Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_11.3295.698ON60160131220.0
YKR093W (PTR2)5.698ON60160129240.0
Smik_11.3565.698ON60260128740.0
KNAG0C065705.698ON59055621660.0
NDAI0E050205.698ON61955821640.0
CAGL0G02453g5.698ON59756221470.0
Kpol_529.285.698ON61060721430.0
NCAS0A032205.698ON61158821220.0
ZYRO0G06688g5.698ON61353520600.0
TPHA0N01960singletonON59150220220.0
KAFR0H002405.698ON59153520170.0
TPHA0O02000singletonON62056120170.0
SAKL0E14828g5.698ON59255520130.0
TBLA0A091205.698ON63353419970.0
KAFR0H00230singletonON59659819870.0
KLLA0E12915g5.698ON65456519740.0
Skud_11.3315.698ON39939919370.0
TDEL0B022305.698ON57453319330.0
TBLA0E01140singletonON61154819360.0
TBLA0B04710singletonON61549718400.0
Kwal_47.16930na 1ON6115426113e-70
KLTH0D16544gna 1ON6265666019e-69
AGL365Cna 2ON5995215571e-62
Ecym_2823na 2ON6135625553e-62
AFR228WsingletonON5765124991e-54
ADL156Cna 3ON483220850.092
Skud_4.2933.276ON1090144820.30
Skud_4.294na 4ON1090144820.30
KNAG0K016203.227ON407228761.2
ZYRO0G18700g1.173ON591179714.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_11.329
         (601 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093...  1207   0.0  
YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integ...  1130   0.0  
Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093...  1111   0.0  
KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON} Anc_5...   838   0.0  
NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON} Anc_5...   838   0.0  
CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly...   831   0.0  
Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}...   830   0.0  
NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {O...   822   0.0  
ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {...   798   0.0  
TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {...   783   0.0  
KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}...   781   0.0  
TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {...   781   0.0  
SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} simi...   780   0.0  
TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa] ...   773   0.0  
KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON}      769   0.0  
KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]...   764   0.0  
Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093...   750   0.0  
TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {O...   749   0.0  
TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {O...   750   0.0  
TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON}            713   0.0  
Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093...   239   3e-70
KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]...   236   9e-69
AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON} NOH...   219   1e-62
Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar...   218   3e-62
AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-synteni...   196   1e-54
ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON} S...    37   0.092
Skud_4.293 Chr4 complement(511701..514973) [3273 bp, 1090 aa] {O...    36   0.30 
Skud_4.294 Chr4 complement(511701..514973) [3273 bp, 1090 aa] {O...    36   0.30 
KNAG0K01620 Chr11 (336059..337282) [1224 bp, 407 aa] {ON}              34   1.2  
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    32   4.7  

>Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093W
           (REAL)
          Length = 601

 Score = 1207 bits (3122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/601 (97%), Positives = 587/601 (97%)

Query: 1   MLNHLSQGSDDIQDEKQGEFPVVEEEKNQTVTLKDSYVSDDAANSTERFNLSPSPEDNEF 60
           MLNHLSQGSDDIQDEKQGEFPVVEEEKNQTVTLKDSYVSDDAANSTERFNLSPSPEDNEF
Sbjct: 1   MLNHLSQGSDDIQDEKQGEFPVVEEEKNQTVTLKDSYVSDDAANSTERFNLSPSPEDNEF 60

Query: 61  EAPTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLS 120
           EAPTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLS
Sbjct: 61  EAPTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLS 120

Query: 121 LNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180
           LNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSV
Sbjct: 121 LNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180

Query: 181 GNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITL 240
           GNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITL
Sbjct: 181 GNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITL 240

Query: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPI 300
           QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPI
Sbjct: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPI 300

Query: 301 GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPI 360
           GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPI
Sbjct: 301 GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPI 360

Query: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKP 420
           YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKP
Sbjct: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKP 420

Query: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLGHNTPNHVHVCWQIPAYVLISFSE 480
           ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLGHNTPNHVHVCWQIPAYVLISFSE
Sbjct: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLGHNTPNHVHVCWQIPAYVLISFSE 480

Query: 481 IFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540
           IFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA
Sbjct: 481 IFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540

Query: 541 CFISGCLFWLCFRKYNDTXXXXXXXXXXXXXXFDLNPISQPKANDIEILEPMGSLKSTTK 600
           CFISGCLFWLCFRKYNDT              FDLNPISQPKANDIEILEPMGSLKSTTK
Sbjct: 541 CFISGCLFWLCFRKYNDTEEEMNAMDYEEEDEFDLNPISQPKANDIEILEPMGSLKSTTK 600

Query: 601 Y 601
           Y
Sbjct: 601 Y 601

>YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integral
           membrane peptide transporter, mediates transport of di-
           and tri-peptides; conserved protein that contains 12
           transmembrane domains; PTR2 expression is regulated by
           the N-end rule pathway via repression by Cup9p
          Length = 601

 Score = 1130 bits (2924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/601 (91%), Positives = 572/601 (95%)

Query: 1   MLNHLSQGSDDIQDEKQGEFPVVEEEKNQTVTLKDSYVSDDAANSTERFNLSPSPEDNEF 60
           MLNH SQGSDD QDEKQG+FPV+EEEK Q VTLKDSYVSDD ANSTER+NLSPSPED +F
Sbjct: 1   MLNHPSQGSDDAQDEKQGDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNLSPSPEDEDF 60

Query: 61  EAPTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLS 120
           E PT+EE+++LRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPND+PKG+LS
Sbjct: 61  EGPTEEEMQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLS 120

Query: 121 LNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180
           LNS GATGLSYFFQFWCYVTPVFGGY+ADTFWGKYNTICCGTAIYIAGIFILFITSIPSV
Sbjct: 121 LNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180

Query: 181 GNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITL 240
           GNRDSA+GGFIA+IILIGIATGMIKANLSVLIADQLPKRKP IKVLKSGERVI D NITL
Sbjct: 181 GNRDSAIGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITL 240

Query: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPI 300
           QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFW+AVVTL+FGKKQYIQRPI
Sbjct: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPI 300

Query: 301 GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPI 360
           GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEK+YPWNDKFVDEIKRALAACKVF+FYPI
Sbjct: 301 GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPI 360

Query: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKP 420
           YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKF YPFIRRYTP KP
Sbjct: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKP 420

Query: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLGHNTPNHVHVCWQIPAYVLISFSE 480
           ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWY+EPLGHNTPNHVHVCWQIPAYVLISFSE
Sbjct: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSE 480

Query: 481 IFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540
           IFASITGLEYAYSKAPA+MKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA
Sbjct: 481 IFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540

Query: 541 CFISGCLFWLCFRKYNDTXXXXXXXXXXXXXXFDLNPISQPKANDIEILEPMGSLKSTTK 600
           CFISGCLFWLCFRKYNDT              FDLNPIS PKANDIEILEPM SL+STTK
Sbjct: 541 CFISGCLFWLCFRKYNDTEEEMNAMDYEEEDEFDLNPISAPKANDIEILEPMESLRSTTK 600

Query: 601 Y 601
           Y
Sbjct: 601 Y 601

>Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093W
           (REAL)
          Length = 602

 Score = 1111 bits (2874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/601 (89%), Positives = 567/601 (94%)

Query: 1   MLNHLSQGSDDIQDEKQGEFPVVEEEKNQTVTLKDSYVSDDAANSTERFNLSPSPEDNEF 60
           MLNH S+ SD++QDEKQG+FPV+EEEK   VTLKDSYVSDD ANSTE++NLS SPED +F
Sbjct: 1   MLNHPSRSSDEVQDEKQGDFPVIEEEKTHAVTLKDSYVSDDVANSTEQYNLSHSPEDEDF 60

Query: 61  EAPTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLS 120
           EAPT+EE ++LRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPND+PKG+L 
Sbjct: 61  EAPTEEETKTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLG 120

Query: 121 LNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180
           LNS GATGLSYFFQFWCYVTPVFGGY+ADTFWGKYNTICCGTAIYIAGIFILFITSIPSV
Sbjct: 121 LNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180

Query: 181 GNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITL 240
           GNRDSA+GGFIA+IILIGIATGMIKAN+SVLIADQLPKRKPFIKVLKSGERVI D NITL
Sbjct: 181 GNRDSAIGGFIAAIILIGIATGMIKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITL 240

Query: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPI 300
           QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFW+AVVTL+FGKKQYIQRPI
Sbjct: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPI 300

Query: 301 GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPI 360
           GDKV+AKSF+VCWILTKNKFDFNAAKPSVHPE++YPWNDKFVDEIKRALAACKVFVFYPI
Sbjct: 301 GDKVVAKSFRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPI 360

Query: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKP 420
           YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALI+FIPIFEKF YPFIRRYTP KP
Sbjct: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKP 420

Query: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLGHNTPNHVHVCWQIPAYVLISFSE 480
           ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWY+EPLGHNTPNH+HVCWQIPAYVLISFSE
Sbjct: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHIHVCWQIPAYVLISFSE 480

Query: 481 IFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540
           IFASITGLEYAYSKAPA+MKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA
Sbjct: 481 IFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540

Query: 541 CFISGCLFWLCFRKYNDTXXXXXXXXXXXXXXFDLNPISQPKANDIEILEPMGSLKSTTK 600
           CFISGCLFWLCFRKYNDT              FDLN IS PKANDIEILEP  SL+ST K
Sbjct: 541 CFISGCLFWLCFRKYNDTEEEMNAMDYEEDDEFDLNSISAPKANDIEILEPTESLRSTAK 600

Query: 601 Y 601
           Y
Sbjct: 601 Y 601

>KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON}
           Anc_5.698 YKR093W
          Length = 590

 Score =  838 bits (2166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/556 (71%), Positives = 469/556 (84%), Gaps = 8/556 (1%)

Query: 2   LNHLSQGSDDIQDEKQGEFPVVEEEKNQTVTLKDSYVSDDAANSTERFNLSPSPEDNEFE 61
           L  ++  S+D   +K+ +  V+ +E + T+  +DS + DD A+  E       PE   +E
Sbjct: 3   LRQVNTFSEDDSLDKKNDL-VLTKENSHTIE-EDSRIVDDLASQYE----DDIPEG--YE 54

