Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_10.3007.342ON6182639611e-121
Smik_12.2647.342ON6122698831e-110
YLR206W (ENT2)7.342ON6132718681e-107
Skud_12.2707.342ON6262748561e-106
NCAS0H006707.342ON4832637097e-86
KAFR0L014607.342ON5502637112e-85
TDEL0C020507.342ON5012636533e-77
CAGL0A03872g7.342ON5102646491e-76
ZYRO0F11550g7.342ON5382636344e-74
Smik_4.757.342ON4602636259e-74
Skud_4.947.342ON4472636231e-73
YDL161W (ENT1)7.342ON4542636213e-73
NDAI0D006107.342ON4862706094e-71
Suva_4.837.342ON4622096066e-71
TPHA0D045607.342ON4872656052e-70
TBLA0E004807.342ON5991966052e-69
KLTH0H01430g7.342ON5022705879e-68
Kpol_2001.707.342ON5331365891e-67
SAKL0F10934g7.342ON4982635825e-67
Kwal_56.246107.342ON5082725819e-67
KNAG0C038007.342ON4471325637e-65
KLLA0C16731g7.342ON4782645587e-64
KAFR0B008907.342ON4141325321e-60
KNAG0B026507.342ON6461345312e-58
Ecym_47317.342ON5142715144e-57
TBLA0E020407.342ON7012124726e-50
ACL157C7.342ON5151324636e-50
KLTH0D16896g4.346ON4011362442e-21
Suva_12.2164.346ON4101362391e-20
KNAG0M003804.346ON4031362362e-20
Kwal_47.168574.346ON3821362352e-20
NDAI0D032004.346ON4351362363e-20
SAKL0G17952g4.346ON4151362337e-20
Skud_10.3494.346ON4101362327e-20
YJR125C (ENT3)4.346ON4081362319e-20
Smik_10.4184.346ON4091362301e-19
TDEL0D007104.346ON3751362272e-19
TBLA0E047604.346ON4261362283e-19
NCAS0A062104.346ON4231362274e-19
KLLA0B04587g4.346ON4001362264e-19
KAFR0B067404.346ON3991362247e-19
Kpol_1001.24.346ON4181362212e-18
ZYRO0B14784g4.346ON4241362194e-18
AER155C4.346ON3641362165e-18
TPHA0B004004.346ON3991362175e-18
CAGL0H04323g4.346ON4121361991e-15
Ecym_11334.346ON3921361962e-15
SAKL0H25762g4.17ON2621401692e-12
TBLA0B062204.346ON3391361571e-10
Kwal_55.206114.17ON2541381487e-10
Kpol_388.54.17ON2681351452e-09
TDEL0G017404.17ON2571351452e-09
TPHA0F002304.17ON2801351382e-08
ZYRO0G07876g4.17ON2591301292e-07
Ecym_84074.17ON2541361212e-06
KLTH0E05874g4.17ON2551281203e-06
KLLA0D03949g4.17ON2251201151e-05
Suva_10.354.17ON2471271142e-05
TBLA0G006504.17ON4231361162e-05
CAGL0E03806g4.17ON2601261089e-05
Skud_12.304.17ON2471271071e-04
NCAS0C058404.17ON2671321081e-04
YHR161C (YAP1801)5.84ON637881082e-04
NDAI0H002804.17ON3101431062e-04
ACL061C4.17ON2341271043e-04
TBLA0H012108.335ON4911601063e-04
KAFR0I014604.17ON2751481043e-04
SAKL0H02530g5.84ON669961055e-04
Skud_8.2255.84ON621881047e-04
Smik_8.2455.84ON62788980.003
YLL038C (ENT4)4.17ON247100890.023
TBLA0B057705.84ON68072900.028
Smik_12.194.17ON24799870.039
ZYRO0F13684g8.335ON40798880.049
NCAS0B036608.335ON416113870.060
Kpol_344.88.335ON384119850.11
TPHA0A052105.84ON63296850.12
KLLA0D16654g8.335ON399159840.14
KAFR0B058008.335ON38297830.17
NDAI0J009308.335ON418159810.31
CAGL0E01199g8.335ON41298790.49
KNAG0A051008.335ON42198790.61
KNAG0E006105.84ON60472790.69
TPHA0C007408.335ON38597780.75
TBLA0F026207.471ON48271742.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_10.300
         (618 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   374   e-121
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   344   e-110
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   338   e-107
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   334   e-106
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    277   7e-86
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   278   2e-85
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   256   3e-77
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   254   1e-76
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   248   4e-74
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   245   9e-74
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   244   1e-73
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   243   3e-73
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   239   4e-71
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   238   6e-71
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   237   2e-70
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   237   2e-69
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   230   9e-68
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   231   1e-67
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   228   5e-67
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   228   9e-67
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   221   7e-65
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   219   7e-64
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   209   1e-60
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   209   2e-58
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   202   4e-57
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   186   6e-50
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   182   6e-50
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...    99   2e-21
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    97   1e-20
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    96   2e-20
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...    95   2e-20
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...    96   3e-20
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    94   7e-20
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    94   7e-20
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    94   9e-20
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    93   1e-19
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    92   2e-19
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    92   3e-19
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    92   4e-19
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    92   4e-19
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    91   7e-19
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    90   2e-18
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    89   4e-18
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    88   5e-18
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    88   5e-18
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    81   1e-15
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    80   2e-15
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    70   2e-12
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    65   1e-10
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    62   7e-10
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    60   2e-09
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    60   2e-09
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    58   2e-08
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    54   2e-07
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    51   2e-06
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    51   3e-06
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    49   1e-05
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    49   2e-05
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    49   2e-05
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    46   9e-05
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    46   1e-04
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    46   1e-04
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    46   2e-04
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    45   2e-04
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    45   3e-04
TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.3...    45   3e-04
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    45   3e-04
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    45   5e-04
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    45   7e-04
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    42   0.003
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    39   0.023
TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa] ...    39   0.028
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    38   0.039
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    39   0.049
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    38   0.060
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    37   0.11 
TPHA0A05210 Chr1 complement(1173573..1175471) [1899 bp, 632 aa] ...    37   0.12 
KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]...    37   0.14 
KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa] ...    37   0.17 
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    36   0.31 
CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} simila...    35   0.49 
KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.3...    35   0.61 
KNAG0E00610 Chr5 complement(102826..104640) [1815 bp, 604 aa] {O...    35   0.69 
TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.3...    35   0.75 
TBLA0F02620 Chr6 complement(634992..636440) [1449 bp, 482 aa] {O...    33   2.1  

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  374 bits (961), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 191/263 (72%), Positives = 191/263 (72%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDSPPTY 180
           IIRVKAKELVSLLNDD                                  SNLYDSPPTY
Sbjct: 121 IIRVKAKELVSLLNDDERLREERTMNTRNRRTNKTARPTPTPRPRRQRTRSNLYDSPPTY 180

Query: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFXXXXXXXXXXXXXXXXXXXXXXXXX 240
           QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDF                         
Sbjct: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFQAALQLSKEEEELKQLQELQKQQQL 240

Query: 241 XXXXXXXXXXXXXYYDIFGNPIS 263
                        YYDIFGNPIS
Sbjct: 241 QSQLQMPPQQQAAYYDIFGNPIS 263

 Score =  236 bits (601), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 125/186 (67%)

Query: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492
           PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ
Sbjct: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492

Query: 493 VVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGFGNQPQNPGMNSPPQNPANVNXXXXXXXX 552
           VVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGFGNQPQNPGMNSPPQNPANVN        
Sbjct: 493 VVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGFGNQPQNPGMNSPPQNPANVNYSQPQQQQ 552

Query: 553 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGYAPDQG 612
                                                                GYAPDQG
Sbjct: 553 QQPQYTQSYQQQQPQYTQNYQQQPQYAQNYQQAPPQQQQQQQQQQQPQQQQQQGYAPDQG 612

Query: 613 ISLIDL 618
           ISLIDL
Sbjct: 613 ISLIDL 618

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 13/13 (100%), Positives = 13/13 (100%)

Query: 339 LPTGSNNPFSMDN 351
           LPTGSNNPFSMDN
Sbjct: 339 LPTGSNNPFSMDN 351

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  344 bits (883), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 181/269 (67%), Positives = 186/269 (69%), Gaps = 10/269 (3%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKNM+KGYSSTQVLVRDATAND RTPSIDTLDDLAQRSYDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDSPPTY 180
           IIRVKAKELVSLLNDD                                  SN +DS P+Y
Sbjct: 121 IIRVKAKELVSLLNDD----ERLREERSMNTRNRRDRSAARPRPRRQRTRSNPHDSSPSY 176

Query: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFXXXXXXX------XXXXXXXXXXXX 234
           QNDLEKALEESRITAQEDE RR E+AQYDD+DPDF                         
Sbjct: 177 QNDLEKALEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQNQ 236

Query: 235 XXXXXXXXXXXXXXXXXXXYYDIFGNPIS 263
                              YYDIFGNPIS
Sbjct: 237 QQSLSQMQVPVQQQQEQPAYYDIFGNPIS 265

 Score =  208 bits (529), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 104/111 (93%)

Query: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492
           PL QTRTGNQSISDKYNDLN LLATGTG DTFGNTGE+RIPAQHTKTGTFINSQGTGYKQ
Sbjct: 425 PLKQTRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 484

