Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_10.2997.344ON32030316220.0
Skud_12.2687.344ON31830314480.0
YLR205C (HMX1)7.344ON31730314480.0
Smik_12.2637.344ON31830314230.0
TDEL0C020307.344ON3113009621e-130
KLLA0D12474g7.344ON3122679401e-127
ZYRO0F11594g7.344ON3092649301e-125
SAKL0F11242g7.344ON3092999131e-123
Kwal_56.246247.344ON3072978531e-114
KLTH0H01386g7.344ON3072968451e-112
Ecym_47297.344ON3262718001e-105
NCAS0E028907.344ON3153017861e-103
CAGL0A03905g7.344ON2822547214e-94
NDAI0E045007.344ON3273157185e-93
Kpol_530.367.344ON3112746923e-89
TPHA0F029207.344ON3202756751e-86
ACL154W7.344ON3192656221e-78
KAFR0L014707.344ON3002745895e-74
KNAG0B026407.344ON3022735541e-68
KLLA0D19492g2.20ON49685740.93
KNAG0M008106.115ON117477721.7
KLLA0C14234g5.10ON1454191703.0
Suva_6.518.67ON76349703.5
CAGL0K09988g8.216ON19686673.8
KLLA0A09141g5.63ON76071694.6
KAFR0C009303.177ON93664686.0
TPHA0B014607.448ON48562676.1
Skud_6.638.67ON78150677.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_10.299
         (320 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {O...   629   0.0  
Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {O...   562   0.0  
YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}  ...   562   0.0  
Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {O...   552   0.0  
TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON...   375   e-130
KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa] ...   366   e-127
ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar...   362   e-125
SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar...   356   e-123
Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR20...   333   e-114
KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {O...   330   e-112
Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON...   312   e-105
NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON...   307   e-103
CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {O...   282   4e-94
NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {...   281   5e-93
Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON} ...   271   3e-89
TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.34...   264   1e-86
ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homol...   244   1e-78
KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.3...   231   5e-74
KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON...   218   1e-68
KLLA0D19492g Chr4 (1643703..1645193) [1491 bp, 496 aa] {ON} simi...    33   0.93 
KNAG0M00810 Chr13 (138732..142256) [3525 bp, 1174 aa] {ON} Anc_6...    32   1.7  
KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} sim...    32   3.0  
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    32   3.5  
CAGL0K09988g Chr11 (977846..978436) [591 bp, 196 aa] {ON} simila...    30   3.8  
KLLA0A09141g Chr1 (801373..803655) [2283 bp, 760 aa] {ON} weakly...    31   4.6  
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    31   6.0  
TPHA0B01460 Chr2 complement(325847..327304) [1458 bp, 485 aa] {O...    30   6.1  
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    30   7.5  

>Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {ON}
           YLR205C (REAL)
          Length = 320

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/303 (100%), Positives = 303/303 (100%)

Query: 18  GALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLND 77
           GALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLND
Sbjct: 18  GALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLND 77

Query: 78  AVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPLLQQ 137
           AVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPLLQQ
Sbjct: 78  AVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPLLQQ 137

Query: 138 FVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLTQKELVKKG 197
           FVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLTQKELVKKG
Sbjct: 138 FVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLTQKELVKKG 197

Query: 198 TNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFNIVAEIG 257
           TNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFNIVAEIG
Sbjct: 198 TNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFNIVAEIG 257

Query: 258 ELNRRELMSKFSFKCVTYVYEEWMFSKGSASRKAFSTTMLLMLSITAVWILYYFVRQNFL 317
           ELNRRELMSKFSFKCVTYVYEEWMFSKGSASRKAFSTTMLLMLSITAVWILYYFVRQNFL
Sbjct: 258 ELNRRELMSKFSFKCVTYVYEEWMFSKGSASRKAFSTTMLLMLSITAVWILYYFVRQNFL 317

Query: 318 SVV 320
           SVV
Sbjct: 318 SVV 320

>Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/303 (88%), Positives = 286/303 (94%)

Query: 18  GALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLND 77
           GALANRINFHTRDAHNKINTFMGI+MAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLL+D
Sbjct: 16  GALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLHD 75

Query: 78  AVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPLLQQ 137
            V+EKELQ   ILKQFWLEDFRRSTQIYKDLKLLYSN FKSTESLNEFLA FEKPPLLQQ
Sbjct: 76  PVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFLAKFEKPPLLQQ 135

Query: 138 FVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLTQKELVKKG 197
           FV+DIH+NIR+EPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFE+L+QKELVKKG
Sbjct: 136 FVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFERLSQKELVKKG 195

Query: 198 TNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFNIVAEIG 257
           TNFFTFS+LGPTEETRLK EYKKNYELATRTELTEAQKL+IISVA GIFDWNF+IVAEIG
Sbjct: 196 TNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAGGIFDWNFHIVAEIG 255

Query: 258 ELNRRELMSKFSFKCVTYVYEEWMFSKGSASRKAFSTTMLLMLSITAVWILYYFVRQNFL 317
           ELNRRELM KFSFKCVTYVYEEWM  K SA RKAF+T MLLMLSI AVW++Y  V++NFL
Sbjct: 256 ELNRRELMGKFSFKCVTYVYEEWMSDKDSAFRKAFNTAMLLMLSIIAVWVIYLLVKKNFL 315

Query: 318 SVV 320
           S+V
Sbjct: 316 SIV 318

>YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}
           HMX1ER localized heme oxygenase, involved in heme
           degradation during iron starvation and in the oxidative
           stress response; expression is regulated by AFT1 and
           oxidative stress; relocates to the perinuclear region in
           the presence of oxidants
          Length = 317

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/303 (87%), Positives = 289/303 (95%), Gaps = 1/303 (0%)

Query: 18  GALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLND 77
           GALANRINF TRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLND
Sbjct: 16  GALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLND 75

Query: 78  AVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPLLQQ 137
            V+E+ELQ   ILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATF+KPPLLQQ
Sbjct: 76  PVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFQKPPLLQQ 135

Query: 138 FVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLTQKELVKKG 197
           F+++IH+NI +EPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKL+QKELVKKG
Sbjct: 136 FINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLSQKELVKKG 195

Query: 198 TNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFNIVAEIG 257
           TNFFTFS+LGPTEETRLKWEYKKNYELATRTELTEAQKL+IISVAEGIFDWNFNIVAEIG
Sbjct: 196 TNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVAEGIFDWNFNIVAEIG 255

Query: 258 ELNRRELMSKFSFKCVTYVYEEWMFSKGSASRKAFSTTMLLMLSITAVWILYYFVRQNFL 317
           ELNRRELM KFSFKC+TY+YEEWMF+K SA+R+A  T MLL+LSI A+W+LY+ V+ +FL
Sbjct: 256 ELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVLSIIAIWVLYFLVK-SFL 314

Query: 318 SVV 320
           S+V
Sbjct: 315 SIV 317

>Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/303 (88%), Positives = 291/303 (96%)

Query: 18  GALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLND 77
           GALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLND
Sbjct: 16  GALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLND 75

Query: 78  AVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPLLQQ 137
            V+ KELQ   ILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPP+LQQ
Sbjct: 76  PVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPVLQQ 135

Query: 138 FVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLTQKELVKKG 197
           FV++IH+NI++EPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKL+QKELVKKG
Sbjct: 136 FVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLSQKELVKKG 195

Query: 198 TNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFNIVAEIG 257
           TNFFTFS+LGPTEETRLK EYKKNYELATRTELTEAQKL+IISVAEGIFDWNFNIVAEIG
Sbjct: 196 TNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAEGIFDWNFNIVAEIG 255

Query: 258 ELNRRELMSKFSFKCVTYVYEEWMFSKGSASRKAFSTTMLLMLSITAVWILYYFVRQNFL 317
           ELNRRELM KFSFKCVTYVYEEWMF+K SA+RK+F+T +LL+LSI A+W LY+ V+++FL
Sbjct: 256 ELNRRELMGKFSFKCVTYVYEEWMFNKESATRKSFNTVLLLILSIIAIWTLYFLVKKSFL 315

Query: 318 SVV 320
           S+V
Sbjct: 316 SIV 318

>TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON}
           Anc_7.344 YLR205C
          Length = 311

 Score =  375 bits (962), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 171/300 (57%), Positives = 232/300 (77%), Gaps = 3/300 (1%)

Query: 18  GALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLND 77
           GALANRINFHTRDAHNK+N +M +++A A++HGFIYRQGILA+Y++FDA+EQE+DRLLND
Sbjct: 15  GALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDAVEQELDRLLND 74

Query: 78  AVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPLLQQ 137
             +++E Q   +L+QFWLE+FRR+ +I+KDL++LYS  +  +ESL  F+      P LQ 
Sbjct: 75  PQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNFVEHQPLAPQLQS 134

Query: 138 FVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLTQKELVKKG 197
           FVD IH  ++Q+ CTIL+YCHVLYLALFAGGK++RSNLYR  GLFP FE LT KELV +G
Sbjct: 135 FVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFEYLTPKELVIRG 194

Query: 198 TNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFNIVAEIG 257
           TNFFTFS+ G   E +L+W+YK+ YELATR EL+E+QK +I+ V+  IFDWN +++ EIG
Sbjct: 195 TNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFDWNMDVIGEIG 254