Query: 62  APTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLSL 121
            PT+EELR+L+HVGG IPMRCWLIA+VELSERFSYYGLSAPFQNYM  GP+D P G+L L
Sbjct: 55  VPTEEELRTLKHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQL 114

Query: 122 NSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSVG 181
           NS GATGLSYFFQFWCYVTP+FGGY+ADT WGKYNTI  GT IYI GIFILF+TSIPS+ 
Sbjct: 115 NSDGATGLSYFFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSIT 174

Query: 182 NRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQ 241
            +++ LGGFI +IILIGIATGMIK+NLSVLIADQLPKRKP +K  K+GERVIED N+TLQ
Sbjct: 175 TKNAGLGGFIVAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQ 234

Query: 242 NVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPIG 301
           NVFMFFY MIN+GSLS++AT+ELE H+GFWAAYLLPFCFFW+AVV LV GK QY++ PIG
Sbjct: 235 NVFMFFYLMINIGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIG 294

Query: 302 DKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPIY 361
           DKVI+K FKV WILTKN+F+F+A KPS++P K+YPW+DKFVDEI+RAL ACKVF+FYPIY
Sbjct: 295 DKVISKCFKVLWILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIY 354

Query: 362 WTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKPI 421
           WT YG M+S F+TQ SMMELHG+PNDF Q  DSIA+I+FIP+ E   YPFIR+YTPF+PI
Sbjct: 355 WTCYGQMMSGFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPI 414

Query: 422 TKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLGHNTPNHVHVCWQIPAYVLISFSEI 481
           TKI+FGFMF S  M WAAVLQS++YKAGP Y  PL H+ PN +HV  Q+PAYVL++FSEI
Sbjct: 415 TKIYFGFMFASGCMIWAAVLQSYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEI 474

Query: 482 FASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVAC 541
           FASITGLEYAYSKAPA+MKSFIMSIFL+TNAFGSAIGCALSPV+ DP +TWL+TGLAVAC
Sbjct: 475 FASITGLEYAYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVAC 534

Query: 542 FISGCLFWLCFRKYND 557
           FISGCLFW+CFRKYND
Sbjct: 535 FISGCLFWVCFRKYND 550

>NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON}
           Anc_5.698
          Length = 619

 Score =  838 bits (2164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/558 (71%), Positives = 459/558 (82%), Gaps = 16/558 (2%)

Query: 12  IQDEKQGEFPVVEEEKNQTVTLKDSYVSDDAANSTERFNLSPSPED--NEF--------- 60
           ++DEK  E    ++E N T +  +  + D      E +NLS S  D  N+F         
Sbjct: 18  LKDEKIEEITTTKKETNATTSSTEEKLHD-----VETYNLSNSANDSTNDFDDDEMEEGY 72

Query: 61  EAPTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLS 120
           E PTDEEL +L+ VGGKIP+RCWLI +VEL+ERFSYYGLSAPFQNYM+ GPND+PKG+L 
Sbjct: 73  EEPTDEELNTLKRVGGKIPLRCWLIGVVELAERFSYYGLSAPFQNYMQNGPNDSPKGVLM 132

Query: 121 LNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180
           LNSSGATGLSYFFQFWCYVTPVFGG++ADT+WGKYN+I  GT  YI GIFILFIT+IPS+
Sbjct: 133 LNSSGATGLSYFFQFWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVGIFILFITAIPSI 192

Query: 181 GNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITL 240
            +++++LGGFI SIILIGI TG IKANLSVLIADQLPKRKP +K+LKSGERVIED NITL
Sbjct: 193 ASQNASLGGFIVSIILIGIGTGFIKANLSVLIADQLPKRKPRVKILKSGERVIEDPNITL 252

Query: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPI 300
           QNVFM FY MIN+GS+S+MATTELE HKGFWAAYLLPFCFFW+AVV LVFG+K Y++  +
Sbjct: 253 QNVFMVFYLMINIGSMSVMATTELESHKGFWAAYLLPFCFFWIAVVILVFGRKYYVKEKM 312

Query: 301 GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPI 360
           GD V+ KSFKVCWI+ KNK D+NAAKPS HPE++YPWND+FVDE+KR +AACKVFVFYPI
Sbjct: 313 GDNVVQKSFKVCWIVAKNKLDYNAAKPSYHPERNYPWNDRFVDEMKRTIAACKVFVFYPI 372

Query: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKP 420
           YW QYG+MIS+F+TQ S MELHGIPNDFLQ FDSIALIIFIPIFE F YPFIRR+TP +P
Sbjct: 373 YWVQYGSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFVYPFIRRFTPIRP 432

Query: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLGHNTPNHVHVCWQIPAYVLISFSE 480
           ITKI  GF  G  AMTWAAVLQ F+Y  GP Y  PL  +TPN +HV WQIPAYVLI+FSE
Sbjct: 433 ITKITIGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLSCDTPNKIHVAWQIPAYVLIAFSE 492

Query: 481 IFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540
           IFASITGLEYAYSKAP +MKSF+MSIFLLTNAFGS +G ALS VTVDPKF WLF GLAV+
Sbjct: 493 IFASITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDPKFVWLFGGLAVS 552

Query: 541 CFISGCLFWLCFRKYNDT 558
           C ++G LFWLCFR  N T
Sbjct: 553 CGVTGILFWLCFRGLNAT 570

>CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093w PTR2
          Length = 597

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/562 (72%), Positives = 471/562 (83%), Gaps = 8/562 (1%)

Query: 1   MLNHLSQGSDDIQD-EKQGEFPVVEEEKNQTV-TLKDS---YVSDDAANSTERFNLSPSP 55
           MLN  S+ +D+    E Q +   +++  ++ V  ++D    ++  D +N+   F L    
Sbjct: 1   MLNRFSKRNDEKNAVEVQKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALG--- 57

Query: 56  EDNEFEAPTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTP 115
           ED++FEAPT+EEL++LRHV G IP+RCWLIAIVELSERFSYYGLSAPFQNYM+ GPND P
Sbjct: 58  EDDDFEAPTEEELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNP 117

Query: 116 KGMLSLNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFIT 175
           KG+L L S GATGLSYFFQFWCYVTPVFGG+++DT+WGKYNTIC GT IY+ GIFILFIT
Sbjct: 118 KGLLGLKSQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFIT 177

Query: 176 SIPSVGNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIED 235
           SIP V N D ALGGFIA+IILIGIATGMIK+NLSVLIADQLP +KP + + K GERVIED
Sbjct: 178 SIPGVTNSDGALGGFIAAIILIGIATGMIKSNLSVLIADQLPNKKPRVVITKKGERVIED 237

Query: 236 GNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQY 295
            N+TLQNVFMFFYF INVGSLS+MATTELEYHKGFWAAYLLPFCFFWVAV  LVFG+ QY
Sbjct: 238 PNLTLQNVFMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQY 297

Query: 296 IQRPIGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVF 355
           I+ P+GDKVI+KSFKV +IL+KNKF+  AAKPS +P+K++PW+DKFVDEIKRAL ACKVF
Sbjct: 298 IKPPVGDKVISKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVF 357

Query: 356 VFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRY 415
           VFYP+YW  YGTM+++F+TQ   MELH +PNDFLQAFDSIALIIFIPIFE+F YPFIRRY
Sbjct: 358 VFYPVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRY 417

Query: 416 TPFKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLGHNTPNHVHVCWQIPAYVL 475
           TP +PITKIFFGFM GS AM WAAVLQ F+Y  GPWY  PL H+TPNH+HV WQIPAYVL
Sbjct: 418 TPLRPITKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVL 477

Query: 476 ISFSEIFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFT 535
           I+ SEIFASITGLEYAYSKAP +MKSFIMSIFLLTNAFGSAIGCALSPV+VDPKF W +T
Sbjct: 478 IAISEIFASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYT 537

Query: 536 GLAVACFISGCLFWLCFRKYND 557
           GLA ACFI+G +FW  +   ND
Sbjct: 538 GLACACFIAGWVFWFIYSGLND 559

>Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}
           complement(82303..84135) [1833 nt, 611 aa]
          Length = 610

 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/607 (64%), Positives = 481/607 (79%), Gaps = 20/607 (3%)

Query: 9   SDDIQDEKQGEF------PVVEEEKNQTVTLKDSYVSDDAANSTERFNLSPSPEDN---- 58
           SD +     GE         ++ +++  V +   + S    NS ++  ++   +D+    
Sbjct: 2   SDSLTRRTSGELEDDSFASHIDSKQDHEVKIVSKFDSTSLQNS-DQLEITKVGDDDIEYD 60

Query: 59  ---EFEAPTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTP 115
              +F  PT+EE+++L+HV GKIPMRCWLIA+VELSERFSYYGL+APFQNYM  GPNDTP
Sbjct: 61  DNQDFVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTP 120

Query: 116 KGMLSLNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFIT 175
           KG+L L++ GA+ LSYFFQFWCY+TP+FGGY+ADT+WGKYNTIC GT IY+ GIF+LFIT
Sbjct: 121 KGVLMLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFIT 180

Query: 176 SIPSVGNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIED 235
           S+PS+  R++ALGG++ +IILIGIATGMIKAN+SVLIA+Q+P+ KP +   K G+RVIED
Sbjct: 181 SLPSIDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIED 240

Query: 236 GNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQY 295
            NIT QNVFMFFY MINVGSLSLMATTELE HKGFWAAYLLPFCFFW+AVV LV G+ QY
Sbjct: 241 PNITTQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQY 300

Query: 296 IQRPIGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVF 355
           I  P+GDK+I+KSFKV WIL KNK +F+AAKPS++PEK+YPWNDKFV+EI+RAL ACKVF
Sbjct: 301 IMVPVGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVF 360

Query: 356 VFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRY 415
           VFYPIYW  YG MI++F+TQA  MELH +PNDFLQAFDSIA+I+FIPIFE+F YPF+RR+
Sbjct: 361 VFYPIYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRF 420

Query: 416 TPFKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLG-----HNTPNHVHVCWQI 470
           TPF+PITKIF+GFMFGS AM WAAVLQSF+YKAGP Y+ P+       NTPN VHV WQ+
Sbjct: 421 TPFRPITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQV 480