Query: 493 VVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGFGNQPQNPGMNSPPQNPANV 543
           V+NEPKNNPFL++QYTGLPST+IVPTQTGYGFGNQPQ+P  NSPPQN  NV
Sbjct: 485 VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQSPPANSPPQNSINV 535

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 13/13 (100%), Positives = 13/13 (100%)

Query: 339 LPTGSNNPFSMDN 351
           LPTGSNNPFSMDN
Sbjct: 340 LPTGSNNPFSMDN 352

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  338 bits (868), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 179/271 (66%), Positives = 186/271 (68%), Gaps = 12/271 (4%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKNM+KGYSSTQVLVRDATAND RTPSIDTLDDLAQRSYDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDSPPTY 180
           IIRVKAKELVSLLND+                                  SN +DS P+Y
Sbjct: 121 IIRVKAKELVSLLNDE----ERLREERSMNTRNRRANRAARPRPRRQRTRSNPHDSSPSY 176

Query: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFXXXXXXX--------XXXXXXXXXX 232
           Q+DLEKALEESRITAQEDE RR E+AQYDD+DPDF                         
Sbjct: 177 QDDLEKALEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQ 236

Query: 233 XXXXXXXXXXXXXXXXXXXXXYYDIFGNPIS 263
                                YYDIFGNPIS
Sbjct: 237 QQSLSQFQAPLQQQQPQQQPAYYDIFGNPIS 267

 Score =  201 bits (512), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 95/112 (84%), Positives = 103/112 (91%)

Query: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492
           PL QTRTGNQSISDKY+DLN LLATGTG DTFGNTGE+RIPAQHTKTGTFINSQGTGYKQ
Sbjct: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483

Query: 493 VVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGFGNQPQNPGMNSPPQNPANVN 544
           V NEPKNNPFL++QYTGLPST+IVPTQTGYGFGNQPQ+P  NSP QNP  ++
Sbjct: 484 VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQSPPTNSPQQNPTGIS 535

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 13/13 (100%), Positives = 13/13 (100%)

Query: 339 LPTGSNNPFSMDN 351
           LPTGSNNPFSMDN
Sbjct: 341 LPTGSNNPFSMDN 353

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  334 bits (856), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 178/274 (64%), Positives = 183/274 (66%), Gaps = 15/274 (5%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M KQFVRSAKNMVKGYSSTQVLVRDATAND RTPSIDTLDDLAQRSYDSVDFFEIMDMLD
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDSPPTY 180
           IIRVKAKELVSLLNDD                                  SN  DS P+Y
Sbjct: 121 IIRVKAKELVSLLNDD----ERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSY 176

Query: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFXXXXXXXXXXXXXXXXXXXXXXXXX 240
           Q++LEK LEESRITAQEDE RR E+AQYDD+DPDF                         
Sbjct: 177 QDELEKVLEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQ 236

Query: 241 XXXXXXX-----------XXXXXXYYDIFGNPIS 263
                                   YYDIFGNPIS
Sbjct: 237 QQPLSQMPVPVQQQQQQQQQQLPAYYDIFGNPIS 270

 Score =  211 bits (536), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 106/112 (94%)

Query: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492
           PL QTRTGNQSISDKYNDLNVLLATGTG DTFGNTGE+RIPAQHTKTGTFINSQGTGYKQ
Sbjct: 450 PLEQTRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 509

Query: 493 VVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGFGNQPQNPGMNSPPQNPANVN 544
           V +EPKNNPFL++QYTGLPST+IVPTQTGYGFGNQPQNP +NSPPQN  N+N
Sbjct: 510 VTSEPKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQNPAVNSPPQNSTNIN 561

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  277 bits (709), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 147/263 (55%), Positives = 166/263 (63%), Gaps = 11/263 (4%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKNMVKGYS+TQVLVRDAT+ND   PS + L +LAQRS+DSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWC+EN Y+IKTLREFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120

Query: 121 IIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDSPPTY 180
           IIRVKAKEL SLL D+                                            
Sbjct: 121 IIRVKAKELTSLLLDEERLKEERTINLKNRRDGDMKGRRRRRGTRNGRGNDE-------D 173

Query: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFXXXXXXXXXXXXXXXXXXXXXXXXX 240
           Q++L++ALEESR+TA+EDE RR +MAQYDD DPD                          
Sbjct: 174 QDELQRALEESRLTAEEDERRRRQMAQYDDQDPDL----QTALQLSKEEEELKKLQEMQR 229

Query: 241 XXXXXXXXXXXXXYYDIFGNPIS 263
                        Y+DIFGNPIS
Sbjct: 230 LQQQQGQMNQPQGYFDIFGNPIS 252

 Score =  169 bits (428), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 79/92 (85%), Positives = 85/92 (92%)

Query: 437 TRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVNE 496
           TRTGNQSI+DKY+ LN LLATGTG DTFGNTGE RIPAQHT+TGTFINSQGTGY+QV N+
Sbjct: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428

Query: 497 PKNNPFLNSQYTGLPSTSIVPTQTGYGFGNQP 528
           PKNNPFLNSQYTGLPST+IV TQTGYGFGN P
Sbjct: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFGNAP 460

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  278 bits (711), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 144/263 (54%), Positives = 170/263 (64%), Gaps = 7/263 (2%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKN++KGYSSTQVLVRDAT+ND R  +IDTLDD+A RSYDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYW+H+ KSLTVLDYLVRFGSENCVLWC+EN YVIKTLREFR+E+++G D+GQ
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDDTGIDQGQ 120

Query: 121 IIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDSPPTY 180
           IIRVKAKEL SLL D                                   SN+   P   
Sbjct: 121 IIRVKAKELTSLLQD---EERLREERRFNNRRNRRNNRSANRSRATSRSQSNI--GPD-- 173

Query: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFXXXXXXXXXXXXXXXXXXXXXXXXX 240
            +DL++ +EES+ TA+EDE RR E+A+YD++DP+F                         
Sbjct: 174 DDDLQRVIEESKKTAEEDERRRKELARYDEEDPEFQAALQLSKEEEELKNLQDLQRQQQQ 233

Query: 241 XXXXXXXXXXXXXYYDIFGNPIS 263
                        YYD+FGNPIS
Sbjct: 234 LQMLQQQQTSANVYYDVFGNPIS 256

 Score =  158 bits (400), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 85/96 (88%), Gaps = 1/96 (1%)

Query: 438 RTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVNE- 496
           RTGN+ I++KY++LN LLA GTG DTFGNTG+ RIPAQHTKTGTFINSQGTGYKQV NE 
Sbjct: 389 RTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVTNER 448

Query: 497 PKNNPFLNSQYTGLPSTSIVPTQTGYGFGNQPQNPG 532
            KNNPFLN+QYTGLPS++IVP+ TGYGFGNQPQ+  
Sbjct: 449 SKNNPFLNTQYTGLPSSNIVPSSTGYGFGNQPQDSA 484

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  256 bits (653), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 135/263 (51%), Positives = 161/263 (61%), Gaps = 21/263 (7%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKN+VKGYSS QVLVR+ATAN+   PS+D LD+LA+++YDSV+FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRH+AKSLTVLDYLVRFGSENCVLWCREN YVIKTL EFR++++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDDDGGVDQGQ 120

Query: 121 IIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDSPPTY 180
           IIRVKAKEL +LL+DD                                           +
Sbjct: 121 IIRVKAKELTNLLSDDERLREEREMNRKGRKNGTRRRRRTTGEQDG-------------F 167

Query: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFXXXXXXXXXXXXXXXXXXXXXXXXX 240
            +DL++AL+ESR+TA+EDE RR  +   DDD                             
Sbjct: 168 DDDLQRALDESRLTAEEDERRRKMLGSEDDD--------LQAALQLSKEEEELKRLQEMQ 219

Query: 241 XXXXXXXXXXXXXYYDIFGNPIS 263
                        YYDIFGNPIS
Sbjct: 220 KLQQQQTQQQPSQYYDIFGNPIS 242

 Score =  150 bits (379), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 79/90 (87%)

Query: 437 TRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVNE 496
            RTG+ ++++KY +LN LLATGTG DTFGNTG++RIPAQHTKTGTFINSQGTGY+QV  E
Sbjct: 389 VRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGE 448

Query: 497 PKNNPFLNSQYTGLPSTSIVPTQTGYGFGN 526
           PK NPFL SQYTG+PS++IVP  TGYGFGN
Sbjct: 449 PKKNPFLQSQYTGIPSSNIVPAHTGYGFGN 478

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  254 bits (649), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 146/264 (55%), Positives = 165/264 (62%), Gaps = 12/264 (4%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M  Q VRSAKNMVKGYSSTQV+VRDATAND  +PS+  L+DLA ++YD+V+FFEIMDMLD
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWC+EN Y+IKTLREFRHE+E SG DEG
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120

Query: 120 QIIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDSPPT 179
           QIIRVKAKEL SLL DD                                  +        
Sbjct: 121 QIIRVKAKELTSLLTDDERLREERALNRANRRNGDAKRRRRRSRSRSTSYRN-------A 173

Query: 180 YQNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFXXXXXXXXXXXXXXXXXXXXXXXX 239
           Y +DL+KALEESR+TA+E+E RR E AQY++ DPD                         
Sbjct: 174 YDDDLQKALEESRMTAEEEEARRREQAQYENQDPDL----LAALQLSKEEEELKKLQDMQ 229