Query: 258 ELNRRELMSKFSFKCVTYVYEEWMFSKGSASRKAFSTTMLLMLSITAVWILYYFVRQNFL 317
           E+NR ELMSKFSFK +TY+ EEW +S   + R   S   +++++I   +++ Y V + F+
Sbjct: 255 EMNRNELMSKFSFKLLTYLSEEWKYSTILSKR---SKDSIIVMAILIQFLVAYIVLRKFI 311

>KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa]
           {ON} similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 312

 Score =  366 bits (940), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 168/267 (62%), Positives = 216/267 (80%)

Query: 18  GALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLND 77
           GALANRINF TRD HNKIN +M +KMA AMRHGFIYRQGI+AYYYVF AIEQEIDRLL  
Sbjct: 16  GALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAIEQEIDRLLEH 75

Query: 78  AVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPLLQQ 137
            V+ ++ +  GIL+QFW E+FRRS ++  DL++LY++ +  +E L EFL  F+ P  LQ+
Sbjct: 76  PVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQEFLDGFQLPAKLQE 135

Query: 138 FVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLTQKELVKKG 197
           FVD+IH N+++EP TIL+YCHVLYLALFAGG++++SNLYR +GLFP F  L+ KELV++ 
Sbjct: 136 FVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPKFGHLSPKELVRRA 195

Query: 198 TNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFNIVAEIG 257
           TNFFTFSE G  +E RL+W+YKK YELATRTELTEA+KL+II V++ IF  N  +VAEIG
Sbjct: 196 TNFFTFSEEGVDDENRLRWQYKKGYELATRTELTEAEKLRIIEVSQTIFQRNMEVVAEIG 255

Query: 258 ELNRRELMSKFSFKCVTYVYEEWMFSK 284
           E+NR ELM KFS+K ++++ EEW +S+
Sbjct: 256 EINRAELMGKFSYKLISFLSEEWKYSE 282

>ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  362 bits (930), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 164/264 (62%), Positives = 210/264 (79%), Gaps = 1/264 (0%)

Query: 18  GALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLND 77
           GALANRINFHTRDAHNKIN +M +++A A++HG+I+RQGILAYYY+F AIEQE+DR+++ 
Sbjct: 11  GALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIEQELDRIMDH 70

Query: 78  AVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEK-PPLLQ 136
           A +EKE+Q   +L +FW+ DFRR+ +I++DL LLYS  F +  SL +FL +     P LQ
Sbjct: 71  ARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLTSGNHLAPTLQ 130

Query: 137 QFVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLTQKELVKK 196
            FVD IH N+++EPCTIL+YCHVLYLALFAGGK++RSNLYR  GLFP F+ L+ +ELV++
Sbjct: 131 AFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQHLSPRELVQR 190

Query: 197 GTNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFNIVAEI 256
           GTNFFTFSE G   E +L+W YK+ YELATR ELTE QK KIISV+  IF WN   +AEI
Sbjct: 191 GTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQWNMETIAEI 250

Query: 257 GELNRRELMSKFSFKCVTYVYEEW 280
           GELNR+ELM   SF+ +TY++EEW
Sbjct: 251 GELNRQELMGSVSFRLLTYLHEEW 274

>SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  356 bits (913), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 169/299 (56%), Positives = 222/299 (74%), Gaps = 2/299 (0%)

Query: 18  GALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLND 77
           GALANRINFHTRD+HNKIN  M +K+A AM+HG IYRQGILA+YY+F A+EQEID LL +
Sbjct: 13  GALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAVEQEIDNLLQN 72

Query: 78  AVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPLLQQ 137
           A +  ELQ   IL QFW E+FRRS  I++DL+LLYS  + +   L+ FL     PP  Q 
Sbjct: 73  ASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFLDDNVLPPQQQA 132

Query: 138 FVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLTQKELVKKG 197
           FV+ IH  +R++P TIL+YCHVLYLALFAGGKL++SN+YR  GLFP F+ LT +++V++G
Sbjct: 133 FVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQHLTPEQIVRRG 192

Query: 198 TNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFNIVAEIG 257
           TNFFTFSE G   E +L+WEYKK YELATR ELTE QK +II V+  IFDWN +++ E+G
Sbjct: 193 TNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIFDWNMDVIGELG 252

Query: 258 ELNRRELMSKFSFKCVTYVYEEWMFSKGSASRKAFSTTMLLMLSITAVWILYYFVRQNF 316
           E+NR ELM KFSFK V+++ EEW +S+  +  K    T+L++ +I    + Y+ +R+ F
Sbjct: 253 EINRNELMGKFSFKLVSFILEEWKYSEKLS--KENKITILVIFAILQFLLAYWLLRKLF 309

>Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR205C
           (HMX1) - Putative heme oxygenase [contig 161] FULL
          Length = 307

 Score =  333 bits (853), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 157/297 (52%), Positives = 215/297 (72%), Gaps = 2/297 (0%)