Query: 471 PAYVLISFSEIFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKF 530
           PAYVLI+ SEI AS+TGLEYAYS APA+MKSFIMSIFL+TNAFGSAIG A+SP   DPK+
Sbjct: 481 PAYVLIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKY 540

Query: 531 TWLFTGLAVACFISGCLFWLCFRKYNDTXXXXXXXXXXXXXXFDLNPISQPKANDIEILE 590
           TW FTGLAVACFI+GCLFW+CFR YN+T                + P +  K + IE++E
Sbjct: 541 TWTFTGLAVACFIAGCLFWICFRSYNNTEDAMNDIDFMDDDDDKIMPTAGEKTS-IEVME 599

Query: 591 PMGSLKS 597
           P+ S +S
Sbjct: 600 PITSFRS 606

>NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {ON}
           Anc_5.698
          Length = 611

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/588 (67%), Positives = 475/588 (80%), Gaps = 4/588 (0%)

Query: 3   NHLSQGSDDIQDEKQGEFPVVEEEKNQTVTLKDSY-VSDDAANSTERFNLSPSPE-DNEF 60
            H   G+D + +++  +     +EK Q +TLK++   S++  +  E +++    E +  +
Sbjct: 6   EHEKDGADVVTEKETVDISEKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEECEPGY 65

Query: 61  EAPTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLS 120
           E PT+E++ +LRHV GKIP+RCWLIA+VEL+ERFSYYGLSAPFQNYME GPNDTP G+L 
Sbjct: 66  EIPTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLE 125

Query: 121 LNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180
           LNSSGATGLSYFFQFWCYVTPVFGG++ADT+WGKYNTIC GT IY+AGIFILFITSIPS+
Sbjct: 126 LNSSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSI 185

Query: 181 GNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITL 240
            ++D++LGGFIA+IILIGIATGMIKANLSVLIADQLPKRKP +K LKSGERV+ED NITL
Sbjct: 186 ASKDTSLGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITL 245

Query: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPI 300
           QNVFM+FY M+NVGSLS++ATTELE HK FWAA+LLPFCFFW+AVV LV G+ QY++   
Sbjct: 246 QNVFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGK 305

Query: 301 GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPI 360
            +K I KSFK+ WI++KNKFD  +AKPS HPEK+YPW DKFVDE  RAL+ACKVF+FYPI
Sbjct: 306 REKSIQKSFKILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPI 365

Query: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKP 420
           YW  YGTMIS+F+TQ SMMELHG+PND  QA DS ALIIFIPI E+F YPFIRR+TPFKP
Sbjct: 366 YWVIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKP 425

Query: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLGHNTPNHVHVCWQIPAYVLISFSE 480
           ITKIFFGFMF + AM W+ VLQSF+YKAGP+Y  PL    PN +HV WQ+PAYVLI+FSE
Sbjct: 426 ITKIFFGFMFATGAMVWSCVLQSFIYKAGPYYDHPLNGGGPNRIHVGWQVPAYVLIAFSE 485

Query: 481 IFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540
           I ASITGLEYAYSKAP +MKSFIMS+FL +NA GS +G ALSPV+VDPKFTWLF GL VA
Sbjct: 486 ILASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVA 545

Query: 541 CFISGCLFWLCFRKYNDTXXXXXXXXXXXXXXFDLNPISQPKANDIEI 588
           CFI GC+FW+ FRKYNDT               DL  +    AND+E+
Sbjct: 546 CFIGGCIFWIIFRKYNDTEEEMNAMDYEDEE--DLREMESAGANDLEL 591

>ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {ON}
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 613

 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/535 (71%), Positives = 440/535 (82%), Gaps = 5/535 (0%)

Query: 26  EKNQTVTLKDSY-VSDDAANSTERFNLSPSPEDNEFEAPTDEELRSLRHVGGKIPMRCWL 84
           EKN+ +    S  VS         F+    P D+E   PT+EELRSLRHVGG IP RCWL
Sbjct: 12  EKNKVIIEDKSLEVSGSHERGELDFDEYEVPNDDE---PTEEELRSLRHVGGHIPFRCWL 68

Query: 85  IAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLSLNSSGATGLSYFFQFWCYVTPVFG 144
           IAIVELSERFSYYGLSAPFQNYM+ G +D P G+L L S GATGL+YFFQFWCYVTPVFG
Sbjct: 69  IAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPVFG 128

Query: 145 GYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSALGGFIASIILIGIATGMI 204
           G++ADT+WGKY TIC GT +Y+ GIFILFITS+PSV ++++ALGGFI +I+LIGIATGMI
Sbjct: 129 GWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVLIGIATGMI 188

Query: 205 KANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQNVFMFFYFMINVGSLSLMATTEL 264
           KANLSVLIADQ PKRKP IK  K GERVIED NIT+QNVFMFFY MIN+GSLS++ATTEL
Sbjct: 189 KANLSVLIADQFPKRKPRIKTTKRGERVIEDPNITIQNVFMFFYLMINIGSLSVIATTEL 248

Query: 265 EYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPIGDKVIAKSFKVCWILTKNKFDFNA 324
           E HKGFWAAYLLPFCFFW+AV+ L  G+K Y++ P+GDKVIAKSF+V   L K++FD+ A
Sbjct: 249 EEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLIKHRFDYEA 308

Query: 325 AKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELHGI 384
            KPSVHPE+DYPWND FV+EIKRAL ACKVF+FYPIYW  YG M S+F++    M+LHG+
Sbjct: 309 VKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLHGL 368

Query: 385 PNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQSF 444
           PNDF QA DSIALI+FIPI E + YPFIRRYTPFKPITKIFFGFM+ S +M WAAVLQ F
Sbjct: 369 PNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMIWAAVLQHF 428

Query: 445 VYKAGPWYSEPLG-HNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPANMKSFI 503
           +YK GP Y  P+   N PN++H+ WQ+PAYVLI+FSEIFASITGLEYAYSKAP +MKSFI
Sbjct: 429 IYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKAPTSMKSFI 488

Query: 504 MSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDT 558
           MSIFLLTNAFGSAIGCALSPV  DPK+ W+FTGLAVA FISGCLFWL F   NDT
Sbjct: 489 MSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHLNDT 543

>TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {ON}
           
          Length = 591

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/502 (73%), Positives = 438/502 (87%), Gaps = 5/502 (0%)

Query: 62  APTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLSL 121
           APT+EEL++LRHV G IP+RCWLIAIVEL+ERFSYYGLSAPFQNYM  GPNDTPKG+L L
Sbjct: 56  APTEEELKTLRHVSGYIPLRCWLIAIVELAERFSYYGLSAPFQNYMANGPNDTPKGLLQL 115

Query: 122 NSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSVG 181
           NSSGAT +SYFFQFWCYVTP+FGGY+ADT WGKYNTIC GT IY++GIFILF+TSI S+ 
Sbjct: 116 NSSGATAISYFFQFWCYVTPIFGGYMADTHWGKYNTICTGTGIYVSGIFILFMTSIESIT 175

Query: 182 NRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQ 241
            +++A GG+IA+IILIGIATGMIK+N+SVLIA+Q+PKRK  +     GERVIED  +T+Q
Sbjct: 176 TQNAARGGYIAAIILIGIATGMIKSNISVLIAEQVPKRKIRVITTSKGERVIEDPKLTVQ 235

Query: 242 NVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPIG 301
           N+FMFFY MIN+GSLS++ATTELE HKGFWAAYLLPFCFFW+AVV L+ GKKQY+++P+G
Sbjct: 236 NIFMFFYLMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWIAVVVLIVGKKQYVRKPVG 295

Query: 302 DKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPIY 361
           DKVI+K F + WI  KNK DF++AKPS HPE +YPW DKFV+E++RA+ ACKVF+FYPIY
Sbjct: 296 DKVISKCFTITWIAFKNKLDFDSAKPSCHPEANYPWTDKFVEEVRRAIRACKVFLFYPIY 355

Query: 362 WTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKPI 421
           W  YG M+++F+TQA  MELHG+PNDFLQA DSIA+I+FIPI EKF YPFIR++TPF+ I
Sbjct: 356 WCVYGQMLNNFVTQAGTMELHGLPNDFLQAIDSIAIIVFIPICEKFLYPFIRKFTPFRSI 415

Query: 422 TKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLG-----HNTPNHVHVCWQIPAYVLI 476
           TKIF+GFMFGS AM WAAVLQSF+YKAGP + +PL       +TPN VH+ WQ+PAYVLI
Sbjct: 416 TKIFWGFMFGSAAMIWAAVLQSFIYKAGPCFDKPLACAAQYAHTPNQVHIAWQVPAYVLI 475

Query: 477 SFSEIFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTG 536
           +FSEIFASITGLEYAYS AP +MKSFIMSIFLLT AFGSA+G A+SP +VDPKFTW FTG
Sbjct: 476 AFSEIFASITGLEYAYSNAPESMKSFIMSIFLLTTAFGSALGIAISPTSVDPKFTWAFTG 535

Query: 537 LAVACFISGCLFWLCFRKYNDT 558
           LAV+CFI+GCLFW+CFRKYN+T
Sbjct: 536 LAVSCFIAGCLFWICFRKYNNT 557

>KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}
           Anc_5.698 YKR093W
          Length = 591

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/535 (68%), Positives = 440/535 (82%), Gaps = 4/535 (0%)

Query: 25  EEKNQTVTLKDSYVSDDAANSTERFNLSPSPEDNE---FEAPTDEELRSLRHVGGKIPMR 81
           E KN  V+  D    D  A + +  ++ P  ED +   +E PT +E+++LR VGG+IP R
Sbjct: 24  ELKNTKVSSSDGEHKDTEAYTLQDGSIEPDHEDYQEEGYEIPTQDEMKTLRRVGGRIPFR 83

Query: 82  CWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLSLNSSGATGLSYFFQFWCYVTP 141
           C+L+A+VEL+ERFSYYGLSAPFQNYM+ GP D+P G+L LNSSGATGLSYFFQFWCY+TP
Sbjct: 84  CFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGATGLSYFFQFWCYITP 143

Query: 142 VFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSALGGFIASIILIGIAT 201
           +FGGY+ADT WG+YNTI  GT IYI GIFILFITS  +V  RD AL GFI ++ILIG AT
Sbjct: 144 IFGGYLADTKWGRYNTIGVGTVIYIIGIFILFITSFKTVAGRDGALAGFILALILIGFAT 203

Query: 202 GMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQNVFMFFYFMINVGSLSLMAT 261
           G+IK+NLSVLIADQ+P ++P +K LKSGERVIED ++T+QNVFMFFY MIN+GSLS++AT
Sbjct: 204 GLIKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINIGSLSVIAT 263

Query: 262 TELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPIGDKVIAKSFKVCWILTKNKFD 321
           TELE + GFWAAYLLPFCFFW+AV+ +V GK+QYI +P GD+VIAKSFKVCWIL KNKFD
Sbjct: 264 TELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKSFKVCWILCKNKFD 323

Query: 322 FNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMEL 381
             +AKPS HPE ++PW DKFVDEI+RALAACKVF+FYPIYWT YG M+++FIT  SMM+L
Sbjct: 324 ITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQMVNNFITMGSMMQL 383

Query: 382 HGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVL 441
           HG+PND  QA +SI+LIIFIPI EKF YPFIRR+TP +P+T+IF GF+F + AM W+ VL
Sbjct: 384 HGLPNDIFQAINSISLIIFIPICEKFLYPFIRRFTPLRPVTRIFCGFIFAAMAMVWSCVL 443

Query: 442 QSFVYKAGPWYSEPLGHNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPANMKS 501
           Q F+Y  GP Y+ PL     N +HV WQ+PAYV I+FSEIFASITGLEYAYSKAPANMKS
Sbjct: 444 QHFIYSTGPNYNRPLELGA-NDIHVGWQVPAYVFIAFSEIFASITGLEYAYSKAPANMKS 502

Query: 502 FIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYN 556
           FIM++FL  NAFGSAIGCALSPV+ DP +TWL+  LAVACF+SG +FWLCFRKYN
Sbjct: 503 FIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLIFWLCFRKYN 557

>TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {ON}
           
          Length = 620

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/561 (65%), Positives = 449/561 (80%), Gaps = 14/561 (2%)

Query: 3   NHLSQGSDDIQDEKQGEFPVVEEEKNQTVTLK-DSYVSDDAANSTERFNLSPSPEDNEFE 61
           + +  G  ++       F + ++ +N T   + D +  DD A+        P  ++  + 
Sbjct: 23  DAIYSGEKELDSSHDVTFNIDDKVENDTNEEELDEFAVDDEAD--------PYNDEWGYV 74

Query: 62  APTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLSL 121
            PT+EE+ +L+HV G IP RCWLIA+VELSERFSYYGLSAPFQNYM  GPNDTPKG+L L
Sbjct: 75  EPTEEEMATLKHVAGHIPYRCWLIAVVELSERFSYYGLSAPFQNYMANGPNDTPKGILQL 134

Query: 122 NSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSVG 181
           N++GATGLSYFFQFWCY+TP+FGGY+ADT+W KYNTI  GT IYI GIFILFIT+IPS+ 
Sbjct: 135 NTNGATGLSYFFQFWCYITPIFGGYMADTYWNKYNTIAVGTVIYIIGIFILFITAIPSIA 194

Query: 182 NRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQ 241
            +++A GGF+ +IILIGI TGMIKANLSVL+A+Q+PKRK  +   K GERVIED +IT+Q
Sbjct: 195 TKETATGGFVTAIILIGIGTGMIKANLSVLVAEQIPKRKHRVITTKKGERVIEDPDITMQ 254

Query: 242 NVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPIG 301
           NVFMFFY MIN+G+LS++ATTELE HKGFWAAYLLPFCFFW+AVV LV G+  YI +P+G
Sbjct: 255 NVFMFFYLMINIGALSVLATTELESHKGFWAAYLLPFCFFWIAVVILVMGRNSYIIKPVG 314

Query: 302 DKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPIY 361
           DKVI+K FKV +I+ KNKF+F++AKPS++PE  YPW+DKFVDEI R++ ACKVF+FYPIY
Sbjct: 315 DKVISKCFKVTFIVCKNKFNFDSAKPSLNPEMQYPWSDKFVDEINRSIKACKVFIFYPIY 374

Query: 362 WTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKPI 421
           W  YG MI++FITQA  MELH IPNDFLQ FDSI +I+FIPIFE+F YP IRR+TP KPI
Sbjct: 375 WCVYGQMINNFITQAGTMELHNIPNDFLQVFDSIGIIVFIPIFERFVYPTIRRFTPLKPI 434

Query: 422 TKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLG-----HNTPNHVHVCWQIPAYVLI 476
           TKIF GFM GS AM WAAVLQSF+YKAGP Y  P+       N PN VHV WQIPAYV+I
Sbjct: 435 TKIFLGFMCGSCAMVWAAVLQSFIYKAGPCYDHPMACGPEYTNIPNRVHVAWQIPAYVII 494

Query: 477 SFSEIFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTG 536
           ++SEIFAS+TGLE+AYS AP +MK+FIMSIFL TNA G+A+G A+SP +VDPK+TW+FTG
Sbjct: 495 AWSEIFASVTGLEFAYSNAPDSMKAFIMSIFLFTNAIGAALGVAISPTSVDPKYTWVFTG 554

Query: 537 LAVACFISGCLFWLCFRKYND 557
           LAV+CF++GCLFW+CF  YND
Sbjct: 555 LAVSCFVAGCLFWICFHHYND 575

>SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32901 Saccharomyces cerevisiae YKR093W PTR2
           Functions in transport of small peptides into the cell
           Peptide transporter
          Length = 592

 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/555 (66%), Positives = 460/555 (82%), Gaps = 13/555 (2%)

Query: 11  DIQDEKQGEFPVVEEEKN--QTVTLKDSYVSDDAANSTERFNLSPSPEDNEFEAPTDEEL 68
           ++ ++ + E  V    +N  + +   +S+V  D  +  +  N     + +    PTDEE+
Sbjct: 6   NLWNKTETEVVVTSSPENSVEKIARPESFV--DVLDKNQYIN----ADSDHGREPTDEEM 59

Query: 69  RSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLSLNSSGATG 128
           ++LRHV  +IP+RCWL+A+VEL+ERFSYYGLSAPFQNYM+ GPNDTPKG+L+L + GAT 
Sbjct: 60  KTLRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATA 119

Query: 129 LSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSALG 188
           LSYFFQFWCYV+P+ GG++ADT+WGKY TIC GT IY+ GIFILFITS+PS+    ++LG
Sbjct: 120 LSYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLG 179

Query: 189 GFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQNVFMFFY 248
           GFI S+ILIG+ATGMIKAN+SVLIADQ+PK +P +KVLKSGERVIED NIT+QN+FMFFY
Sbjct: 180 GFITSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFY 239

Query: 249 FMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPIGDKVIAKS 308
            MIN+GSLS++ATTE+E H GFWAAYLLPFCFF+VAV  L+ G+ QY++ P+GDKVI+KS
Sbjct: 240 LMINIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKS 299

Query: 309 FKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTM 368
           FKVCWI+ +NKF F+AA+PS++PE  YPW+DKF+DEIKRA+AACKVFVFYPIYW  YG M
Sbjct: 300 FKVCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQM 359

Query: 369 ISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKPITKIFFGF 428
           +S+F++QA MMELHG+PNDFLQA DSIALI+FIPI E+F YPFIRR+TPF+PITKIF+GF
Sbjct: 360 LSNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGF 419

Query: 429 MFGSFAMTWAAVLQSFVYKAGPWYSEPLG-----HNTPNHVHVCWQIPAYVLISFSEIFA 483
           +FG+ AM WAAVLQ F+YKAGP Y  P+       NTPN +H+ WQ+PAYVLI+FSEIFA
Sbjct: 420 IFGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFA 479

Query: 484 SITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFI 543
           SITGLEYAYSKAP +M+SFIMSIFLLT AFGSA+G ALS V+V+PKF W F+GLAV+CFI
Sbjct: 480 SITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFI 539

Query: 544 SGCLFWLCFRKYNDT 558
           +GCLFW  F KYNDT
Sbjct: 540 AGCLFWAFFHKYNDT 554

>TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa]
           {ON} Anc_5.698 YKR093W
          Length = 633

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/534 (67%), Positives = 442/534 (82%), Gaps = 5/534 (0%)

Query: 68  LRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLSLNSSGAT 127
           LR+L+HVGGKIP+RCWL+A++EL+ERFSYYGLSAPFQNYM+ GPND+P G LSL+SSGAT
Sbjct: 88  LRTLKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGAT 147

Query: 128 GLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSAL 187
           GLSYFFQFWCY+TPVF GY+ADT+WGK+ TIC GT IYI GIFILFITS+PS+ + ++A+
Sbjct: 148 GLSYFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAM 207

Query: 188 GGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQNVFMFF 247
           GGFI ++IL+GIATGMIKANLSV+IA+Q+PKRK  +   K+G RVIED +IT+QNVFM F
Sbjct: 208 GGFIVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTF 267

Query: 248 YFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPIGDKVIAK 307
           YFMIN+GSLS++ATTELE HKGFWAAYLLPFCFFWVAV+ L+ G K YI+ P+GDKVI+K
Sbjct: 268 YFMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISK 327

Query: 308 SFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGT 367
            FKV  IL +N+F+ ++AKP+ +P+K+YPW+DKFVDEI RAL ACKVFVFYPIYW  YG 
Sbjct: 328 CFKVLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQ 387

Query: 368 MISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKPITKIFFG 427
           M+++F++Q   MELHG+PNDF QA DSIALI+FIPI E+F YPFIR+YTPFKPITKIF+G
Sbjct: 388 MLNNFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWG 447

Query: 428 FMFGSFAMTWAAVLQSFVYKAGPWYSEPLG-HNTPNHVHVCWQIPAYVLISFSEIFASIT 486
           F FG+ +MTWA VLQ F+YKA P Y  P    N PNH+HV  Q+PAY L++ SEIFASIT
Sbjct: 448 FTFGALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASIT 507

