR----------------LIDLLESQLNAVKEELN 318
           TL D SN+E  D       AE++LK+R                 ID LESQL  + +E+N
Sbjct: 309 TLPDVSNAEPGDEEDNTLYAEVSLKERPTMKVGLFGLFGEKIDAIDHLESQLKFIDQEIN 368

Query: 319 NTRESNYS 326
           + R+ +YS
Sbjct: 369 DARKKHYS 376

>Kwal_23.5978 s23 complement(1398157..1400352) [2196 bp, 731 aa] {ON}
            YIL078W (THS1) - Threonyl-tRNA synthetase, cytoplasmic
            [contig 12] FULL
          Length = 731

 Score = 33.9 bits (76), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 10/82 (12%)

Query: 1020 SKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTIS-----ELREQLHT----YKGQ 1070
            + L+++++   Q   +   AQN  EQE++   +  + +      E + +L T    Y G+
Sbjct: 453  TGLTRVRR-FQQDDAHIFCAQNQIEQEIENCFNFLQYVYGVFGFEFKMELSTRPEKYVGE 511

Query: 1071 VETLNLARGQFEKALKENETNW 1092
            +ET N A  + E ALK+   NW
Sbjct: 512  IETWNYAESKLESALKKWGGNW 533

>KNAG0F00930 Chr6 (170493..172262) [1770 bp, 589 aa] {ON} Anc_2.26
            YNL218W
          Length = 589

 Score = 33.9 bits (76), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 62/142 (43%), Gaps = 20/142 (14%)

Query: 1262 LKFSIQEKEQEIRLTK-------EEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKA 1314
            LK   ++ + E RLTK       +E+HR+ K  QD++  H  + + D   +    E+   
Sbjct: 222  LKAVFEKAKAEYRLTKRRVILFIDEIHRFNKPQQDLLLPH--VENGDIVLIGATTENPSF 279

Query: 1315 QLEDKTQQGADSEEKFNRLRRQAQEKLKASKLS--QDSFIEQLNELKDAKLALEKSLNNA 1372
            QL +            +R      EKL +S+L    +  I  LN+L+       + L  A
Sbjct: 280  QLNNAL---------ISRCHVFVLEKLSSSELGLVLNRAIALLNKLRTFIWHCSRPLKLA 330

Query: 1373 NARIQELEDAKVAENRNQLSMI 1394
               I+ +ED  + + R  L+++
Sbjct: 331  KDAIEYIEDVCIGDTRRALNLL 352

>KNAG0K01060 Chr11 (207381..208709) [1329 bp, 442 aa] {ON} Anc_3.149
            YOL069W
          Length = 442

 Score = 33.5 bits (75), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 86/206 (41%), Gaps = 28/206 (13%)

Query: 1208 DEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELAALKFSIQ 1267
            D  + + N+ NLLR+ NT +  EL   ++ N+E  ++L RL       ES     K    
Sbjct: 139  DIFVTRFNEFNLLRKQNTEIEAELGDLDNINEETSNDLSRLEA-----ESNEMIEKLKDL 193

Query: 1268 EKEQEIRLTKEEVHRWKKR---------SQDIME------KHQQLSSTDYEKLETEIESL 1312
            E+ +   L +++ ++ +KR         S  I+E      K  ++S+TD + L   I +L
Sbjct: 194  EQTKSALLVQQDAYKLEKRTLLTQLESLSFQIVELESKRDKFAEMSTTDMQDLTNSINNL 253

Query: 1313 -------KAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLAL 1365
                   +A L D   +  + E  F  ++R   E     K+         N+ + A    
Sbjct: 254  SRILTERQADLTDLKSKQTNLESTFQTMKRVIDEICALLKILTTVLQPTFNK-EIATFET 312

Query: 1366 EKSLNNANARIQELEDAKVAENRNQL 1391
             + +NN  AR+    +  V   RN L
Sbjct: 313  RQKVNNTVARLDTFMNESVLSKRNAL 338

>TDEL0B07090 Chr2 complement(1249326..1251647) [2322 bp, 773 aa] {ON}
            Anc_2.616 YKL072W
          Length = 773

 Score = 33.5 bits (75), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 34/161 (21%), Positives = 73/161 (45%), Gaps = 18/161 (11%)

Query: 936  SLQEMSSQLDESNKAFSNQIQNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMXXXXX 995
            +  ++ ++L    +  ++++  L D+K  +E K +LL+ +M  LN+              
Sbjct: 613  AFGDLMNELQGVYQDCTSRVGELDDKKQEVETKRTLLKGEMRELNS-----------LSS 661

Query: 996  XXXXXISILQNNNKEIEAVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSK 1055
                 + +++   +++E     +E+KL  +QK L +  +    A ++    L   A   +
Sbjct: 662  KFQYDMRVIEGRMRDVEDSVNHFEAKLEAVQKSLIENGLGIGMAVDS----LSDKAAFDR 717