Query: 18  GALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLND 77
           GALANRINF+TRD HNKI+  M +K A AM+HGFIYRQG+LA++YVF AIEQEIDRLL +
Sbjct: 11  GALANRINFYTRDEHNKIDKQMSVKFAFAMKHGFIYRQGLLAFFYVFQAIEQEIDRLLQN 70

Query: 78  AVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPLLQQ 137
           A + +E+Q   IL QFW+  F R+ +IY+DLKLLY+  F S E L+ FL     PP  Q 
Sbjct: 71  AQTAEEVQTRDILLQFWVSSFSRTPRIYQDLKLLYAKEFPSDEQLSLFLQQNTLPPEQQG 130

Query: 138 FVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLTQKELVKKG 197
           FVD +H+++R  P +IL++CHVLYLALFAGG+++RS +YR  GLFP F  LT +E+V+KG
Sbjct: 131 FVDFVHESVRARPTSILAFCHVLYLALFAGGRVMRSTIYRSTGLFPKFPDLTPEEVVRKG 190

Query: 198 TNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFNIVAEIG 257
           TNFFTFS+ G   E +L+ EYK+ YELATR  LTE QKL I+ VA   F+WN  +++EIG
Sbjct: 191 TNFFTFSDDGVQAENQLRKEYKRGYELATREGLTEDQKLNILEVAAATFEWNTRVISEIG 250

Query: 258 ELNRRELMSKFSFKCVTYVYEEWMFSKGSASRKAFSTTMLLMLSITAVWILYYFVRQ 314
           E+NR+ELM K SFK V++  +EW  ++    R+   + +L   ++  + ++Y+ +R+
Sbjct: 251 EINRQELMGKLSFKLVSFAIDEWKHTEKLTRRQ--KSIVLATGAVIQILVMYWMLRK 305

>KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 307

 Score =  330 bits (845), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 161/296 (54%), Positives = 210/296 (70%), Gaps = 2/296 (0%)

Query: 18  GALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLND 77
           GALANRINFHTRD HNKI+  M  K A AM+HGFIYRQG+LA++YVF AIEQE+DRL  +
Sbjct: 11  GALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIEQELDRLRQE 70

Query: 78  AVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPLLQQ 137
           A + +E Q   IL QFW E+FRR+ +I +DL+LLY+  F ++ SL  FL      P LQ 
Sbjct: 71  AQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEETTLAPELQG 130

Query: 138 FVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLTQKELVKKG 197
           FVD +H +IR  P  IL+YCHVLYLALFAGG+++RS +YR  GLFP F  LT +E+V++G
Sbjct: 131 FVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPNLTTEEVVRRG 190

Query: 198 TNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFNIVAEIG 257
           TNFFTFS+ G   E +L+  YK+ YELATR  LTE QKL I+ V+  IF+WN  +V EIG
Sbjct: 191 TNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEWNTRVVTEIG 250

Query: 258 ELNRRELMSKFSFKCVTYVYEEWMFS-KGSASRKAFSTTMLLMLSITAV-WILYYF 311
           E+NR+ELM K SF+ +T+V EEW +S K +  +K+      ++L I  + W+L  F
Sbjct: 251 EINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKSLVLATGVVLQILMMYWVLRKF 306

>Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON}
           similar to Ashbya gossypii ACL154W
          Length = 326

 Score =  312 bits (800), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 149/271 (54%), Positives = 198/271 (73%)

Query: 18  GALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLND 77
           GALANRINF TRD H K + F+  KMA+AMRHGFIYRQGILA+YY+F A+EQ+IDRLL  
Sbjct: 29  GALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAVEQQIDRLLET 88

Query: 78  AVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPLLQQ 137
             +++ELQ   IL+QFW E+FRRS ++ +DL+  Y + + +   L +FL  FE PP LQ+
Sbjct: 89  PSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFLNDFELPPKLQR 148

Query: 138 FVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLTQKELVKKG 197
           FVD I D   + P TIL+YCHVLY ALFAGGK++RSN+YR +GLFP  + ++  E  + G
Sbjct: 149 FVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGLFPKPKGISAAESSRNG 208

Query: 198 TNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFNIVAEIG 257
           TNFFTFS+ G  EE +L+W+YKKNYELATR  L E QKL+II V+   F    +I+ EIG
Sbjct: 209 TNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQKLEIIDVSIANFQAVMDILGEIG 268

Query: 258 ELNRRELMSKFSFKCVTYVYEEWMFSKGSAS 288
           E N++ELM+ FSFK +T++  EW +++  +S
Sbjct: 269 ETNKKELMNIFSFKLLTFLSNEWRYNQKLSS 299

>NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON}
           Anc_7.344 YLR205C
          Length = 315

 Score =  307 bits (786), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 148/301 (49%), Positives = 206/301 (68%), Gaps = 4/301 (1%)