Query: 240 XXXXXXXXXXXXXXYYDIFGNPIS 263
                         YYDIFGNPIS
Sbjct: 230 RMQELQAQQQQQNVYYDIFGNPIS 253

 Score =  168 bits (425), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 78/90 (86%), Positives = 86/90 (95%)

Query: 436 QTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVN 495
           +TRTGNQSISDKY++LN LLA+GTG DTFGNTGE+RIPAQHTKTGTFINSQGTGYKQV N
Sbjct: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419

Query: 496 EPKNNPFLNSQYTGLPSTSIVPTQTGYGFG 525
           EPKNNPFL+SQYTGLPST+IVP+ TGYGFG
Sbjct: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  248 bits (634), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 135/263 (51%), Positives = 158/263 (60%), Gaps = 19/263 (7%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M  QFVRSAKN +KGY+S QVLVRDATAN+   PS+D LD+LA RSYDSV+FFEIMDM+D
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCREN Y+IKTLREFRH+++   D GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGTQDGGQ 120

Query: 121 IIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDSPPTY 180
           IIRVKAKEL +LL DD                                   N YDS    
Sbjct: 121 IIRVKAKELTNLLMDD--------ERLRMERGEDKGAPPRMMSPSPPTPRRNSYDS---- 168

Query: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFXXXXXXXXXXXXXXXXXXXXXXXXX 240
             ++++AL+ SR+TA+EDE RR  +   +++D D                          
Sbjct: 169 --EMQRALDASRLTAEEDERRRKTL---NNEDADL--ETALQLSKEEEELKRLQELQKAQ 221

Query: 241 XXXXXXXXXXXXXYYDIFGNPIS 263
                        YYDIFGNPIS
Sbjct: 222 QDQQRLSQMQPQGYYDIFGNPIS 244

 Score =  154 bits (390), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 81/94 (86%)

Query: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492
           P+   RTGNQSISDKYNDLN LLA  TG DTFGN G++RIPAQHTKTGTFINSQGTG+KQ
Sbjct: 419 PMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQ 478

Query: 493 VVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGFGN 526
             NEPK NPFL +Q+TG+P++S+VP+ TGYGFGN
Sbjct: 479 YSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFGN 512

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  245 bits (625), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 132/263 (50%), Positives = 159/263 (60%), Gaps = 24/263 (9%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKN+VKGYSSTQVLVR+AT+ND    S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+EN Y+IKTL+EFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDSPPTY 180
           I+RVK+KEL +LL+DD                                  SN  D     
Sbjct: 121 IVRVKSKELTALLSDD-------ERLNEERNMNIKGRNRKGRSRRGTGRSSNDND----- 168

Query: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFXXXXXXXXXXXXXXXXXXXXXXXXX 240
            NDL++AL+ SR+TA+EDE RR     Y+                               
Sbjct: 169 -NDLQRALDASRMTAEEDEKRRKMDEDYE-----------TALQLSKEEEELKRLQDLQR 216

Query: 241 XXXXXXXXXXXXXYYDIFGNPIS 263
                        YYDIFGNPI+
Sbjct: 217 MQQLQTQQQQQPMYYDIFGNPIT 239

 Score =  168 bits (425), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 77/93 (82%), Positives = 86/93 (92%)

Query: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492
           PLTQTRTGNQS++DKYN LN LLATGTG DTFGN G++R+PAQHTKTGTFINSQGTGYKQ
Sbjct: 346 PLTQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQ 405

Query: 493 VVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGFG 525
           V N+PK NPFL+ QYTGLPST++VPTQTGYGFG
Sbjct: 406 VSNDPKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  244 bits (623), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 128/263 (48%), Positives = 157/263 (59%), Gaps = 24/263 (9%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKN+VKGYSSTQVLVR+AT+ND    S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+EN Y+IKTL+EFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGVDQGQ 120

Query: 121 IIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDSPPTY 180
           I+RVKAKEL +LL+DD                                            
Sbjct: 121 IVRVKAKELTTLLSDDERLNEERNMNIKGRSRKGRKRRGTGRNDEDD------------- 167

Query: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFXXXXXXXXXXXXXXXXXXXXXXXXX 240
            +DL++A++ SR+TA+EDE RR +   Y+                               
Sbjct: 168 -DDLQRAIDASRMTAEEDERRRKQDEDYE----------TALQLSKEEEELKRLQDLQRM 216

Query: 241 XXXXXXXXXXXXXYYDIFGNPIS 263
                        YYDIFGNPI+
Sbjct: 217 QQVHAQQQQQQPMYYDIFGNPIT 239

 Score =  171 bits (434), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 79/93 (84%), Positives = 86/93 (92%)

Query: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492
           PLTQTRTGNQS++DKY  LN LLATGTG DTFGN G+SR+PAQHTKTGTFINSQGTGY+Q
Sbjct: 333 PLTQTRTGNQSMTDKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQ 392

Query: 493 VVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGFG 525
           V N+PK NPFLNSQYTGLPST+IVPTQTGYGFG
Sbjct: 393 VSNDPKQNPFLNSQYTGLPSTNIVPTQTGYGFG 425

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  243 bits (621), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 128/263 (48%), Positives = 156/263 (59%), Gaps = 24/263 (9%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKN+VKGYSSTQVLVR+AT+ND    S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRH+AK+LTV+DYL+RFGSENCVLWCREN Y+IKTL+EFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDSPPTY 180
           I+RVKAKEL +LL+DD                                            
Sbjct: 121 IVRVKAKELTALLSDDERLNEERNMNIKGRNRKGRRRRGTGRSDEN-------------- 166

Query: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFXXXXXXXXXXXXXXXXXXXXXXXXX 240
            +DL++A+  SR+TA+EDE RR +   Y+                               
Sbjct: 167 DDDLQRAISASRLTAEEDERRRKQDEDYE----------TALQLSKEEEELKRLQDLQRM 216

Query: 241 XXXXXXXXXXXXXYYDIFGNPIS 263
                        YYDIFGNPI+
Sbjct: 217 QQQQGQQQLQQPMYYDIFGNPIT 239

 Score =  164 bits (414), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 75/92 (81%), Positives = 84/92 (91%)

Query: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492
           PL Q RTGNQS++DKY+ LN LLATGTG DTFGN GE+RIPAQHTKTGTFINSQGTGY+Q
Sbjct: 340 PLIQNRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQ 399

Query: 493 VVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGF 524
           V ++P +NPFLNSQYTGLPSTS+VPTQTGYGF
Sbjct: 400 VSDDPNHNPFLNSQYTGLPSTSVVPTQTGYGF 431

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  239 bits (609), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 137/270 (50%), Positives = 163/270 (60%), Gaps = 16/270 (5%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKNM+KGYS+TQVLVRDAT+ND   PS + L ++++RS+DSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC++N Y+IKTL+EF+ E+++  DE  
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDN-VDESS 119

Query: 121 IIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDSPPTY 180
           IIRVKAKEL +LL DD                                  +N        
Sbjct: 120 IIRVKAKELTALLQDD--------ERLKEERSINLKNNRRSERKNRSRRGTNATRRGTKS 171

Query: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFXXXXXXX-------XXXXXXXXXXX 233
             DL+KALEESRITA+EDE RR E+AQYD+ D D+                         
Sbjct: 172 DEDLQKALEESRITAEEDERRRRELAQYDNQDTDYQTALQLSKEEEELKKLQELQRLQQL 231

Query: 234 XXXXXXXXXXXXXXXXXXXXYYDIFGNPIS 263
                               YYDIFGNPIS
Sbjct: 232 QQQQQQQMQFQQQPQQQEQVYYDIFGNPIS 261

 Score =  155 bits (393), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 83/89 (93%), Gaps = 1/89 (1%)

Query: 437 TRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVNE 496
           TRTGNQSISDKYN+LN LLA+GTG DTFGNTG+ RIPAQHT+TGTFINSQGTGYKQ+VN+
Sbjct: 368 TRTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVND 427

Query: 497 P-KNNPFLNSQYTGLPSTSIVPTQTGYGF 524
           P K NPFLN+QYTGLPS++IVP+ TGYGF
Sbjct: 428 PVKKNPFLNNQYTGLPSSNIVPSHTGYGF 456

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  238 bits (606), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 117/209 (55%), Positives = 145/209 (69%), Gaps = 14/209 (6%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQ VRSAKN+VKGYSSTQVLVR+AT+ND    S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+EN Y+IKTL+EFRH+++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120

Query: 121 IIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDSPPTY 180
           I+RVKAKEL SLL+D+                                            
Sbjct: 121 IVRVKAKELTSLLSDEERLNEERNMNIKGRNRGGRRRRRTNRSSEDD------------- 167

Query: 181 QNDLEKALEESRITAQEDELRRNEMAQYD 209
            +DL++A++ SR+TA EDE RR +   Y+
Sbjct: 168 -DDLQRAIDASRMTADEDERRRKQDEDYE 195

 Score =  174 bits (440), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 90/97 (92%)

Query: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492
           PLTQTRTGNQS++DKY+ LN LL TGTG DTFGN G++R+PAQHTKTGTFINSQGTGY+Q
Sbjct: 348 PLTQTRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQ 407

Query: 493 VVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGFGNQPQ 529
           V N+PK+NPFLNSQYTGLPST++VP QTGYGFGNQPQ
Sbjct: 408 VSNDPKHNPFLNSQYTGLPSTNVVPAQTGYGFGNQPQ 444