Query: 1056 TISELREQLHT-YKGQVETLNLARGQFEKALKENETNWNSQ 1095
             ISEL    +T Y+G    L +   +F + +KE+ + W S 
Sbjct: 718  CISELVHARNTKYEGV--CLKMFSKRFVRDIKEDVSKWGSW 756

>NDAI0C05600 Chr3 complement(1293657..1296251) [2595 bp, 864 aa] {ON}
            Anc_8.560
          Length = 864

 Score = 33.5 bits (75), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 107/246 (43%), Gaps = 42/246 (17%)

Query: 1010 EIEAVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTY-- 1067
            + E  K   E+K  +++KD D   IY +T  ++   E  K  D  K  S   +QL +Y  
Sbjct: 297  DFEGFKDTIETKTKEMEKDNDY--IYHDTIPSSVSLESIKPIDAIKCPS-WEQQLKSYME 353

Query: 1068 KGQVETLNLARGQFEKALKENETNWNSQKESLL-------EQLDLSNSRIEDLSSQNKLL 1120
                +T +L +G     + E E+ ++ +K  +L       E  +L  +   D ++  KL+
Sbjct: 354  TTASDTDSLYKGIVPMEIYEKESIYSEEKAQMLRNEMEATETANLEYTSFVDFTNLPKLI 413

Query: 1121 YDQIELYTTTGNKPTDAKSGSVLNNDILITLRRERDILDTKVAVAE-----------RDA 1169
             D  + Y+T+G   T+         D  + L R++  L +  +V             RD 
Sbjct: 414  TDLEKRYSTSGASSTE---------DPQVELMRKQ--LTSYASVIHNSPFNDVDKVIRDI 462

Query: 1170 KMLRQKISLIDVEL----QEARTKLCNSKVE----NEKRSFIIQQHDEVMEKLNQLNLLR 1221
              +RQ+I  I V L    +E   KL  S VE    +EK  F+++ + E ++ LN  NLL 
Sbjct: 463  SFMRQEILDILVTLPSQEKENSLKLKASLVEASKSDEKLFFLVKPYMEEIKLLNNANLLW 522

Query: 1222 ESNTTL 1227
                T 
Sbjct: 523  SKFNTF 528

>KLTH0F01452g Chr6 complement(109643..110863) [1221 bp, 406 aa] {ON}
            similar to uniprot|P11709 Saccharomyces cerevisiae
            YCL029C BIK1 Microtubule-associated protein component of
            the interface between microtubules and kinetochore
            involved in sister chromatid separation essential in
            polyploid cells but not in haploid or diploid cells
            ortholog of mammalian CLIP-170
          Length = 406

 Score = 33.1 bits (74), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 50/93 (53%), Gaps = 14/93 (15%)

Query: 1291 MEKHQQLSSTDYEKLETEIESLKAQLEDKTQQGADSEEKF-NRLRRQAQEKLKASKLSQD 1349
            ++  Q  S+   +K E E E LK Q++  +     SE ++ N+  R A EKLK S+ SQ 
Sbjct: 265  LKAQQAASAVTAKKWEKEREQLKLQIDSLS-----SEYQYVNKELRDAHEKLKVSQESQS 319

Query: 1350 SFIEQLNELKDAKLALEKSLNNANARIQELEDA 1382
                 L+E++  KL LE     ANA+IQELE  
Sbjct: 320  D----LSEIEQLKLQLEA----ANAKIQELEQG 344

>ADL022C Chr4 complement(660327..670505) [10179 bp, 3392 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL021W
           (SPA2) and YLR313C
          Length = 3392

 Score = 33.5 bits (75), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 82/142 (57%), Gaps = 9/142 (6%)

Query: 626 IQQLTETKRELESQTQDLQARISQVTRES---TENMSLLNKELQDLYDSKSSLSIELG-- 680
           + Q+TE  + LE ++ +L  +++Q+  E    TE +  L+ +L++   + + LS E+   
Sbjct: 360 LMQITEENKSLEQKSDELAGQVTQLLSEKEILTEQVLDLHTKLEESEKTVTDLSEEVVKL 419

Query: 681 REKS-SRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNAISKQDSKTQETLNDYVSCK 739
           REK+ + ++ +++   L+N ++    EN+ L ++++ L   ++ QD+    ++ D  S K
Sbjct: 420 REKADAGVVLQQQISALTNQVNELTFENEALTQKNLTLTTQLADQDATVGRSMGD--SFK 477

Query: 740 SKLSAIETELSNLKLE-RTLKI 760
            KLSA+ ++L  L  + +TLK+
Sbjct: 478 EKLSALNSQLEELITQNQTLKL 499

>Ecym_6476 Chr6 (921068..923620) [2553 bp, 850 aa] {ON} similar to
           Ashbya gossypii ABL193C
          Length = 850

 Score = 33.1 bits (74), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 76/139 (54%), Gaps = 16/139 (11%)