Query: 19  ALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLNDA 78
           ALANRINF TRDAHNKIN  M IK+AIA+RHGFIYRQGIL YYY+F  +E+EI +L    
Sbjct: 17  ALANRINFQTRDAHNKINKKMSIKLAIALRHGFIYRQGILTYYYIFKVVEEEIIKLTTSP 76

Query: 79  VSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLAT--FEKPPLLQ 136
            + +E++   +L + W+ +F R+  + KDL+LLY + + + E+L  FL T   E PP+L 
Sbjct: 77  TTSEEVKIGNLLSKTWIPEFNRTENLLKDLQLLYHDEYPTKEALQLFLETNATELPPVLD 136

Query: 137 QFVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLTQKELVKK 196
            F+  IH +I + PC+I +YCHVLYLALFAGGK+IRS +Y+ LG  PNF  L+ KE+ +K
Sbjct: 137 SFIKYIHQSILENPCSIFAYCHVLYLALFAGGKIIRSKIYKNLGFLPNFNHLSSKEVFEK 196

Query: 197 GTNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFNIVAEI 256
           GTNFF F   G  EET+LK E+KKNYEL TR  L E +K  II  ++ IFD+N   + E+
Sbjct: 197 GTNFFKFGSDGVIEETKLKLEFKKNYELNTRESLNEKEKSIIIETSKKIFDYNLMAMEEL 256

Query: 257 GELNRRELMSKFSFKCVTYVYEEWMFSKGSASRKAFSTTMLLMLSITAVWILYYFVRQNF 316
           G +N+ +LMSK +FK VTY+ EEW F+    S++     M++M+ +  ++   +F+ + F
Sbjct: 257 GSINKEQLMSKLNFKMVTYLLEEWKFNDNFLSKRGKHLIMVVMVLLHMLFA--FFILKRF 314

Query: 317 L 317
           L
Sbjct: 315 L 315

>CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205c
          Length = 282

 Score =  282 bits (721), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 137/254 (53%), Positives = 180/254 (70%), Gaps = 11/254 (4%)

Query: 39  MGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLN----------DAVSEKELQACG 88
           M ++ A+A+RHG +YRQGILA+YYVF AIEQEID LL+            VS+++L A  
Sbjct: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDTATGATGATDVSDQKLLASK 60

Query: 89  ILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPLLQQFVDDIHDNIRQ 148
           I+KQFW+ +FRR+ Q+YKDL LLYS  + ++  L+  L   + PP LQ FVD +H  +RQ
Sbjct: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120

Query: 149 EPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLTQKELVKKGTNFFTFSELGP 208
            P T+L+YCHV+YLALFAGGK++RS LYR  GLFP FE L+ KEL +KGTNFFTFS+ G 
Sbjct: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV 180

Query: 209 TEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFNIVAEIGELNRRELMSKF 268
             E +LKW+YKKNYELATR  L E  KL+II VA+ IF+ N +I+ EIG+LN +E ++  
Sbjct: 181 DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLN-KEALTNN 239

Query: 269 SFKCVTYVYEEWMF 282
               + YV+EE  F
Sbjct: 240 KLDLLQYVFEELKF 253

>NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {ON}
           Anc_7.344 YLR205C
          Length = 327

 Score =  281 bits (718), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 148/315 (46%), Positives = 206/315 (65%), Gaps = 22/315 (6%)

Query: 19  ALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLN-- 76
           ALANRINFHTRDAHNKI+  M +K+A+A+RHG IYRQGIL YYY+F A+E EI+ LL+  
Sbjct: 17  ALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSFN 76

Query: 77  -DAVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEF------LATF 129
            DA  E++ +   +L + WL +F R+ +++KDLKLLYS+ F++ + L  F      L   
Sbjct: 77  TDATKEQK-RTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQ 135

Query: 130 EKPPLLQQFVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLT 189
            K   L QFV+ IH +I+  PC IL+YCHVLYLALFAGGK+I+S +Y+ LG  PNF  L+
Sbjct: 136 NKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNHLS 195

Query: 190 QKELVKKGTNFFTFSELGP--------TEETRLKWEYKKNYELATRTELTEAQKLKIISV 241
            KEL    TNFF F+E           + E +LK ++K+N+EL TR+ L E +KL II +
Sbjct: 196 SKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTIIEI 255

Query: 242 AEGIFDWNFNIVAEIGELNRRELMSKFSFKCVTYVYEEWMFSKGSASRKAFSTTMLLMLS 301
           A+ IF WN   + E+G+ N++ELM+ FSFK + Y++EEW F    + +K F    +LM  
Sbjct: 256 AKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKF--NDSIKKNFKA--ILMFV 311

Query: 302 ITAVWILYYFVRQNF 316
           I  + I ++  R  F
Sbjct: 312 ILLLLIQFFVSRSLF 326

>Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON}
           complement(84853..85788) [936 nt, 312 aa]
          Length = 311