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  237 bits (605), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 132/265 (49%), Positives = 156/265 (58%), Gaps = 30/265 (11%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MS QFVRS KN+VKGYSSTQVLVR+ATAN+   P+ID L D+A+++YDS DFFEIMDMLD
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENES--GFDE 118
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC+EN Y+IKTL EFR+E+E+  G D+
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 119 GQIIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDSPP 178
           GQIIRVKAKEL +LL DD                                          
Sbjct: 121 GQIIRVKAKELTALLMDDERLREERRLNNRRDRNRNRRPPARNGS--------------- 165

Query: 179 TYQNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFXXXXXXXXXXXXXXXXXXXXXXX 238
               DL++ALEESR TA+EDE +R    + + DD D                        
Sbjct: 166 --DEDLQRALEESRRTAEEDERKR----RLNQDDSDL-------QAALQLSKEEEELKRL 212

Query: 239 XXXXXXXXXXXXXXXYYDIFGNPIS 263
                          YYD+FGNPIS
Sbjct: 213 QELQSSMHMQQQQPVYYDVFGNPIS 237

 Score =  146 bits (368), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 80/88 (90%)

Query: 438 RTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVNEP 497
           RTGN+ +++KYN+LN LLA+GTG DTFGNTGE+RIPAQHT+TGTFINSQGTGY+Q   E 
Sbjct: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434

Query: 498 KNNPFLNSQYTGLPSTSIVPTQTGYGFG 525
           K NPFL++QYTGLPS++I+PTQTGYGFG
Sbjct: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  237 bits (605), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 139/196 (70%), Gaps = 4/196 (2%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQF+RS KNMVKGYSSTQ+LVRDATAND  TPSID LDD+A+++YDSVDFFEIMDMLD
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE----SGF 116
           KRLNDKGKYW+HVAKSLTVLDYL+RFGSENCV WC+EN Y+IKTL+EFR ++     +G+
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 117 DEGQIIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDS 176
           D+GQI+RV+A EL SLL DD                                   N   +
Sbjct: 121 DQGQIVRVRATELTSLLMDDERLREERSLHSRGGRRSAPPPRMAPQRRNTSRSDFNRQRA 180

Query: 177 PPTYQNDLEKALEESR 192
              Y +DL+KA+EES+
Sbjct: 181 DDHYDDDLQKAIEESK 196

 Score =  168 bits (426), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 88/97 (90%)

Query: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492
           P+ Q RTGNQ ISDKYN+LN LLATGTG DTFGNTG+ RIPAQHT TGTFINSQGTGYKQ
Sbjct: 466 PIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQ 525

Query: 493 VVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGFGNQPQ 529
            +N+PKNNPF+++QYTGLPST++VP+ TGYGFGNQPQ
Sbjct: 526 YINDPKNNPFMSNQYTGLPSTNVVPSYTGYGFGNQPQ 562

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  230 bits (587), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 158/270 (58%), Gaps = 26/270 (9%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSK  +R AKN+V GYS+TQVL+R+AT+NDP  PS+D +D++A+RS+DSV FFEIMDMLD
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W +EN Y+IKTLREF HE+E+G D+GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120

Query: 121 IIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDSPPTY 180
           I+RVKA+EL +LL D+                                       +  +Y
Sbjct: 121 IVRVKARELTALLQDEERLREERELKGRNRRPRRRK-------------------NSDSY 161

Query: 181 QNDLEKALEESRITAQEDEL-RRNEMAQYDDDDPDFXXXXXXXXXXXXXXXXXXXXXXXX 239
            +D+++ALEESR+TA+++E  RR ++  YD+   D                         
Sbjct: 162 DDDMQRALEESRMTAEQEEAERRRKLEMYDNSADDLQTALQLSKEEEELRRLRELQMQQQ 221

Query: 240 XXXXXXXXXXXXX------XYYDIFGNPIS 263
                               YYD+FGNPIS
Sbjct: 222 MQQAQQQMFGLQQQQTQQPMYYDVFGNPIS 251

 Score =  156 bits (394), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 74/93 (79%), Positives = 84/93 (90%), Gaps = 2/93 (2%)

Query: 437 TRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVNE 496
           TRTGNQS++DK++DLN LLA+GTG DTFGNTG++RIPAQHTKTGTFINSQGTGYKQV N 
Sbjct: 387 TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNM 446

Query: 497 P--KNNPFLNSQYTGLPSTSIVPTQTGYGFGNQ 527
           P  K+NPFL  QYTGLPSTS+VP+ TGYGFGNQ
Sbjct: 447 PQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQ 479

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  231 bits (589), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 124/136 (91%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M KQFVRSAKN+VKGYSSTQV+VR+AT+ND   P IDTLD LA+++YDSV+FFEIMDMLD
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC+EN Y+I+TL+EF + ++S  D+GQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120

Query: 121 IIRVKAKELVSLLNDD 136
           IIRVKAKEL SLLND+
Sbjct: 121 IIRVKAKELTSLLNDE 136

 Score =  164 bits (414), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 84/90 (93%)

Query: 437 TRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVNE 496
           TRTGNQ I+DK+ +LN LLA+GTG DTFGNTGE+RIPAQHTKTGTFINSQGTGY+QV N+
Sbjct: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442

Query: 497 PKNNPFLNSQYTGLPSTSIVPTQTGYGFGN 526
           PKNNPFLNSQYTGLPST+IVP+ TGYGFGN
Sbjct: 443 PKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  228 bits (582), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 129/263 (49%), Positives = 158/263 (60%), Gaps = 17/263 (6%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSK  +R+AKN+V GYSS QVLVR+AT+N+P  P++D LD+LA+++YD+V+FFEIMDMLD
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR+GSENCVLW +EN Y+IKTLREF HE+E G D GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120

Query: 121 IIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDSPPTY 180
           IIRVKAKEL SLL D+                                           Y
Sbjct: 121 IIRVKAKELTSLLRDEERLTEERNMRKKRRGKTRRPERSRGGEE---------------Y 165

Query: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFXXXXXXXXXXXXXXXXXXXXXXXXX 240
            +DL++ALEESR+TA+E+E RR   +  +DDD DF                         
Sbjct: 166 DDDLQRALEESRLTAEEEERRRRTDSGSNDDD-DF-QTALQLSKEEEELRRLRNLQMQQQ 223

Query: 241 XXXXXXXXXXXXXYYDIFGNPIS 263
                        YYD+FGNPI+
Sbjct: 224 QTAMFQQQQQQPMYYDVFGNPIT 246

 Score =  157 bits (398), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 76/94 (80%), Positives = 84/94 (89%), Gaps = 1/94 (1%)

Query: 434 LTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQV 493
           L  TRTGNQSIS KYNDLN LLA+GTG DTFGNTG++RIPAQHT+TG FINSQGTGYKQV
Sbjct: 371 LNPTRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQV 430

Query: 494 VN-EPKNNPFLNSQYTGLPSTSIVPTQTGYGFGN 526
            N +PKNNPFL +QYTGLPSTS+VP+ TGYGFGN
Sbjct: 431 TNDQPKNNPFLAAQYTGLPSTSVVPSYTGYGFGN 464

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  228 bits (581), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 123/272 (45%), Positives = 155/272 (56%), Gaps = 28/272 (10%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSK  +R AKN+V GYS+TQVL+R+AT+NDP  PS+D +D++A+RS+DSV FFEIMDMLD
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W +EN YVIKTLREF HE+E G D+GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120

Query: 121 IIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDSPPTY 180
           I+RVKA+EL +LL DD                                       +  + 
Sbjct: 121 IVRVKARELTALLLDDERLREERSLRTKNRKPRRRP-------------------TAGSE 161

Query: 181 QNDLEKALEESRITAQEDEL-RRNEMAQYDDDDPDFXXXXXXXXXXXXXXXXXXXXXXXX 239
             DL++A+EESR+TA+++E  RR ++  YD+   D                         
Sbjct: 162 DEDLQRAMEESRLTAEQEEAERRRKLEIYDNSSDDLQTALQLSKEEEELRRLRELQMQQQ 221

Query: 240 XXX--------XXXXXXXXXXXYYDIFGNPIS 263
                                 YYD+FGNPIS
Sbjct: 222 MQQAQQQMFGLSQQQTQAQQPMYYDVFGNPIS 253

 Score =  149 bits (377), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 81/89 (91%)

Query: 437 TRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVNE 496
           TRTGNQSI++K+++LN LLA+GTG DTFGNTG++RIPAQHTKTG FINSQGTGYKQV + 
Sbjct: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454

Query: 497 PKNNPFLNSQYTGLPSTSIVPTQTGYGFG 525
           PK+NPFL  QYTGLPST++VP+ TGYGFG
Sbjct: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  221 bits (563), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 100/132 (75%), Positives = 117/132 (88%)

Query: 5   FVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLN 64
            +RSAKN+VKGYS T+VLVRDATAN+   PS + LDDLA +SY+SV+FFEI+DMLDKR+N
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRV 124
           DKGKYWRHVAK+LTVLDYLVRFGSENCV+WC+EN Y+IKTLREF HE+  G DEG+IIRV
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120

Query: 125 KAKELVSLLNDD 136
           KAKEL SLL D+
Sbjct: 121 KAKELTSLLMDE 132

 Score =  165 bits (417), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 87/95 (91%)

Query: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492
           PLTQTR+GNQ+ISDKY+ LN LLA+GTG DTFGNTGE RIPAQHT+TGTFINSQGTGY+Q
Sbjct: 334 PLTQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQ 393