Query: 538 DIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAI--------LTL 589
           DII L++K++  +   + L D+L+  EN+ K+  ++IE+ T++   E I        +TL
Sbjct: 250 DIIHLEQKSARTMESLKTLEDELKQRENRIKSLEQSIESATVDSEAEVIKLNKELEQVTL 309

Query: 590 QSQKVQLESKIHELEKEREKFKNWTMDQETSPN-NSVIQQLTETKREL---ESQTQDLQA 645
           + +K ++E+K+   E E    K+  ++QE   +      +LT+  ++L   E++  DL +
Sbjct: 310 EYKKYKIEAKLRLDETESLLVKSNDLNQELQESVKGKTDELTQLSKKLVTKENEVSDLNS 369

Query: 646 RISQ----VTRESTENMSL 660
            +++    +++  TEN SL
Sbjct: 370 SLTKSNTIISKLQTENDSL 388

>KNAG0C05060 Chr3 complement(972160..975282) [3123 bp, 1040 aa] {ON}
           Anc_5.414 YDR356W
          Length = 1040

 Score = 33.1 bits (74), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 57/106 (53%), Gaps = 18/106 (16%)

Query: 576 NETINEAKEAILTLQSQKVQLESKIHELEKEREKFKNWTMDQETSPNNSVIQQLTETKRE 635
           N+TI  +KE++ T++++  Q++    +LEK + +F     D+    NN + +Q++   R+
Sbjct: 661 NKTIKASKESLKTIETKNAQIDDLTEQLEKAKSEF-----DRALKTNNILEEQIS---RK 712

Query: 636 LESQTQDLQARISQV-------TRESTENMSLLN---KELQDLYDS 671
            + Q +DL+  +  +       TRE  E +  LN   +E QD YD+
Sbjct: 713 YQDQIKDLEDEVDGLSNTLRIRTREENERIKQLNEDIQEWQDRYDT 758

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]
           {ON} Anc_4.237 YLR383W
          Length = 1102

 Score = 33.1 bits (74), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 57/108 (52%), Gaps = 6/108 (5%)

Query: 837 NDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHT---- 892
           N   +E  +N ++T +   E + + +NEK+  +E++  + +S +  IEEN I ++     
Sbjct: 309 NYKAVEKLKNDMKTCQTKIEKLTNKVNEKEKGIEKYTIDNESAQALIEENVINVNNREQE 368

Query: 893 YNVLDESINDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEM 940
           + +  E++ +  +R E EK K N  +A   I+  KK  E  DK++  +
Sbjct: 369 HQLAREAVRN--VRAEFEKKKANEAEAQKNIESCKKKIEALDKTIAHL 414

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
           YGR238C
          Length = 1086

 Score = 33.1 bits (74), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 4/106 (3%)

Query: 52  QFNELKSENIQITVTLDELKTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQR 111
           QF+ +K EN  +  T+++L       I S  T ++D L Q  +      D  SK +SV+ 
Sbjct: 849 QFDLVKKENETLKQTVNDLNLGLKNDITSYSTLLDDFLGQWKQKNLANTDDESKLKSVET 908

Query: 112 EKTHLSNELESIKRKLSDLSEEKKEIQSSQQRTLKILDERLKELEM 157
              H    ++ +  +L +L  + KE+  S+++    L++  K LEM
Sbjct: 909 YNQHHKAVVDKLSNRLDELISKSKEMTQSKEK----LNQEYKALEM 950

>NDAI0H01540 Chr8 complement(366943..368139) [1197 bp, 398 aa] {ON} 
          Length = 398

 Score = 32.7 bits (73), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 59/130 (45%), Gaps = 8/130 (6%)

Query: 84  EMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNELESIKRKLSDLSEEKKEIQSSQQR 143
           ++E  L   +EIRK  N T   F+S+      L N+LES    +++  +  K + S+  R
Sbjct: 61  DIEIPLPNAEEIRKATNKTKKVFDSL------LQNKLESNGTSVAN--KNHKNVSSNVVR 112

Query: 144 TLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISNDLNSKSQLERRTQE 203
             K     + E+E+V+A  +      KK R  +  +  ++ T I N  N K   +   ++
Sbjct: 113 YGKSGTSNVVEMEIVEAVQDPLQPSRKKFRKAVAPISGEEVTPIYNSSNEKKLTKEEIRK 172

Query: 204 LNLLQSNKDW 213
            N+  +   W
Sbjct: 173 WNIPSAISAW 182

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.123    0.312 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 187,594,137
Number of extensions: 8752111
Number of successful extensions: 84540
Number of sequences better than 10.0: 4084
Number of HSP's gapped: 71720
Number of HSP's successfully gapped: 10561
Length of query: 1898
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1774
Effective length of database: 39,262,815
Effective search space: 69652233810
Effective search space used: 69652233810
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 73 (32.7 bits)