 Score =  271 bits (692), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 133/274 (48%), Positives = 193/274 (70%), Gaps = 9/274 (3%)

Query: 18  GALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLND 77
           GALANRINF TRD HNK++ FMGI++A+A++HGFIYR+G++ +Y++F+ IE EID +LN+
Sbjct: 12  GALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTIETEIDLVLNN 71

Query: 78  AVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTES-LNEFLAT---FEKPP 133
              + + Q   IL  F+L++FRR  +I KDL+LLY   F++    L EF+ +        
Sbjct: 72  ---QDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFINSDRFTNDSE 128

Query: 134 LLQQFVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLTQKEL 193
            LQ FV  I  N  ++PCT+L+YCHVLYLALFAGGK+++SN+ + LG+FP FE L+ KE+
Sbjct: 129 QLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFPKFEHLSHKEI 188

Query: 194 VKKGTNFFTFSE-LGP-TEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFN 251
           + +GTNF+ F++   P T + +L+W YKKNYEL+TR EL E QKL +I  ++ +F    N
Sbjct: 189 IARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKTSKDVFVMLEN 248

Query: 252 IVAEIGELNRRELMSKFSFKCVTYVYEEWMFSKG 285
            +AE+G  NR ELM+ FS+K  T++ EEW ++  
Sbjct: 249 CIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSS 282

>TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.344
           YLR205C
          Length = 320

 Score =  264 bits (675), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 134/275 (48%), Positives = 192/275 (69%), Gaps = 9/275 (3%)

Query: 19  ALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLNDA 78
           ALANRINF TRD HNKI  FM I++A+A+RHGFIYRQG++A+Y++F  IE EID LLN  
Sbjct: 15  ALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTIENEIDNLLNTL 74

Query: 79  VSE---KELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKST-ESLNEFL--ATFEKP 132
            SE    ++Q   ILK F++ +FRR   + +DL +LY   FK   + + +FL   TF K 
Sbjct: 75  DSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLDFLNSETFNKE 134

Query: 133 --PLLQQFVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLTQ 190
             P L  F D I D  +++P TI++YCHVLYLALFAGGK+++SN+ + +GLFP F+ ++ 
Sbjct: 135 NYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVGLFPKFDHMSH 194

Query: 191 KELVKKGTNFFTFSELGPTE-ETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWN 249
           +E+  +G+NFF F++    + +++L++EYKKNYEL+TR EL E QK  II V++ IF   
Sbjct: 195 EEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDIIEVSKNIFVML 254

Query: 250 FNIVAEIGELNRRELMSKFSFKCVTYVYEEWMFSK 284
            N++AEIG  NR +LM  F+ K +TY+ EEW +++
Sbjct: 255 ENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNE 289

>ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR205C (HMX1)
          Length = 319

 Score =  244 bits (622), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 119/265 (44%), Positives = 175/265 (66%), Gaps = 1/265 (0%)

Query: 18  GALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLND 77
           GALANRINFHTR+ H+K + F+  K A+A+RH  IYRQG+LA YY+F ++EQ IDRLL  
Sbjct: 25  GALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRSVEQHIDRLLRA 84

Query: 78  AVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPLLQQ 137
             +  E +   IL+ FW  +F R+  + +D ++ Y+  + ++  L++FL ++E PP L  
Sbjct: 85  PATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFLDSYELPPRLAA 144

Query: 138 FVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLTQKELVKKG 197
            V DI     ++P TIL++CHVLYLALFAGG+++RS L R+LGL P    L+ +E   +G
Sbjct: 145 AVADIEAAALRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPRAAGLSARETQLRG 204

Query: 198 TNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFNIVAEIG 257
           T+FFTF   G  EE + +  YK+ YELATRT L+EA+K  +I  A   FD    ++AE+ 
Sbjct: 205 THFFTFGA-GAGEENKARVAYKRAYELATRTALSEAEKADVIDAARADFDHIQAVMAELA 263

Query: 258 ELNRRELMSKFSFKCVTYVYEEWMF 282
             NR+EL+   S++ +T++ EEW +
Sbjct: 264 VRNRQELLGSPSYRLLTFLGEEWRY 288

>KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.344
           YLR205C
          Length = 300

 Score =  231 bits (589), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 120/274 (43%), Positives = 179/274 (65%), Gaps = 13/274 (4%)

Query: 18  GALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLND 77
            ALANRINFHTRD HN I+  M IK   A+RH FIY+  +L+YYYVF  +E EID ++++
Sbjct: 12  DALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDEIDFIISN 71

Query: 78  AVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPLLQQ 137
             S        IL+ F+ + FRR  QI KDLK L  N  +  +S +++L++    P L +
Sbjct: 72  DRS----HIGEILRGFFNDKFRRKDQILKDLKFL--NVIQD-QSDDQWLSS---RPELCK 121