Query: 493 VVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGFGNQ 527
           V N+ K NPFLN QYTGLPST+IVPTQTG+GFGNQ
Sbjct: 394 VNNDDKPNPFLNGQYTGLPSTNIVPTQTGFGFGNQ 428

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  219 bits (558), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 121/264 (45%), Positives = 149/264 (56%), Gaps = 19/264 (7%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSK F+RSAKN+V GYS  QVLVR AT+ND   PS+D L++LA+R++D+V+FFEIMDMLD
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119
           KRLNDKG+ WRHVAKSLT LD+LVR GSENCV WC+EN Y+IKTLREF H +E +  D G
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120

Query: 120 QIIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDSPPT 179
           +I+RVKAKEL +LL D+                                           
Sbjct: 121 EIVRVKAKELTALLRDEERLKEERMMRLKGRKRGGRKNRRDDN----------------E 164

Query: 180 YQNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFXXXXXXXXXXXXXXXXXXXXXXXX 239
             +DL++ALEESRITA+E+E RR ++    DD                            
Sbjct: 165 DDDDLQRALEESRITAEEEERRRKQLMMQGDDSS--LQAALELSKEEEELRRLQQLQAQQ 222

Query: 240 XXXXXXXXXXXXXXYYDIFGNPIS 263
                         YYDIFGNPIS
Sbjct: 223 QAALWQQQQQQQPMYYDIFGNPIS 246

 Score =  157 bits (397), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 87/96 (90%), Gaps = 1/96 (1%)

Query: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492
           P+ + RTGNQSISDK+++LN LLA+GTG DTFGNTGE+R+PAQHTKTGTFINSQGTGYKQ
Sbjct: 355 PVPKQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQ 414

Query: 493 VVNE-PKNNPFLNSQYTGLPSTSIVPTQTGYGFGNQ 527
           + N+ PK+NPFL SQYTG+PS++I P+ TGYGFGNQ
Sbjct: 415 ITNDAPKHNPFLTSQYTGIPSSAIAPSYTGYGFGNQ 450

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  209 bits (532), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 92/132 (69%), Positives = 114/132 (86%)

Query: 5   FVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLN 64
            +RSAKN+VKGYSSTQ LVRDAT+N    P ID L +LA+ +Y++++FFEIMDMLDKR+N
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRV 124
            KGKYW+HV KSL VLDYLVRFGSENCV+WC+EN Y+IKTLREF +E+ESG D+GQ++RV
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDESGMDQGQMVRV 120

Query: 125 KAKELVSLLNDD 136
           +AKEL SLL D+
Sbjct: 121 RAKELTSLLMDE 132

 Score =  159 bits (401), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 78/98 (79%), Positives = 83/98 (84%)

Query: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492
           PL QTRTG+QSISDKY+ LN LLATGTG DTFGNTG  RIPAQHTKTGTFINSQGTGYKQ
Sbjct: 310 PLKQTRTGSQSISDKYSALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQ 369

Query: 493 VVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGFGNQPQN 530
           V     NN FLNSQYTGLPS++IVP+QTGYGFGN   N
Sbjct: 370 VSTNGFNNVFLNSQYTGLPSSNIVPSQTGYGFGNSTVN 407

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  209 bits (531), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 95/134 (70%), Positives = 117/134 (87%), Gaps = 1/134 (0%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MS+QFVRSAKN++KGYSSTQVLVRDATAND RTP +DTL+D+A  S+DSVDFFEIMD+L+
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENES-GFDEG 119
           KRLND GKYWRH+ KSLTVLDYLVRFGSE+C  W R++ +++K LR FR  ++  GFD+G
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120

Query: 120 QIIRVKAKELVSLL 133
           QI+RVKA++LV LL
Sbjct: 121 QIVRVKARDLVELL 134

 Score =  142 bits (358), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 80/98 (81%), Gaps = 3/98 (3%)

Query: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492
           P+ +  TGNQ +++KY++LN LLA GTG DTFGN G  RIPAQHT+TGTFINSQGTG+KQ
Sbjct: 490 PMPRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQ 549

Query: 493 VVNE---PKNNPFLNSQYTGLPSTSIVPTQTGYGFGNQ 527
           V +E   P +NPFLNSQYTGLPST IVP  TGYGFGNQ
Sbjct: 550 VNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFGNQ 587

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 38/82 (46%)

Query: 182 NDLEKALEESRITAQEDELRRNEMAQYDDDDPDFXXXXXXXXXXXXXXXXXXXXXXXXXX 241
           +DL++A+EES+ T QEDE RR +++ YD++DP+F                          
Sbjct: 206 DDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLSREEEELKNLQHLQRLQQQQ 265

Query: 242 XXXXXXXXXXXXYYDIFGNPIS 263
                       Y D+FGNP+S
Sbjct: 266 QQQQQQQQLNTAYLDVFGNPVS 287

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  202 bits (514), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 116/271 (42%), Positives = 149/271 (54%), Gaps = 24/271 (8%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQ +RSAKN++ GYS  QVLVR+AT+ND   PS+D +++LA+R+Y +V+FFEIM MLD
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119
           +RLNDK K WRHVAKSLTV DYLVR G+E CV W REN ++I+ L EF H +E SG D G
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120

Query: 120 QIIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDSPPT 179
           Q+IRVKAKEL++LL DD                                       +P  
Sbjct: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQNVPET---------------NPDG 165

Query: 180 YQNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFXXXXXXXXXXXXXXXXXXXXXXXX 239
              DL++ALEESRITA+E+E RR ++A+  +D  +                         
Sbjct: 166 VDPDLKRALEESRITAEEEE-RRRKLAEKTEDAEELQAALQLSKEEEELRKLRELQQQRE 224

Query: 240 XXXXXXXXXXXXX-------XYYDIFGNPIS 263
                                YYDIFGNPI+
Sbjct: 225 QQMAFWQQQQVQQVQYQQQPMYYDIFGNPIT 255

 Score =  152 bits (384), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 81/91 (89%), Gaps = 1/91 (1%)

Query: 437 TRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVNE 496
           TRTGNQSISDKY +LN LLATGTG DTFGNTG++RI +QHTKT TFINS GTG+KQV NE
Sbjct: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462

Query: 497 -PKNNPFLNSQYTGLPSTSIVPTQTGYGFGN 526
            PK+NPFL +QYTGLPST+IVP+ TGYGFGN
Sbjct: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGN 493

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  186 bits (472), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 99/212 (46%), Positives = 128/212 (60%), Gaps = 7/212 (3%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MS QFVRS KNM KGYS TQVLVRDATAN+    SID LD L + SYD+ +F +I  +LD
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           +R++DK KYWRHVAKSLTV+DYLVRFGSE CV W R+N   ++ LR+F + + +G D+GQ
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120

Query: 121 IIRVKAKELVSLLNDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNLYDSPPTY 180
           +IRVKA EL+ LL D                                          P  
Sbjct: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRR-------PED 173

Query: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDD 212
           + D+++ALEES+ TA+EDE RR +  + +  D
Sbjct: 174 EEDVDRALEESKKTAEEDEARRRKDQEREKQD 205

 Score =  109 bits (273), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 53/78 (67%), Positives = 60/78 (76%)

Query: 439 TGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVNEPK 498
           TGN  IS KY++LN LLA GTG DTFGN G +RIPAQHTKTGTFINSQGTGYKQV +   
Sbjct: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTSSSS 655

Query: 499 NNPFLNSQYTGLPSTSIV 516
             P L +QYTGLP+ + V
Sbjct: 656 PIPLLPTQYTGLPAQTAV 673

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  182 bits (463), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 84/132 (63%), Positives = 107/132 (81%), Gaps = 1/132 (0%)

Query: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQ +RSAKN+V GYS  Q+LVR+AT+N+   PS+D +++LA+RSY +V+FFEI+ MLD
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENES-GFDEG 119
           KRL+DK K+WRHVAKSLTV D+LVR G+E CV W REN Y+ + L EF H +ES G D G
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120

Query: 120 QIIRVKAKELVS 131
           QIIRVKA+ELV+
Sbjct: 121 QIIRVKARELVA 132

 Score =  155 bits (393), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 74/94 (78%), Positives = 86/94 (91%), Gaps = 1/94 (1%)

Query: 434 LTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQV 493
           L  TRTGNQSI+DKY++LN LLA+GTG DTFGNTG++RIPAQHTKTGTFINSQGTGYKQV
Sbjct: 398 LQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQV 457

Query: 494 VNE-PKNNPFLNSQYTGLPSTSIVPTQTGYGFGN 526
            NE PK+NPF+ +QYTGLPST++VP+ TGYGFGN
Sbjct: 458 GNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGN 491

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 98.6 bits (244), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 82/136 (60%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+NMV  Y+  +  VR+AT N+P   S   ++ ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + K+L +LDYL+R G+E  +   R N  +IK L  F + +  G D+G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDD 136
            +R +A ELV LL+DD
Sbjct: 135 NVRNRAHELVLLLDDD 150

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 82/136 (60%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT N+P   S   +D ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   R +  +IK L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDD 136
            +R + K LV LL+DD
Sbjct: 135 NVRTRVKALVELLSDD 150

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 82/136 (60%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+V  ++  +  VR+AT N+P   S   ++ +AQ +Y+  +  E+M ML +
Sbjct: 15  AKKYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL+R GSE  +   R    +++ L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYIDSQGRDQGV 134