Query: 487 GLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGC 546
           GLEYAYSKAPA+MK+FIMSIFL+TNAFG+AIGCALSPV+ DPK+ WL+ GLAVACF+ GC
Sbjct: 508 GLEYAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGC 567

Query: 547 LFWLCFRKYNDTXXXXXXXXXXXXXXFDLNPISQPKANDIEILEPMGSLKSTTK 600
           LFW+ F+KYND                  + +    A DIE+++P+ S +S+ K
Sbjct: 568 LFWIIFKKYNDMEEELNNLDFEEGD----DMLETKHAGDIEMIQPISSRRSSLK 617

>KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON} 
          Length = 596

 Score =  769 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/598 (61%), Positives = 449/598 (75%), Gaps = 16/598 (2%)

Query: 9   SDDIQDEKQGEFPVVEEEKNQTVTLKDSYVSDDAANSTERFNLS---------PSPEDNE 59
           S     E+  +  V+ +EKN     K +  S+D    TE + L          P  ++  
Sbjct: 2   SSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEG 61

Query: 60  FEAPTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGML 119
           +E PT+EELR+LRHV G+IP RC+LIA+VELSERFSYYGLSAPFQNYM   P+D+P G+L
Sbjct: 62  YEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVL 121

Query: 120 SLNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPS 179
            LNS GATGLSYFFQFWCY+TPV GGY+ADT WG+YNTI  GT IYI GIF+LFITS  S
Sbjct: 122 QLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKS 181

Query: 180 VGNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNIT 239
           +  ++ ALGGFI ++ILIGI TG IKANLSVLIADQ+P ++P +K LKSGERVIED +IT
Sbjct: 182 IAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDIT 241

Query: 240 LQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRP 299
           +QNVFMFFY MIN+GSLS++ATTELE H GFWAAYLLPFCFFW+AV+ LV G++ Y  +P
Sbjct: 242 IQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKP 301

Query: 300 IGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYP 359
             D+VI KSFK CW LTKNKF+++A  P+ +PE  + W+DKFV+EI+ ALAACKVF+FYP
Sbjct: 302 TSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYP 361

Query: 360 IYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFK 419
           IYWT YG M ++F+T  SM++LHG+PND  QA DSIALI+FIPI EKF YPFIRR+TPF+
Sbjct: 362 IYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFR 421

Query: 420 PITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLGHNTPNHVHVCWQIPAYVLISFS 479
           PITKI +GF   S +M WA VLQ F+YK GP Y  PL  + PN+VHV WQ+PAYVLI+FS
Sbjct: 422 PITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPLA-DGPNNVHVAWQVPAYVLIAFS 480

Query: 480 EIFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAV 539
           EIFASITGLEYAYSKAPA+MKSFIM++FL  NAFGSAIGCALSPV+ DP +TWL+ GLAV
Sbjct: 481 EIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAV 540

Query: 540 ACFISGCLFWLCFRKYNDTXXXXXXXXXXXXXXFDLNPISQPKANDIEILEPMGSLKS 597
             FI+GC FW CFR YND               ++   I      DIE++ P+ +  S
Sbjct: 541 TAFITGCAFWFCFRHYNDI------EDEMNALNYEDEDIITENNQDIEMVHPLSAYTS 592

>KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 654

 Score =  764 bits (1974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/565 (66%), Positives = 449/565 (79%), Gaps = 15/565 (2%)

Query: 2   LNHLSQGSDDIQDEKQGEFPVVEEEKNQTVTLKDSYVSDDAANSTERFNL--SPSPEDNE 59
           LN  S  S D  DE  GE    ++EK +  T    Y+S D   S+++ +   +   +DN+
Sbjct: 36  LNVDSTVSSD--DEFTGE---KKDEKFKNNTDIKVYISKDHHASSDKIDFIGAVDEDDNQ 90

Query: 60  FE---APTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPK 116
            E    PT+EEL +LRHV  +IP  CWLIAIVEL+ERFSYYGLSAPFQNYM+ GPNDTPK
Sbjct: 91  NENGREPTEEELSTLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPK 150

Query: 117 GMLSLNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITS 176
           G+L L S GAT LSYFFQFWCYVTP+ GGY+ADTFWGKYNTIC G + Y+ GI ILF+T+
Sbjct: 151 GVLQLKSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTA 210

Query: 177 IPSVGNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDG 236
           IPS+ +++S+LGGFI S+I+IGI TG IKANLSVLIADQ+PK +P IKVLK+GE+VIED 
Sbjct: 211 IPSINDKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDP 270

Query: 237 NITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYI 296
           N+T+QNVFMFFY MIN+GSLS+MATT LE   GFWAAYLL FCFFWV +V LVFG+K+Y+
Sbjct: 271 NVTMQNVFMFFYLMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYV 330

Query: 297 QRPIGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFV 356
           +RPIGD VIA+ FK+CWI   N F+ N A PS++PEK+YPWND F+DEI+RA  ACKVF 
Sbjct: 331 RRPIGDHVIARCFKICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFA 390

Query: 357 FYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYT 416
           FYPIYW  YG M+++F+TQA  MELHG+PNDFLQA +SIALI+FIPI E+F YPFIRR+T
Sbjct: 391 FYPIYWVVYGQMLNNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFT 450

Query: 417 PFKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLG-----HNTPNHVHVCWQIP 471
           PF+P+TKIF GF FGS AM +AAVLQ F+YKAGP Y  P+       NTPN VH+ WQ+P
Sbjct: 451 PFRPVTKIFIGFCFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVP 510

Query: 472 AYVLISFSEIFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFT 531
           AYVLIS SEIFASITGLEYAYSKAPA MK+FIMSIFL+TNA GSA+G ALSP   +PK+ 
Sbjct: 511 AYVLISLSEIFASITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYV 570

Query: 532 WLFTGLAVACFISGCLFWLCFRKYN 556
           W F+GLAVACFI+GCLFWLCF  YN
Sbjct: 571 WTFSGLAVACFIAGCLFWLCFHHYN 595

>Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093W
           (REAL)
          Length = 399

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/399 (90%), Positives = 372/399 (93%)

Query: 203 MIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQNVFMFFYFMINVGSLSLMATT 262
           MIKANLSVLIADQLPKRKP IKVLKSGERV+ D NITLQNVFMFFYFMINVGSLSLMATT
Sbjct: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60

Query: 263 ELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPIGDKVIAKSFKVCWILTKNKFDF 322
           ELEYHKGFWAAYLLPFCFFW+AVVTL+ GKKQYIQRPIGDKVIAKSF+VCWIL KNKFDF
Sbjct: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120

Query: 323 NAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELH 382
           NAAKPS+HPE+DYPWNDKFVDEIKRALAACKVF+FYPIYWTQYGTMISSFITQASMMELH
Sbjct: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180

Query: 383 GIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 442
           GIPNDFLQAFDSIALIIFIPIFEKF YPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ
Sbjct: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240

Query: 443 SFVYKAGPWYSEPLGHNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPANMKSF 502
           SF+YKAGPWY EPLGHNTPN VHVCWQIPAYVLISFSEIFASITGLEYAYSKAPA+MKSF
Sbjct: 241 SFIYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSF 300

Query: 503 IMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDTXXXX 562
           IMSIFLLT AFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFW CFRKYNDT    
Sbjct: 301 IMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTEEEM 360

Query: 563 XXXXXXXXXXFDLNPISQPKANDIEILEPMGSLKSTTKY 601
                     FDLNPIS PKANDIEILEPM SL+ST KY
Sbjct: 361 NAMDYEEEDEFDLNPISAPKANDIEILEPMESLRSTAKY 399

>TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {ON}
           Anc_5.698 YKR093W
          Length = 574

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/533 (66%), Positives = 434/533 (81%), Gaps = 6/533 (1%)

Query: 26  EKNQTVTLKDSYVSDDAANSTERFNLSPSPEDNEFEAPTDEELRSLRHVGGKIPMRCWLI 85
           EK + V + D  + +  ++      L     D+E   PT+EE+++L+HV G IP RCWLI
Sbjct: 16  EKQKAVEVVDDKLVEVISSHN---GLEVESYDDE---PTEEEMKTLKHVAGTIPFRCWLI 69

Query: 86  AIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLSLNSSGATGLSYFFQFWCYVTPVFGG 145
           A+VELSERF+YYGLS PFQNYM+ GP+DTP G+L+L S GATGLSYFFQFWCYVTP+FGG
Sbjct: 70  AVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQFWCYVTPIFGG 129

Query: 146 YIADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSALGGFIASIILIGIATGMIK 205
           +++DT+ GKYNTIC GT +Y+ GI ILF+TSIPS+  +++A GGFIA+IILIGIATGMIK
Sbjct: 130 WLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNAATGGFIAAIILIGIATGMIK 189

Query: 206 ANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQNVFMFFYFMINVGSLSLMATTELE 265
           +N+SVLIADQ PK++  +   K G RVIED NITLQNVFM FY MIN+GSLS++ATTELE
Sbjct: 190 SNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSLSVIATTELE 249

Query: 266 YHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPIGDKVIAKSFKVCWILTKNKFDFNAA 325
            H GFWAAYLLPFCFFW+AV+ L  GK  Y++ P+GDKVI+K FKV  I  KNKF+F AA
Sbjct: 250 AHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAIKNKFNFEAA 309

Query: 326 KPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELHGIP 385
           KPSV P++ +PW DKFVDEI R+L+ACKVF+FYP+YW  YG M+++F++    MELHG+P
Sbjct: 310 KPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVGGTMELHGLP 369

Query: 386 NDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQSFV 445
           NDF QA DSIALI+FIPI E F YP+IR++TPF+PITKIF+GFMFG+ AM WAAVLQ F+
Sbjct: 370 NDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMVWAAVLQHFI 429

Query: 446 YKAGPWYSEPLGHNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPANMKSFIMS 505
           YK+GPWY  P+  NTPNH+H+ WQ+PAYVLI+FSEIFASITGLEYAYSKAP  MKSFIM+
Sbjct: 430 YKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPVTMKSFIMA 489