Query: 138 FVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF--PNFEKLTQKELVK 195
           F++ I  N+ + P  +L+YCHVLYLALFAGG+++R+++ + L  F  P F+K++  +++ 
Sbjct: 122 FLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDKMSHTDVIM 181

Query: 196 KGTNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFNIVAE 255
             TNFF F +     E +LK EYK+NY++ T+ +L E +KL+II ++  IF +NFN++ E
Sbjct: 182 NATNFFKFDK-DIVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFKFNFNLLQE 240

Query: 256 IGELNRRELMSKFSFKCVTYVYEEWMFSKGSASR 289
           IG +N+ ELM  F++K VTYV EEW F K    +
Sbjct: 241 IGTVNKDELMKNFNYKMVTYVVEEWKFRKPQIKK 274

>KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON}
           Anc_7.344 YLR205C
          Length = 302

 Score =  218 bits (554), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 117/273 (42%), Positives = 166/273 (60%), Gaps = 18/273 (6%)

Query: 19  ALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLNDA 78
           ALANRINFHTRD HN+++    +K  +A+RH FIY   +  +Y VF  +EQ ID L+   
Sbjct: 13  ALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTVEQRIDELI--- 69

Query: 79  VSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPLLQQF 138
            SE       IL +F++ +FRR+ +I +DL  L    + + ES       +  PP L  F
Sbjct: 70  ASEGGDGVGAILGEFYVPEFRRADKIKRDLVFL--GEWDTVES-----GQWTPPPQLAGF 122

Query: 139 VDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNF-------EKLTQK 191
           +  +   + ++P T+L+ CHVLYLALFAGG++ +S+L++ LG  PNF       E+++  
Sbjct: 123 LQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDKNGPGEEMSDH 182

Query: 192 ELVKKGTNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFN 251
            LV   TNFF F+E    +E +L+W YK+NYELATR  LTE QKL +I+ +  +F   F 
Sbjct: 183 TLVSNATNFFQFAET-IEDENKLRWTYKRNYELATRDTLTEDQKLAVIAASRDVFRHTFA 241

Query: 252 IVAEIGELNRRELMSKFSFKCVTYVYEEWMFSK 284
           ++ EI + N  ELMS  SFK VTY  EEW F+K
Sbjct: 242 VIEEICQQNHDELMSFRSFKIVTYFLEEWKFNK 274

>KLLA0D19492g Chr4 (1643703..1645193) [1491 bp, 496 aa] {ON} similar
           to uniprot|Q07729 Saccharomyces cerevisiae YDL238C GUD1
           Guanine deaminase a catabolic enzyme of the guanine
           salvage pathway producing xanthine and ammonia from
           guanine activity is low in exponentially-growing
           cultures but expression is increased in post-diauxic and
           stationary-phase cultures
          Length = 496

 Score = 33.1 bits (74), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 41/85 (48%), Gaps = 12/85 (14%)

Query: 142 IHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLTQK--ELVKKGTN 199
           + D  R+E C  LS   VLYLA   G K++  NL  ++G F   ++   +  +L  KG+N
Sbjct: 386 VEDPERKEECK-LSVAEVLYLATMGGAKVL--NLSDKIGSFDVGKEFDAQLIDLSTKGSN 442

Query: 200 FFTF-------SELGPTEETRLKWE 217
              F        ++ P  + R+K E
Sbjct: 443 VSIFPWQKVTNDKIQPNGKDRIKLE 467

>KNAG0M00810 Chr13 (138732..142256) [3525 bp, 1174 aa] {ON} Anc_6.115
            YBR218C
          Length = 1174

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 48   RHGFIYRQGILAYYYVFDAIEQEIDRLLNDAVSEKELQACGILKQFWLEDFRRSTQIYKD 107
            R     R G+    +  DAI ++++      + E ++ +  +  + + EDF+++ ++Y D
Sbjct: 962  RRKLTCRPGLELAPFDLDAIREDLNSRFGSDIDECDVASYNMYPKVY-EDFQKTRELYGD 1020

Query: 108  LKLLYSNTFKSTESLNE 124
            L +L +  F +  ++ E
Sbjct: 1021 LSVLPTKNFLAPAAIGE 1037

>KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON}
           similar to uniprot|P53049 Saccharomyces cerevisiae
           YGR281W YOR1 Plasma membrane transporter of the ATP-
           binding cassette (ABC) family mediates export of many
           different organic anions including oligomycin
          Length = 1454

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 76/191 (39%), Gaps = 34/191 (17%)