Query: 121 IIRVKAKELVSLLNDD 136
            +R +AK++V LL DD
Sbjct: 135 NVRNRAKQIVELLQDD 150

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score = 95.1 bits (235), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 81/136 (59%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT N+P   S   ++ +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + K+L +LDYL+R G+E  +   R N  +IK L  F + +  G D+G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDD 136
            +R +A EL  LL+DD
Sbjct: 135 NVRNRAHELALLLDDD 150

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score = 95.5 bits (236), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 83/136 (61%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT N+P   S   ++ +AQ +Y+  + +EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   R +  +I+ L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYIDSEGRDQGI 134

Query: 121 IIRVKAKELVSLLNDD 136
            +R +AK LV LL DD
Sbjct: 135 NVRNRAKLLVELLQDD 150

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 94.4 bits (233), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 82/136 (60%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT N+P   S   ++ ++  +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + K+L +L+YL++ GSE  +   R N  +IK L  F + +  G D+G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDD 136
            +R +A+ELV LLN+D
Sbjct: 135 NVRNRAQELVKLLNND 150

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 94.0 bits (232), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 82/136 (60%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT N+P   S   +D ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   R +  +IK L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDD 136
            +R + K L+ LL+DD
Sbjct: 135 NVRTRVKTLIELLSDD 150

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 93.6 bits (231), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 82/136 (60%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT N+P   S   +D ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   R +  +I+ L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDD 136
            +R + K L+ LL+DD
Sbjct: 135 NVRTRVKALIELLSDD 150

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 82/136 (60%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT N+P   S   +D ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   R +  +I+ L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDD 136
            +R + K L+ LL+DD
Sbjct: 135 NVRTRVKALIDLLSDD 150

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 81/136 (59%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT N+P   S   ++ ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           RL +K    WR + K+L +LDYL+R  SE  +   R +  +IK L  F + +  G D+G 
Sbjct: 75  RLTEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDD 136
            +R +AK L  LL+DD
Sbjct: 135 NVRNRAKALAELLSDD 150

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 81/136 (59%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT N+P   S   ++ +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +L+YL+  G+E  +   R +  +I+ L  F + +  G D+G 
Sbjct: 75  RFTEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVDSEGRDQGA 134

Query: 121 IIRVKAKELVSLLNDD 136
            +R +A+ + SLL+ D
Sbjct: 135 NVRSRAQAMTSLLSSD 150

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 92.0 bits (227), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 81/136 (59%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT N+P   S   ++ +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   R +  V+K L+ F + +  G D+G 
Sbjct: 75  RFTEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYIDAEGRDQGI 134

Query: 121 IIRVKAKELVSLLNDD 136
            +R +   L+ LL DD
Sbjct: 135 NVRNRVTTLIELLRDD 150

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 91.7 bits (226), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 80/136 (58%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT N+P   S   ++ +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + K+L +L+YLV+ GSE  +   R N  ++K L  F + +  G D+G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDD 136
            +R +A +LV LL  D
Sbjct: 135 NVRNRASQLVKLLESD 150

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 90.9 bits (224), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 82/136 (60%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT N+P   S   ++ +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + KSL +LDYL+R GSE  +   R +  +I+ L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDD 136
            +R +AK L  LL+DD
Sbjct: 135 NVRNRAKALGELLSDD 150

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 81/136 (59%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+P   S   ++ ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + K+L +L+YL++ GSE  +   R +  +IK L  F + +  G D+G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDD 136
            +R KA+ L +LL DD
Sbjct: 135 NVRNKAQSLTALLKDD 150

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 89.0 bits (219), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 80/136 (58%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT N+P   S   ++ +AQ +Y+  +  EI+ M+ +
Sbjct: 50  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFR 109

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + K+L +L+YL++ GSE  +   R +  ++K L  F + +  G D+G 
Sbjct: 110 RFTEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVDSQGRDQGI 169

Query: 121 IIRVKAKELVSLLNDD 136
            +R +AK L  LL DD
Sbjct: 170 NVRTRAKALTELLGDD 185

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 87.8 bits (216), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 79/136 (58%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+P   S   +  +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + KS+ +L+YLV+ GSE  +   R N  +I+ L  F + +  G D+G 
Sbjct: 75  RFLEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDD 136
            +R + K LV LL DD
Sbjct: 135 NVRNRTKALVKLLEDD 150

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 88.2 bits (217), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 79/136 (58%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+P   S   +  +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + KSL + DYL++ GSE  +   R +  +IK L  F + +  G D+G 
Sbjct: 75  RYTEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDD 136
            +R KA+ LV+ L DD
Sbjct: 135 NVRNKAQSLVAFLKDD 150

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 81/136 (59%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT N+P   S   ++ +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +L+YL++ GSE  +   R +  ++K L  F + +  G D+G 
Sbjct: 75  RFTEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYIDSQGRDQGV 134

Query: 121 IIRVKAKELVSLLNDD 136
            +R +A  L +LL DD
Sbjct: 135 NVRNRAAALTALLADD 150

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 76/136 (55%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR+AT N+        +  +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + KS+ +L+YL+  GSE  +   R    +IK L  F + +  G D+G 
Sbjct: 75  RFVEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDD 136
            +R + + LV LLN+D
Sbjct: 135 NVRNRTQALVQLLNND 150

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 78/140 (55%), Gaps = 12/140 (8%)

Query: 5   FVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL 63
           F+RS +NM  G S+T+V V+ AT +D  + +   L ++++  +Y +    EI  ++ +RL
Sbjct: 3   FIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRRL 60

Query: 64  NDKGKYWR-------HVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGF 116
           +  G Y +       H+ K+LT++ YL+  GS + V W R+  Y++ TLREF    +   
Sbjct: 61  S--GNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREFNVSADKDR 118

Query: 117 DEGQIIRVKAKELVSLLNDD 136
              + +R+ + +L  LL DD
Sbjct: 119 KMAEQVRMLSIKLSKLLKDD 138

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 71/136 (52%), Gaps = 1/136 (0%)

Query: 2   SKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K+F R A+N +   +  +  VR+AT NDP   S+  +  +   +++     +I++ML  
Sbjct: 15  AKKFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLN 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + KS+ +L YL+  GS   V   + N  +IK L  F   ++ G+++  
Sbjct: 75  RFLEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDDQGYNQSS 134

Query: 121 IIRVKAKELVSLLNDD 136
            I    + L+ L+ DD
Sbjct: 135 KISKATERLIELMTDD 150

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 73/138 (52%), Gaps = 8/138 (5%)

Query: 5   FVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL 63
            +++ +N+  G SST+V  R+AT +D    +  +L ++L+  +Y      EI  ++ KRL
Sbjct: 3   LLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKRL 60

Query: 64  N-----DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDE 118
           +        K   H+ K+LT++ YL+  GS+  V+W R   Y+I TL+EF   + +    
Sbjct: 61  SGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEFNGGSRTKERM 120

Query: 119 GQIIRVKAKELVSLLNDD 136
              IR  A  L ++L D+
Sbjct: 121 ASQIRNLASSLAAILRDE 138

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 72/135 (53%), Gaps = 8/135 (5%)

Query: 8   SAKNMVKGYSSTQVLVRDATANDPRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           S +N V+  S+T+  V++AT ++  + +  TL ++++  +Y      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SATEAKVKEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKKRLTGS 63

Query: 67  GKY-----WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
            K        H+ K++T++ YL+  GS + + W R N  + + L++F   +E      + 
Sbjct: 64  SKKSSHRNCVHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEVIHEDDEKMAEQ 123

Query: 122 IRVKAKELVSLLNDD 136
           IR  A +L  L+NDD
Sbjct: 124 IRYIAGDLCILINDD 138

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 75/135 (55%), Gaps = 8/135 (5%)

Query: 8   SAKNMVKGYSSTQVLVRDATANDPRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           S + +V+  S+T++ V+ AT  +  + +  TL ++++  +Y      EI+ ++ KRL   
Sbjct: 6   SVRTLVQ--STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVVRKRLMGH 63

Query: 67  G-----KYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
           G     K   H+ K+LT++ YL+  GS + + W R N  ++  L+EF  ++ +    GQ 
Sbjct: 64  GRRNSHKICIHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEFNVQDRNDEKIGQQ 123

Query: 122 IRVKAKELVSLLNDD 136
           IR  +++L +L+ DD
Sbjct: 124 IRAMSQDLCTLIKDD 138

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 70/135 (51%), Gaps = 8/135 (5%)

Query: 8   SAKNMVKGYSSTQVLVRDATANDPRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL--- 63
           S +N V+  S T+  VR AT +D  + +  TL ++++  +Y      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SPTESKVRQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRLTGY 63

Query: 64  --NDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
              +  K   H+ K+LT++ YL+  GS + + W R N  + + L+ F  +N      GQ 
Sbjct: 64  SKKNSHKNCVHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNFEVQNLEDEKMGQQ 123

Query: 122 IRVKAKELVSLLNDD 136
           I     ++ +++NDD
Sbjct: 124 IVFICNDICNIINDD 138

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 64/130 (49%), Gaps = 6/130 (4%)

Query: 13  VKGYSSTQVLVRDATANDPRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWR 71
           V G SST++ VR AT  D +T +  TL ++++  +Y      EI  +L +RL+  G+   
Sbjct: 9   VFGPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTS 68