Query: 506 IFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDT 558
           IFLLTNAFGSAIGCALSPVT DP + WL+ GL VACF +G LFW CF+ YNDT
Sbjct: 490 IFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYNDT 542

>TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/548 (65%), Positives = 433/548 (79%), Gaps = 6/548 (1%)

Query: 11  DIQDEKQGEFPVVEEEKNQTVTLKDSYVSDDAANSTERFNLSPSPEDNEFEAPTDEELRS 70
           D +D+K   F + E+E N       S + +  +N       +   +D +F  PT+EE+R+
Sbjct: 24  DNKDDKNYNF-ITEDEPNSIA----STIIEGNSNEENYNRSTDDDDDEDFIEPTEEEMRT 78

Query: 71  LRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLSLNSSGATGLS 130
           L+ VGG IP RCWL+A++ELSERFSYYGLSAPFQNYM+ GP DTP G LSLN+ GATGLS
Sbjct: 79  LKRVGGYIPARCWLMAVIELSERFSYYGLSAPFQNYMQNGPYDTPPGALSLNTQGATGLS 138

Query: 131 YFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSALGGF 190
           YFFQFWCY+TP+FGGY+ADT+WGKYNTI  G   YI GIFILF+TS+P + +  +A+GGF
Sbjct: 139 YFFQFWCYITPIFGGYMADTYWGKYNTIWVGVISYICGIFILFMTSLPKLTSYSAAMGGF 198

Query: 191 IASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQNVFMFFYFM 250
           I SII+IG+ TGMIKANLSV+IA+Q+PKRK  I   K G RVIED +ITLQNVFM FYFM
Sbjct: 199 IVSIIIIGLGTGMIKANLSVMIAEQVPKRKRRIITRKDGTRVIEDPDITLQNVFMAFYFM 258

Query: 251 INVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPIGDKVIAKSFK 310
           INVGSLS+MATTELE  KGFWAAYLLPFCFFWVAVV L+ G K++I+ PIGDK I+KSFK
Sbjct: 259 INVGSLSVMATTELEARKGFWAAYLLPFCFFWVAVVVLMIGNKRFIKVPIGDKTISKSFK 318

Query: 311 VCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMIS 370
           V  IL KNKF++ +AKPS+HPE +YPW DKFV+EI+RA+ AC VF FYPIYW  YG M++
Sbjct: 319 VVGILIKNKFNYESAKPSIHPECNYPWTDKFVEEIRRAIKACNVFYFYPIYWVCYGQMLN 378

Query: 371 SFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKPITKIFFGFMF 430
           +F+TQ   MELH +PNDFLQ  DSIALI+FIPI E+  YPF+RR+TP +PITKI  GF F
Sbjct: 379 NFVTQGGQMELHDLPNDFLQVIDSIALIVFIPICERLIYPFVRRFTPLRPITKITIGFFF 438

Query: 431 GSFAMTWAAVLQSFVYKAGPWYSEPLG-HNTPNHVHVCWQIPAYVLISFSEIFASITGLE 489
           GSF+M WAAVLQ FVY+  P Y  P    N PNH+HVCWQ+PAY LI+ SEIFASITGLE
Sbjct: 439 GSFSMVWAAVLQWFVYQKPPCYYHPTNCPNGPNHIHVCWQVPAYCLIALSEIFASITGLE 498

Query: 490 YAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFW 549
           YAYSKAPA+MKSFIMSIFL T A GSA+G ALSPV++DPKFTW + GLAV+CFI+G  FW
Sbjct: 499 YAYSKAPASMKSFIMSIFLFTTAIGSALGAALSPVSIDPKFTWQYVGLAVSCFIAGIAFW 558

Query: 550 LCFRKYND 557
           LCF +YND
Sbjct: 559 LCFSRYND 566

>TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/497 (69%), Positives = 417/497 (83%), Gaps = 2/497 (0%)

Query: 63  PTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLSLN 122
           PT+EEL++L    G IP  CWL+AI+EL+ERFSYYGLSAPFQNYM+  P+D P G LSLN
Sbjct: 67  PTEEELKTLPREAGHIPFNCWLLAIIELAERFSYYGLSAPFQNYMQNNPSDNPPGALSLN 126

Query: 123 SSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGN 182
           S+GATGLSYFFQFWCYVTP+F G++ADT+WGK+NT+C GT IYI GIFILFITS+P++ +
Sbjct: 127 STGATGLSYFFQFWCYVTPIFAGFMADTYWGKFNTLCIGTIIYIIGIFILFITSLPAITS 186

Query: 183 RDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRK-PFIKVLKSGERVIEDGNITLQ 241
            ++ALGGFI +IILIGIATGMIKANLSV+IADQLPK+K   +   KSG+RVIED  +T+Q
Sbjct: 187 YNTALGGFIVAIILIGIATGMIKANLSVMIADQLPKKKLRVVTKKKSGKRVIEDPQLTIQ 246

Query: 242 NVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPIG 301
           NVFM FYFMINVGSLS++ATTELE H GFWAAYLLPFCFFW+AV+ L FG ++++++PIG
Sbjct: 247 NVFMAFYFMINVGSLSVIATTELELHVGFWAAYLLPFCFFWIAVLVLAFGNRKFVKKPIG 306

Query: 302 DKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPIY 361
           D+VI+K F +  IL KN F+F  AKP+ +PEK+YPW+DKFVDEI+R+L ACKVF+FYPIY
Sbjct: 307 DRVISKCFTIIGILIKNNFNFQKAKPTYNPEKNYPWSDKFVDEIQRSLKACKVFLFYPIY 366

Query: 362 WTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKPI 421
           W  YG M+++F+TQ S M+LHG+PNDF QA +SIALI+FIPI EKF YPFIR++TP KPI
Sbjct: 367 WVCYGQMLNNFVTQGSTMQLHGLPNDFFQAINSIALIVFIPIVEKFVYPFIRKFTPLKPI 426

Query: 422 TKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLG-HNTPNHVHVCWQIPAYVLISFSE 480
           TK+  GF+FGS AM WAAVLQ F+Y+AGP Y  P+   N PNHVHV WQ+PAY LIS SE
Sbjct: 427 TKVTIGFVFGSLAMVWAAVLQHFIYQAGPCYDHPVKCPNGPNHVHVAWQVPAYCLISLSE 486

Query: 481 IFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540
           IFASITGLE AYSKAP +MKSFIMS+FL+TNAFG+AIGCALS V+ DPK+ WL+TGLAV 
Sbjct: 487 IFASITGLEIAYSKAPESMKSFIMSMFLVTNAFGAAIGCALSSVSEDPKYVWLYTGLAVT 546

Query: 541 CFISGCLFWLCFRKYND 557
           CF +G  FW  F+ YND
Sbjct: 547 CFCAGIAFWFTFKHYND 563

>Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093W
           (PTR2) - Peptide transporter [contig 219] FULL
          Length = 611

 Score =  239 bits (611), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 164/542 (30%), Positives = 260/542 (47%), Gaps = 43/542 (7%)

Query: 34  KDSYVSDDAANSTERFNLSPSPEDNEFEAPTDEELRSLRHVGGKIPMRCWLIAIVELSER 93
           K+ Y   +    +E F+     +   F  PT+ E   LR V G      + I ++E SER
Sbjct: 6   KNQYAVAEIDGHSEDFD---ELDTQTFPEPTERERSELRRVLGHPKWYVYFICLIEFSER 62

Query: 94  FSYYGLSAPFQNYME-------------YGPNDTPKGMLSLNSSGATGLSYFFQFWCYVT 140
            SYYG      N+++                ++   G L +    AT L+    F  Y  
Sbjct: 63  ASYYGTGDRLNNFIQKPLPAGGNGAGAPAPGSEATAGALGMGLQVATALNLLLTFLAYCF 122

Query: 141 PVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSV-GNRDSALGGFIASIILIGI 199
           P+  GY+AD +WG+   +  G  + I    +  I S+P V G+  +AL   I  II + I
Sbjct: 123 PLITGYVADRYWGRMRMLWIGVFVGIVSHVVFIIGSLPVVLGHGSAALAPCIIGIITLAI 182

Query: 200 ATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQNVFMFFYFMINVGSLSLM 259
           AT  +K  L   +  Q P     +K L SGERVI D + +LQ + M FY+ INVGS   +
Sbjct: 183 ATAFVKPILLPTLLSQYPHATDVVKTLPSGERVIIDRDASLQRMTMTFYWSINVGSFLSV 242

Query: 260 ATTELEYHKGFWAAYLLPFCFFWVA-VVTLVFGKKQYIQRPIGDKVIA---KSFKVC--- 312
           AT+      G+W A+L+P   F +   V LV  +    + P G  +IA   K  KVC   
Sbjct: 243 ATSYSARDVGYWLAFLIPLALFMIMPAVLLVLRRYIKDEPPSGRSLIADCLKVLKVCFER 302

Query: 313 --WILTKNKFDFNAAKPSVHP-------EKDYP--WNDKFVDEIKRALAACKVFVFYPIY 361
             W   +    ++ AKPS           K  P  + +  V + +  ++AC +F++Y IY
Sbjct: 303 NWWSRYRAGTFWDYAKPSNLRSLGRQGWRKSKPGFYPESLVQDARVTISACTIFLYYVIY 362

Query: 362 WTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYT-PFKP 420
               G + S   +Q + +   G+PND +  F+ + +I+F+PI ++  YP +R+    F+P
Sbjct: 363 NINDGGIGSIMNSQTASLTSKGVPNDLMSNFNPLCIIVFMPILDRVVYPLLRKLRWNFRP 422

Query: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGP---WYSEPLGHNTPNHVHVCWQIP-AYVLI 476
           + +IF GFM  + A    A++Q  +Y+  P   + +E     +P  +   W +   Y L 
Sbjct: 423 VFRIFAGFMVAALASAVGAIIQHAIYQTSPCGNYATECEKGVSPISM---WVVAIEYALT 479

Query: 477 SFSEIFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTG 536
            FSE  A  TG E A+ ++P +MK+F+M++FL  +A  +A+G  ++P  VDP     F  
Sbjct: 480 GFSECLAMTTGYEIAFERSPPHMKTFVMALFLFMSALSAALGEIVTPSLVDPHLVIPFGV 539