Query: 72  H-----VAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKA 126
           H     + K+LT++ YL+  GSE  V W R N    + L+      +      + IR  +
Sbjct: 69  HKNSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECLKSCEVSQKRDEPLAKQIRSMS 128

Query: 127 KELVSLLNDD 136
            ++   + DD
Sbjct: 129 NQICDCVKDD 138

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 71/136 (52%), Gaps = 11/136 (8%)

Query: 5   FVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL 63
           F+ S +++  G SST V V+ AT +     +  +L +++A  +Y      EI  +L KRL
Sbjct: 3   FLSSVRHL--GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVLKKRL 60

Query: 64  -----NDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRH---ENESG 115
                    K   ++ K+LT++ +LV  GSE C+ W R +  +I++ ++F     E +  
Sbjct: 61  VGNYKKTPSKRAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRDGEKKQM 120

Query: 116 FDEGQIIRVKAKELVS 131
            ++ Q++  K  +L++
Sbjct: 121 VNQIQLLSCKLCQLLT 136

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 64/128 (50%), Gaps = 6/128 (4%)

Query: 15  GYSSTQVLVRDATANDPRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL---NDKGKYW 70
           G S T++  ++AT +D  + +  +L ++++  +Y S    EI  ++ KRL   N K  + 
Sbjct: 11  GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKRLSGNNRKSSHK 70

Query: 71  R--HVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKAKE 128
              H+ K+LT+  YL+  GS   V W R   Y+I +L+EF   +         IR  A  
Sbjct: 71  NAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEFTIGSRGQERMAVQIRSLAST 130

Query: 129 LVSLLNDD 136
           L  +L DD
Sbjct: 131 LSVILRDD 138

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 66/120 (55%), Gaps = 10/120 (8%)

Query: 15  GYSSTQVLVRDATANDPRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWR-- 71
           G S+TQ+ V+ AT ++    +  TL ++L+  +Y      EI +++ KRL +     +  
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 72  -----HVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKA 126
                 V K+LT+++YL+  GSE  VLW R +   I+ L+++   N+   D+ ++ ++K+
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDYHCSNDK--DKSKVKQIKS 128

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 65/127 (51%), Gaps = 7/127 (5%)

Query: 17  SSTQVLVRDATANDPRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ D  + +  TL ++++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLLLGQNRRNSHRS 72

Query: 70  WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKAKEL 129
              V K+LT++ YL+  GS   + W + N  +I+ L +F+ ++      G+ IR  ++ L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQAQDARDDRNGEEIRKLSRNL 132

Query: 130 VSLLNDD 136
             LL DD
Sbjct: 133 HELLQDD 139

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 75/136 (55%), Gaps = 11/136 (8%)

Query: 8   SAKNMVKGYSSTQVLVRDATANDPRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           S +N V+  S T++ VR AT ++  + +  TL ++++  +Y +    EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKRLTGY 63

Query: 67  GKY-----WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
           GK        H+ K+LT++ YL+  GS   + W  EN  + + ++ F   +++  DE   
Sbjct: 64  GKKSSHRNCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNFE-VSDTIHDEKFA 122

Query: 122 IRVK--AKELVSLLND 135
           I+++  ++ ++ L+N+
Sbjct: 123 IQIRDLSERILELINN 138

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 68/126 (53%), Gaps = 10/126 (7%)

Query: 8   SAKNMVKGY--SSTQVLVRDATANDPRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLN 64
           S  +  KG+  S T++ VR AT ++    +  TL ++++  +Y      +++ ++ KRL+
Sbjct: 2   SLMHTFKGFLLSPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLS 61

Query: 65  -----DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEG 119
                +  +   HV K+LT++ YL+  GS + + W + + YVI+ L  F  E +S  DE 
Sbjct: 62  GVNKRNSHRTCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSF--EAQSSSDEP 119

Query: 120 QIIRVK 125
            + +++
Sbjct: 120 MVNQIR 125

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 64/127 (50%), Gaps = 7/127 (5%)

Query: 17  SSTQVLVRDATANDPRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ D  + +  TL ++++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKAKEL 129
              V K+LT++ YL+  GS   + W + N  +I+ L  F  ++     + + IR  ++ L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILENFHIQDVRDERKREEIRKLSRNL 132

Query: 130 VSLLNDD 136
           + LL DD
Sbjct: 133 LELLQDD 139

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 63/132 (47%), Gaps = 8/132 (6%)

Query: 13  VKGY--SSTQVLVRDATANDPRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLNDKGKY 69
           VK +  S T+  V+ AT  D    +  TL ++++  +Y      EI+ +L KRL+   + 
Sbjct: 7   VKSFVQSPTESKVKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRLSGYSRK 66

Query: 70  WRH-----VAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRV 124
             H     + K+LT++ YL+  GS   V W R N  +I  L   + E       G  I+ 
Sbjct: 67  TSHKNCIFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNLISEKVEYPKDDKMGPEIKS 126

Query: 125 KAKELVSLLNDD 136
            A +L+ L+ DD
Sbjct: 127 IAADLMELIQDD 138

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
           YAP1801Protein involved in clathrin cage assembly; binds
           Pan1p and clathrin; homologous to Yap1802p, member of
           the AP180 protein family
          Length = 637

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 46/88 (52%), Gaps = 5/88 (5%)

Query: 22  LVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT      P    LD +   + +  DF+EI+  LD R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTA--WTIVYKSLLVVH 64

Query: 82  YLVRFGSENCVL--WCRE-NFYVIKTLR 106
            ++R GS++  L  + R   F+ I+ +R
Sbjct: 65  LMIREGSKDVALRYYSRNLEFFDIENIR 92

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 78/143 (54%), Gaps = 17/143 (11%)

Query: 8   SAKNMVKGYSSTQVLVRDATANDPRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLND- 65
           + KN V+  + T+  V+ AT ++  T +  TL ++++  +Y      +I+ ++ KRL+  
Sbjct: 6   TVKNFVQ--TPTESKVKQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRLSSA 63

Query: 66  --KGKYWRH-----VAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLRE---FRHENESG 115
               K   H     + K+LT++ YL+  GS   + W R NFY+++ + +   F+ ++ S 
Sbjct: 64  TSSNKKLSHKTSVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENITKKCNFQLQDNSA 123

Query: 116 FDEGQI--IRVKAKELVSLLNDD 136
            D   I  I+V A+++ +L+N++
Sbjct: 124 -DSKMIGQIKVIAEDMTNLINNE 145

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 59/127 (46%), Gaps = 6/127 (4%)

Query: 15  GYSSTQVLVRDATA-NDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKG-----K 68
           G S T   VR AT  N+    S   + ++   +Y      ++  +L KRL+        K
Sbjct: 11  GSSPTAAKVRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSHK 70

Query: 69  YWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKAKE 128
              H+ K+LT+ +YL+  GSE+ V W +    +++ L++F   NE        IR  +  
Sbjct: 71  NAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDFTTGNERDSHMASQIRSFSLS 130

Query: 129 LVSLLND 135
           L+ L+ +
Sbjct: 131 LLELMQN 137

>TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.335
           YDR153C
          Length = 491

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 69/160 (43%), Gaps = 30/160 (18%)

Query: 6   VRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+NM+  Y   Q+ +R AT  D   P+   LD +     + V   +I+D + KRL D
Sbjct: 20  ARYAQNMIIAYEPYQIDIRQATNTDSWGPTKKHLDQIL-LDRNKVPLRKIVDYIMKRLMD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV-------RFGSENCVLWCRENF 99
                               G  WR V KSL VL +L+       +       L     F
Sbjct: 79  HINTRPRNLYDRARKDYVNYGTEWRVVFKSLIVLKFLLLNVDPGEQLDDLVEYLLNHYGF 138

Query: 100 YVIKTLREFRHENES-GFD--EGQIIRVKAKELVSLLNDD 136
           +    L  ++ +N S G D    ++I++K +E++ L+ND+
Sbjct: 139 FKHDILEIYQVQNSSDGKDSKHQEVIQLKCQEIIELINDE 178

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 73/148 (49%), Gaps = 18/148 (12%)

Query: 5   FVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL 63
           F  S +N+V  YS T++ VR AT  +    S  TL ++++  +Y +    EI+ +L K+L
Sbjct: 3   FFNSVRNLV--YSQTELKVRQATDENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKKL 60

Query: 64  -------NDKG----KYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHEN 112
                  N  G    K    V K+ T++ YL+  GS + + W + N  V++ L +    N
Sbjct: 61  SLLYGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLNNGVLQILAKVDSNN 120

Query: 113 ESGFDEGQIIRVKA----KELVSLLNDD 136
               DE   I  +A    K+++ L+ND+
Sbjct: 121 HITDDEDLHILNQAQKITKDIILLINDN 148

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
           similar to uniprot|P53309 Saccharomyces cerevisiae
           YGR241C YAP1802 Yeast Assembly Polypeptide, member of
           AP180 protein family, binds Pan1p and clathrin; member
           of clathrin assembly polypeptide AP180 family and weakly
           similar to uniprot|P38856 Saccharomyces cerevisiae
           YHR161C YAP1801 Yeast Assembly Polypeptide member of
           AP180 protein family binds Pan1p and clathrin clathrin
           assembly protein
          Length = 669

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 43/96 (44%), Gaps = 2/96 (2%)