Query: 537 LA 538
           LA
Sbjct: 540 LA 541

>KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 626

 Score =  236 bits (601), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 166/566 (29%), Positives = 265/566 (46%), Gaps = 56/566 (9%)

Query: 26  EKNQTVTLKDSYVSDDAANSTERFNLSPSPEDNEFEAPTDEELRSLRHVGGKIPMRCWLI 85
           EK+Q   L+    S+  + +         PE      PT+ E  +LR V        + I
Sbjct: 11  EKSQVAVLETDTYSEGGSGTPLSL-----PE------PTEHERTTLRRVLEHPKWYVYFI 59

Query: 86  AIVELSERFSYYGLSAPFQNYME----------------YGPNDTPKGMLSLNSSGATGL 129
            ++E SER SYYG      N+++                   +    G L +    AT L
Sbjct: 60  CLIEFSERASYYGTGDRLNNFIQQPLPAGGNGAGAPAHGAAGDSATAGALGMGLQTATAL 119

Query: 130 SYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSV-GNRDSALG 188
           +    F  Y  P+  GYIAD +W +   +  G  + I    I  I ++P V GN  +AL 
Sbjct: 120 NLLLTFLAYCFPLVTGYIADRYWSRMRMLWIGVFVGIISHVIFIIGALPPVLGNGQAALA 179

Query: 189 GFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQNVFMFFY 248
             +  II + IAT  +K  L   +  Q P     ++ L SGERV+ D + +LQ + M FY
Sbjct: 180 PCVIGIITLAIATSFVKPVLLPTLLSQYPHETDVVRTLASGERVLVDRDASLQRMTMTFY 239

Query: 249 FMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVA-VVTLVFGKKQYIQRPIGDKVIA- 306
           + IN+GS   +AT+      G+W A+L+P   + +   V LV G+    + P G  ++A 
Sbjct: 240 WSINIGSFLSVATSYAARDIGYWLAFLIPLILYLIMPAVLLVLGRYLRDEPPSGRSMLAD 299

Query: 307 --KSFKVC----WILTKNKFDF-NAAKPS-VHPEKDYPWNDK---------FVDEIKRAL 349
             K  +VC    W       DF N A+PS +       W  K          V + +  L
Sbjct: 300 CCKVLRVCFERGWWRRYRSGDFWNYARPSRLRQAGRAGWRRKGAGGFYAESLVQDTRVTL 359

Query: 350 AACKVFVFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGY 409
           +A  +F++Y IY    G + S   +Q + +  +G+PND +  F+ + +I+F+P+ +   Y
Sbjct: 360 SASAIFLYYVIYNINDGGIGSIMNSQTASLTSNGVPNDLISNFNPLCIIVFMPVLDHVLY 419

Query: 410 PFIRRYT-PFKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGP---WYSEPLGHNTPNHVH 465
           P +R+    FKP+ +IF GFM  + A    A++Q+ +Y   P   + +E     +P  + 
Sbjct: 420 PVLRKMRWNFKPVYRIFCGFMIAALASAVGAIIQTVIYNTSPCGRYATECDKGVSPVSM- 478

Query: 466 VCWQIPA-YVLISFSEIFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPV 524
             W +   Y L   SE  A  TG E A+ ++PA+MKSF+M++FL T+A  +A+G  ++P 
Sbjct: 479 --WVVAVEYALTGLSECLAMTTGYEIAFERSPAHMKSFVMALFLFTSALSAALGEIVTPS 536

Query: 525 TVDPKFTWLFTGLA-VACFISGCLFW 549
            VDP     F  LA +  F++    W
Sbjct: 537 LVDPHLVIPFGVLAGLGAFMAFVFLW 562

>AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON}
           NOHBY725; No homolog in Saccharomyces cerevisiae
          Length = 599

 Score =  219 bits (557), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 156/521 (29%), Positives = 244/521 (46%), Gaps = 44/521 (8%)

Query: 69  RSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEY-----------GPNDTPKG 117
           + LRHV        ++I ++EL+ER SYYG      N+ +Y           GP+D   G
Sbjct: 44  KRLRHVVAAPKWTVYMICLIELAERASYYGTGDRLYNFFQYPLPQGGNGAGAGPDDQNPG 103

Query: 118 MLSLNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSI 177
            L      AT L+   +F  Y  P+  GY+AD + G+   +  G    +    I  I ++
Sbjct: 104 ALGRGLQVATSLNLVLKFTSYFFPLVTGYVADMYVGELKMLWLGIWTGVVSHVIFVIAAL 163

Query: 178 PSVGNRDS-ALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDG 236
           P+V   ++  +   +  ++ + + T  +K  L  ++  Q P     +K L +GERVI + 
Sbjct: 164 PAVIKHNNLCMALAVLGLLTLSLCTAFVKPVLLPMLLRQYPHETNVVKTLPTGERVILNR 223

Query: 237 NITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYI 296
           + +LQ + M FY+ INVGS   +AT       G+W ++L+P   F +    L+  K   +
Sbjct: 224 DASLQRMSMTFYWCINVGSFVSLATGYSAQRVGYWLSFLIPLVLFLIMPAILLTLKNVKV 283

Query: 297 QRPIGDKVIA---KSFKVC----WILTKNKFDF-NAAKPSV---------HPEKDYPWND 339
             P+G+ + A   K  KVC    W        F   AKPS             K+  + +
Sbjct: 284 TPPLGESLFAECLKVIKVCFEPGWFKRYRSGSFWRYAKPSNLRALGRTGWRRSKEGFYKE 343

Query: 340 KFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALII 399
             V++ +  LAAC +F++Y IY      + S    QA  M   G+PND +  F+ +A+II
Sbjct: 344 SLVEDTRITLAACVIFLYYVIYNMNDNQLSSIINNQAGSMTGEGVPNDVISNFNPLAIII 403

Query: 400 FIPIFEKFGYPFIRRYT-PFKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPW------Y 452
            +PI +    P +RR    FKP+ +IFFGFM    A    A++Q+ +Y   P        
Sbjct: 404 TMPIIDYGLNPLLRRLRINFKPVYRIFFGFMLAVLASVAGAIIQAAIYNTSPCGKHASTC 463

Query: 453 SEPLGHNTPNHVHVCWQIPA-YVLISFSEIFASITGLEYAYSKAPANMKSFIMSIFLLTN 511
           SE +   +P      W +   YVL   SE FA  TG E A+ ++P +MK+F+MS+FL+T 
Sbjct: 464 SETIRQVSPLSR---WLVGVEYVLSGVSECFAMPTGYEIAFERSPKDMKAFVMSLFLVTT 520

Query: 512 AFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCF 552
           A  S +    + +  DP     F   AV     G LF + F
Sbjct: 521 ALSSILTQIFNGIMTDPYLVIPFILFAVL----GTLFAILF 557

>Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar to
           Ashbya gossypii AGL365C
          Length = 613

 Score =  218 bits (555), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 163/562 (29%), Positives = 255/562 (45%), Gaps = 54/562 (9%)

Query: 40  DDAANSTERFNLSPSPEDNEFEAPTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGL 99
            +AA   E         D E   PT+EE R+LR +        +LI  +EL+ER SYYG 
Sbjct: 21  SNAATVQEAPQEVKERSDIEIGLPTEEEERTLRRIVVHPSWYVYLICFIELAERASYYGT 80

Query: 100 SAPFQNYMEY----GPN---------DTPKGMLSLNSSGATGLSYFFQFWCYVTPVFGGY 146
                NY  Y    G N         +   G L    + AT L    +F  Y  P+  GY
Sbjct: 81  GDRLNNYYTYPLPEGGNGAGATAHGSEANSGALGKGLATATSLGLLLKFTSYFFPLVTGY 140

Query: 147 IADTFWGKYNTICCGTAIYIAGIFILFITSIPSV-GNRDSALGGFIASIILIGIATGMIK 205
           + D + G   T+  G    +A   I  ++++P V  + D+A+   +  +I + + T  +K
Sbjct: 141 LCDMYMGHVRTLWYGIWTGVASHIIFILSALPVVLKHPDAAMALSLIGLITLSVCTAFVK 200

Query: 206 ANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQNVFMFFYFMINVGSLSLMATTELE 265
             L  L+  Q P     +K L++GERVI D + +LQ + M FY+ IN+G+   +AT+   
Sbjct: 201 PVLLPLLLQQYPHETNVVKTLETGERVIIDRDASLQRMTMTFYWAINIGAFMSLATSYAA 260

Query: 266 YHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQR-PIGDKVIAKSFKVCWIL--------T 316
              GFW A+L+P   +    V     +     R P G  ++A   KV ++          
Sbjct: 261 KEVGFWLAFLIPLIIYMAMPVVFSLVQPHIKDRAPSGYSLLADCMKVLYVAFGKGWNARR 320

Query: 317 KNKFDFNAAKPSVHPE-------KDYP-WNDKFVDEIKRALAACKVFVFYPIYWTQYGTM 368
           K    ++ A PS   +       K  P + +  V + K  L+AC +F +Y IY      +
Sbjct: 321 KEGVFWDYALPSNQRQMGKVGWRKKSPFYKESLVQDTKITLSACFIFCYYIIYNMNDNQL 380

Query: 369 ISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYT-PFKPITKIFFG 427
            +   +Q   M  +G+PND +  F+ +++I+ IPI +   YP +RR    FKP+ +IF G
Sbjct: 381 TTIINSQTGSMTKNGVPNDVISNFNPLSIIVLIPILDYGLYPLLRRLRINFKPVYRIFTG 440

Query: 428 FMFGSFAMTWAAVLQSFVYKAGPWYSEPLGHNTPNHVHVC------------WQIPA-YV 474
           FM    +    A++Q  +Y+     +   G+    H   C            W +   Y 
Sbjct: 441 FMLAVASSVAGALIQWRIYE-----TSSCGY----HATTCSEKGLGVSPLSSWIVAVEYT 491

Query: 475 LISFSEIFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLF 534
           L   SE  A  T  E AY ++P +MKSF++++FL T+A  +AI   ++P+  DP     F
Sbjct: 492 LSGASECLAMTTAYEIAYDRSPEHMKSFVLALFLFTSAVSAAITQIVNPILKDPLLIVPF 551