Query: 22  LVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT      P    +D +   + DS +F EIM  L+ R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILLGTSDSSEFMEIMKALESRINDTA--WTIVYKSLIVIH 64

Query: 82  YLVRFGSENCVLWCRENFYVIKTLREFRHENESGFD 117
            ++R G  +  +    +      LR+  H   S  D
Sbjct: 65  LMMRDGDRDVTIKYLSHHLEFFQLRDVFHSKLSSGD 100

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
           YHR161C (REAL)
          Length = 621

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 44/88 (50%), Gaps = 5/88 (5%)

Query: 22  LVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT      P    LD +   +    DF+EI+  LD R+ND    W  V K+L V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLATGSEEDFYEIVKALDSRVNDTA--WTIVYKTLLVVH 64

Query: 82  YLVRFGSENCVL--WCRE-NFYVIKTLR 106
            ++R G ++  L  + R   F+ I+ +R
Sbjct: 65  LMMREGKKDVALRYYSRNLEFFSIENIR 92

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
           YHR161C (REAL)
          Length = 627

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 45/88 (51%), Gaps = 5/88 (5%)

Query: 22  LVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT      P    LD +   +    DF+EI+  L+ R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82  YLVRFGSENCVL--WCRE-NFYVIKTLR 106
            ++R G+++  L  + R   F+ I+ +R
Sbjct: 65  LMIREGAKDVALRYYSRNLEFFDIENIR 92

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 51/100 (51%), Gaps = 7/100 (7%)

Query: 17  SSTQVLVRDATANDPRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT  D  + +  TL ++++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFR 109
              V K+LT++ YL+  GS   + W + N  +I+ L +F+
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQ 112

>TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa]
          {ON} Anc_5.84 YGR241C
          Length = 680

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 34/72 (47%), Gaps = 2/72 (2%)

Query: 22 LVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
          LV+ AT      P    +D +   S D  DF EI+  L  R++D    W  V KSL V  
Sbjct: 7  LVKGATKIKMAPPKQKYIDPILMGSTDPRDFHEIIRALYSRISDSA--WTVVYKSLIVTH 64

Query: 82 YLVRFGSENCVL 93
           L+R G ++  L
Sbjct: 65 LLIREGEKDITL 76

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 50/99 (50%), Gaps = 7/99 (7%)

Query: 17  SSTQVLVRDATANDPRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT  D  + +  TL ++++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNRRNSHRN 72

Query: 70  WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREF 108
              V K+LT++ YL+  GS   + W + N  +++ L +F
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKSNMILVEILEDF 111

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 42/98 (42%), Gaps = 20/98 (20%)

Query: 6   VRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+NM+  Y   QV VR AT  D   P+   L+ + +  Y  V  + I +   KRL D
Sbjct: 20  ARFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRY-QVPMYLITEYTLKRLID 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV 84
                               G  WR V K LTV++YL+
Sbjct: 79  HIATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLL 116

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 47/113 (41%), Gaps = 24/113 (21%)

Query: 6   VRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT  D   P+   L  + +  Y  V  + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLVRFGSE----NCVLWC 95
                               G  WR V K L V+D+L+   SE    N VL C
Sbjct: 79  HIASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSEGDELNQVLSC 131

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 49/119 (41%), Gaps = 24/119 (20%)

Query: 7   RSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           R  +NM+  Y   Q+ +R AT  D   P+   L  + +  Y SV  + + + + KR+ D 
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKY-SVPLYLMTEYVLKRIVDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYLVRFGSE----NCVLWCRENFYVI 102
                              G  WR + K L V++YL+   SE    N V  C EN   I
Sbjct: 80  LAKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSEPEELNQVKSCLENHKQI 138

>TPHA0A05210 Chr1 complement(1173573..1175471) [1899 bp, 632 aa]
           {ON} Anc_5.84 YGR241C
          Length = 632

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 40/96 (41%), Gaps = 2/96 (2%)

Query: 22  LVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT      P    ++ +   + D  DF EI+  L  R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKLAPPKDKYIEPILMGTNDPHDFREIVKALHSRVNDSA--WTVVYKSLIVIH 64

Query: 82  YLVRFGSENCVLWCRENFYVIKTLREFRHENESGFD 117
            L+R G  +  +    N      L    H N S  D
Sbjct: 65  VLMREGDRDVAIKYFSNNLNYFGLAGIHHSNFSNGD 100

>KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]
           {ON} similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
           YDR153C ENT5 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
           clathrin
          Length = 399

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 65/159 (40%), Gaps = 31/159 (19%)

Query: 6   VRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   Q+ +R AT  D   P+   L  + +  Y+ V  F + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDSWGPTPKHLAKVMRHRYE-VSMFLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV----RFGSENCVLWCRENFYVI 102
                               G  WR V K L +L+YL+    R    + VL C +    I
Sbjct: 79  HMAKRPKNMYEKARKQYVNYGNEWRVVLKCLVLLEYLLMRSDRGKETDQVLSCLQAHKHI 138

Query: 103 KTLREFRHENESGFDEGQI------IRVKAKELVSLLND 135
            T    ++  +   D G++      I+ K + ++ L+ D
Sbjct: 139 LTKETMQYRVDFSSD-GKMELHERGIKKKCEHIIQLIED 176

>KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa]
           {ON} Anc_8.335 YDR153C
          Length = 382

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 20/97 (20%)

Query: 7   RSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ VR AT  D   P+   L+ + +  +  V  + + + + KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDVRRATNTDAWGPTTKHLEKVMRNRF-QVPMYLVTEYILKRLIDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYLV 84
                              G  WR V K LTV++YL+
Sbjct: 80  IATKPKNLYEKARKEYVNYGSEWRVVLKCLTVIEYLL 116

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 67/159 (42%), Gaps = 31/159 (19%)

Query: 6   VRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT  D   P+   L  + +  Y  V  + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-NCVLWCRENFYVI 102
                               G  WR V K LTV++YL   V  G E N V+ C +    I
Sbjct: 79  HIAVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLMLNVDDGDELNQVVRCLDTHKHI 138

Query: 103 KTLREFRHENESGFDEGQI------IRVKAKELVSLLND 135
            T RE         ++G++      IR K ++++  L D
Sbjct: 139 LT-REIPMYKVGFSNDGKMEIHERGIRKKGEDILQYLED 176

>CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} similar
           to uniprot|Q03769 Saccharomyces cerevisiae YDR153c ENT5
          Length = 412

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 41/98 (41%), Gaps = 20/98 (20%)

Query: 6   VRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV VR AT  D   P+   L  + +  Y  V  + I + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDVRRATNTDSWGPTPKHLAKVLRNRY-QVPLYLITEYILKRLID 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV 84
                               G  WR V K L V++YL+
Sbjct: 79  HIAQRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEYLL 116

>KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.335
           YDR153C
          Length = 421

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 20/98 (20%)

Query: 6   VRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT  D   P+   L  + +  Y  V  + + + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRHRY-QVPMYLMTEYILKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV 84
                               G  WR V K LTV+++L+
Sbjct: 79  HIATRPKNLYEKARKDYVNYGAEWRVVLKCLTVIEFLM 116

>KNAG0E00610 Chr5 complement(102826..104640) [1815 bp, 604 aa]
          {ON} Anc_5.84 YGR241C
          Length = 604

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 31/72 (43%), Gaps = 2/72 (2%)

Query: 22 LVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
          LV+ AT      P    +D +   +    DF EI+  L  R+ D    W  V KSL V  
Sbjct: 7  LVKGATKIKMAPPKAKYVDPILLGTAQRDDFREIVGALRTRVGDSA--WTVVYKSLLVCH 64

Query: 82 YLVRFGSENCVL 93
           + R G E  VL
Sbjct: 65 LMFREGDEQIVL 76

>TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.335
           YDR153C
          Length = 385

 Score = 34.7 bits (78), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 40/97 (41%), Gaps = 20/97 (20%)

Query: 7   RSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           R  +NM+  Y   Q+ VR A+  D   P+   L  + +  Y SV  + I +   KRL D 
Sbjct: 21  RFMQNMIVQYEPYQIDVRRASNTDAWGPTSKHLQKVLRHKY-SVPLYLITEYTLKRLIDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYLV 84
                              G  WR V K L +LD+L+
Sbjct: 80  IATNSKNVYEKARKEYVNFGSEWRVVFKCLVILDFLL 116

>TBLA0F02620 Chr6 complement(634992..636440) [1449 bp, 482 aa] {ON}
           Anc_7.471 YPR045C
          Length = 482

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 31/71 (43%), Gaps = 16/71 (22%)

Query: 484 NSQGTGYK-----QVVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGFGNQPQN-------- 530
           N Q T  K     Q++N P   PFLN+ Y G+PS   +P     G G  PQ         
Sbjct: 23  NDQATNQKSHENNQIIN-PSTTPFLNAGYPGIPSLPNIPPTLMGGVGMVPQPLPNPVRSM 81

Query: 531 --PGMNSPPQN 539
             PG NS  QN
Sbjct: 82  VLPGPNSATQN 92

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.132    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,367,115
Number of extensions: 1505588
Number of successful extensions: 4497
Number of sequences better than 10.0: 97
Number of HSP's gapped: 4569
Number of HSP's successfully gapped: 151
Length of query: 618
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 502
Effective length of database: 40,180,143
Effective search space: 20170431786
Effective search space used: 20170431786
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)