Query: 535 TGLAVACFISGCLFWLCFRKYN 556
              A   FISGC F   FR  +
Sbjct: 552 ALFAGIGFISGCHFLWKFRNLD 573

>AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKR093W (PTR2)
          Length = 576

 Score =  196 bits (499), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 145/512 (28%), Positives = 242/512 (47%), Gaps = 42/512 (8%)

Query: 56  EDNEFEAPTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEY------ 109
           E    + PT+ E  +LR +     +  + I ++E +ER S+YG      N+ +Y      
Sbjct: 24  ETETLQIPTEHEELTLRRIVTSPKIHLYFICLIEFAERGSFYGTGNRMGNFYQYPLPIGG 83

Query: 110 ------GPNDTPKGMLSLNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTA 163
                 GP +   G L    + AT +    +F  Y   +  GYI+D + G+   +  G  
Sbjct: 84  NGAGAPGPGEQDPGALGKGLAVATAMGLLLKFTSYTFSIITGYISDVYIGQIKMLWIGVW 143

Query: 164 IYIAGIFILFITSIPSV-GNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPF 222
           + +    +  I ++PSV  + + A    + +++ + + T  +K  L  L+  Q P +   
Sbjct: 144 LGVGSHILFIIAALPSVLAHTNVAYALSVVALLSLSLCTSFVKPVLLPLLLQQYPYKTNI 203

Query: 223 IKVLKSGERVIEDGNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFW 282
           +K L SGERVI D + +LQ + M FY+ INVG+   +AT       G+W A+ +P   + 
Sbjct: 204 VKTLLSGERVIVDRDASLQRMTMVFYWAINVGAFLSLATAYSAQRVGYWLAFTVPLIIYL 263

Query: 283 VAVVTL-VFGKKQYIQRPIGDKVIAKSFKVC-----WILTKNKFD---FNAAKPSV---- 329
           +  + L    +      P  + V+A+S KV      W   K  +    ++ AKP+     
Sbjct: 264 LMPIVLWKLQEDIKTNEPSRESVLAESLKVLKVCYEWGWIKRYWSGQFWDYAKPTNLIQQ 323

Query: 330 -----HPEKDYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELHGI 384
                  +K   +++K+V + K  ++AC +F++Y IY   +  +     +QA  ME  G+
Sbjct: 324 GRIGWRKKKAGFYDEKYVYDTKLTISACTIFLYYVIY-QMHSNLDEPMRSQAGSMEGEGV 382

Query: 385 PNDFLQAFDSIALIIFIPIFEKFGYPFIRRYT-PFKPITKIFFGFMFGSFAMTWAAVLQS 443
           PND    F+ I++I+ +PI +   YP +RRY   FKP+ +IF GFM G    T  A++Q 
Sbjct: 383 PNDLFSNFNPISIIVVMPILDYVLYPLLRRYRINFKPVYRIFCGFMIGCLGSTVGAIIQW 442

Query: 444 FVYKAGPWYSEPLGHNTPNHVH------VCWQIP-AYVLISFSEIFASITGLEYAYSKAP 496
            VY   P     +G  T   +H        W +   Y L   SE  A  TG E A+ ++P
Sbjct: 443 RVYNTSP--CGYMGATTCPELHHKKSPLSRWLVAIEYALGGTSECLAMTTGYEIAFERSP 500

Query: 497 ANMKSFIMSIFLLTNAFGSAIGCALSPVTVDP 528
             MK F++++F+ T A  SAI   ++P   DP
Sbjct: 501 KKMKGFVLALFMFTVAISSAIILPITPFFKDP 532

>ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL119C
           (MCH4); Tandem gene duplication in this genome
          Length = 483

 Score = 37.4 bits (85), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 84/220 (38%), Gaps = 23/220 (10%)

Query: 13  QDEKQGEFPVVEEEKNQTVTLKDSYVSDDAANSTERFNLSPSPEDNEFEAPTDEELRSLR 72
            ++  G  P+V ++  +    ++  +    A+      +  + E    EA  + ++    
Sbjct: 12  HEKAGGRLPLVTDDYMRDGQTRELRMKPPVADEDGAEEVLAADEKAATEATNELDVEEEY 71

Query: 73  HVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLSLNSSGATGLSYF 132
             GG    R WL  +      F  +G +     Y  Y  N        L SSGA  +S+ 
Sbjct: 72  PDGG---YRAWLTVLGSFVGIFPIWGTANALGAYEGYISNH------QLASSGAGEVSWI 122

Query: 133 FQFW---CYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSALGG 189
           F      C+V  VF G   D   G+   I  G+ +Y+ GIF++         +  + L  
Sbjct: 123 FALHMIACFVGCVFSGSYFDRNGGQ-KAIIVGSVLYVFGIFMM---------SECTKLWH 172

Query: 190 FIASIIL-IGIATGMIKANLSVLIADQLPKRKPFIKVLKS 228
           FI +  L  G+  G++   L   +A    +R+     L +
Sbjct: 173 FILAFSLSSGVGAGILTTPLISCVATWFHRRRAVATSLAT 212

>Skud_4.293 Chr4 complement(511701..514973) [3273 bp, 1090 aa] {ON}
           YDR038C (REAL)
          Length = 1090

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 61/144 (42%), Gaps = 16/144 (11%)

Query: 167 AGIFILFITSIPSVGNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPK-RKPFIKV 225
           A I +L I+ + S    D   GG I+ ++ + +  G+++   +    + L     P   V
Sbjct: 73  AMIMVLLISMVISFAMHDWITGGVISFVVGVNVGIGLVQEYKATKTMNSLKNLSSPSAHV 132

Query: 226 LKSGERVIEDGNITLQNVFMFFYFMINVG-----SLSLMATTELEYHKGFWAAYLLPFCF 280
           +++GE      NI  +NV      ++ VG      L L+ T   +  +       LP   
Sbjct: 133 IRNGES----ENINSKNVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVS- 187

Query: 281 FWVAVVTLVFGKKQYIQRPIGDKV 304
                 TLVFGK +  +  +GD++
Sbjct: 188 ---KDATLVFGKDE--ETSVGDRL 206

>Skud_4.294 Chr4 complement(511701..514973) [3273 bp, 1090 aa] {ON}
           YDR039C (REAL)
          Length = 1090

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 61/144 (42%), Gaps = 16/144 (11%)

Query: 167 AGIFILFITSIPSVGNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPK-RKPFIKV 225
           A I +L I+ + S    D   GG I+ ++ + +  G+++   +    + L     P   V
Sbjct: 73  AMIMVLLISMVISFAMHDWITGGVISFVVGVNVGIGLVQEYKATKTMNSLKNLSSPSAHV 132

Query: 226 LKSGERVIEDGNITLQNVFMFFYFMINVG-----SLSLMATTELEYHKGFWAAYLLPFCF 280
           +++GE      NI  +NV      ++ VG      L L+ T   +  +       LP   
Sbjct: 133 IRNGES----ENINSKNVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVS- 187

Query: 281 FWVAVVTLVFGKKQYIQRPIGDKV 304
                 TLVFGK +  +  +GD++
Sbjct: 188 ---KDATLVFGKDE--ETSVGDRL 206

>KNAG0K01620 Chr11 (336059..337282) [1224 bp, 407 aa] {ON} 
          Length = 407

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 91/228 (39%), Gaps = 39/228 (17%)

Query: 285 VVTLVFG-----KKQYIQRPIGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWND 339
           +VTL++G     +K ++ R     + A +       TK   D  A K S++P      + 
Sbjct: 191 IVTLLYGVCGIARKNHVFRNFLVMMAALASIQVISYTKATCDMLAGKLSINPSTGEVTDL 250

Query: 340 KFVDEIKRAL----AACKVFVFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSI 395
              D +K +L     +  V VF  ++   +G   +S I Q+S + L GI          I
Sbjct: 251 FLFDRLKASLICGLGSLSVGVFAVMWHRWFGKPSASLIQQSSHLSLIGI-------MSII 303

Query: 396 ALIIFIPIFEKFGYPFIRRYTPFKP-----ITKIFFGFMFGSFAM-----------TWAA 439
            L+ F+P   K  Y  I  Y   K      +  +FFG +   F++               
Sbjct: 304 LLLPFVPDL-KLSYQVISFYYADKTFWLTLMGSLFFGTVPCLFSLLHLNKKNPPEFVTTV 362

Query: 440 VLQSFVYKA-GPWYSEPLGHNTPNHVHVCWQIPAYVLISFSEIFASIT 486
            L S ++     W +EP+         V W++  Y+++  S IF S+T
Sbjct: 363 NLGSIIFMGLAEWLTEPIQTTI-----VRWEVIGYIVLVLSCIFLSMT 405

>ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} similar
           to uniprot|P36029 Saccharomyces cerevisiae YKL174C TPO5
           Protein involved in excretion of putrescine and
           spermidine putative polyamine transporter in the Golgi
           or post-Golgi vesicles
          Length = 591

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 35/179 (19%), Positives = 74/179 (41%), Gaps = 38/179 (21%)

Query: 132 FFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSALGGFI 191
           +++ W YV P      +++   KY+ +   +  YI G+  LF          ++A   FI
Sbjct: 383 YYRLWTYVDPQ-----SESRVPKYSILLSMSISYILGLLPLF---------SNAAFNAFI 428

Query: 192 ASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQ-------NVF 244
              +L   +  +I                P + VL +  RV+++  + ++       N+ 
Sbjct: 429 GCAVLCLCSATLI----------------PLLLVLVTRRRVLKNAPVKIKYKLGWIANIG 472

Query: 245 MFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPIGDK 303
              + ++++ S+ L     +      +A  +  FCFF + ++   +G+K + Q P  DK
Sbjct: 473 SVCWLLLSMFSVCLPPQIPVTAKTMNYALLVFLFCFFIICILYYKWGRKHF-QLPQVDK 530

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.445 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,672,503
Number of extensions: 2903898
Number of successful extensions: 9845
Number of sequences better than 10.0: 44
Number of HSP's gapped: 10077
Number of HSP's successfully gapped: 44
Length of query: 601
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 486
Effective length of database: 40,294,809
Effective search space: 19583277174
Effective search space used: 19583277174
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)