Query: 140 DDIHDNIRQEPCT-ILSYCHVLYLA----LFAGGKLIRSNLYRR---LGLFPNFEKLTQK 191
           DD+   +    C  I+  C + YL     + A  +L   +   R   LGL  +F+  T  
Sbjct: 722 DDVLSAVDSRVCKHIVDECMMGYLKQKTRILATHQLSLIDKASRVIFLGLDGSFDIGTVP 781

Query: 192 ELVKKGTNF---FTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDW 248
           EL+K+ T F     F    P EE        +N E+   +  T+  K + +S  EG    
Sbjct: 782 ELLKRNTGFSDLMQFQNSAPAEELEDDDTKAQNMEITAISSQTDISKKQSLSGREG---- 837

Query: 249 NFNIVAEIGELNRRE--LMSKFSFKCVTYVYEEWMFSKGSASRKAFSTTMLLMLSIT--- 303
                 E G +  +E   M+  SFK    VY+E++ +        F    L ++  T   
Sbjct: 838 ------ETGRITLKEERAMNALSFK----VYKEYIAAGCGKYAPIFVPAFLCVVICTTFC 887

Query: 304 ----AVWILYY 310
               +VW+ ++
Sbjct: 888 SLFSSVWLSFW 898

>Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)
          Length = 763

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 90  LKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEF-LATFEKPPLLQQ 137
           + Q W +  ++ST ++K  KLL S  F S+ES N F L   EK P L Q
Sbjct: 285 VSQSWNKVIKKSTSLWK--KLLVSENFVSSESFNSFNLKLSEKYPKLPQ 331

>CAGL0K09988g Chr11 (977846..978436) [591 bp, 196 aa] {ON} similar
           to uniprot|P38962 Saccharomyces cerevisiae YDR084c
          Length = 196

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 36/86 (41%), Gaps = 3/86 (3%)

Query: 144 DNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLTQKELVKKGTNFFTF 203
           D++R    TIL   H L +A    GK      Y    LFP+F  L    ++    +F+  
Sbjct: 2   DHVRNFYDTILRSSHPLLMAFHLAGKAAPLAFYIAGFLFPSFTALFITIVLLLAADFYFT 61

Query: 204 SELGPTEETRLKWEYKKNYELATRTE 229
             +      +L+W Y  +   AT TE
Sbjct: 62  KNISGRRLVQLRWWYDSS---ATSTE 84

>KLLA0A09141g Chr1 (801373..803655) [2283 bp, 760 aa] {ON} weakly
           similar to uniprot|P38863 YHR172W Saccharomyces
           cerevisiae SPC97 Component of the microtubule-nucleating
           Tub4p (gamma-tubulin) complex
          Length = 760

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 34/71 (47%), Gaps = 9/71 (12%)

Query: 43  MAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLNDAVSEKELQACGILKQFWLEDFRRST 102
           + + +  GFIY+         F  ++Q +DR+++      E+    +    +++D RR T
Sbjct: 166 LEMVLEDGFIYK---------FRLLDQIVDRIMDSTRERSEMDRVQMDFNNFMDDLRRDT 216

Query: 103 QIYKDLKLLYS 113
               DL++LY 
Sbjct: 217 NDELDLRVLYD 227

>KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {ON}
           Anc_3.177 YAR019C
          Length = 936

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 33/64 (51%), Gaps = 9/64 (14%)

Query: 82  KELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPLLQQFVDD 141
           K   A  +LK  WL+D  +STQ+ ++L       FKS + L +F   FEK  L   + DD
Sbjct: 264 KRPSAVSLLKHPWLKDITQSTQLPENLD------FKSAKFL-QFREDFEKDDL--NWDDD 314

Query: 142 IHDN 145
             DN
Sbjct: 315 FMDN 318

>TPHA0B01460 Chr2 complement(325847..327304) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 14/62 (22%), Positives = 32/62 (51%), Gaps = 9/62 (14%)

Query: 49  HGFIYRQGILAYYYVFDAIEQEIDRLLNDAVSEKELQACG---------ILKQFWLEDFR 99
            G + + GIL   +  D ++ E+++++N+ + E + +            +  Q W++DF+
Sbjct: 170 DGILIKNGILKSKFGGDFLDFEVNKIINEKIKESDKEEMDEDKKSTEMWLESQTWIKDFK 229

Query: 100 RS 101
           RS
Sbjct: 230 RS 231

>Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W
           (REAL)
          Length = 781

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 4/50 (8%)

Query: 90  LKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEF-LATFEK-PPLLQQ 137
           + Q W +  R+ST ++K  KLL S  F S +S N F L   E+ P LLQQ
Sbjct: 302 VSQNWNKIIRKSTSLWK--KLLISENFVSPKSFNHFNLKLSERYPKLLQQ 349

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.138    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,056,789
Number of extensions: 1334520
Number of successful extensions: 5263
Number of sequences better than 10.0: 41
Number of HSP's gapped: 5405
Number of HSP's successfully gapped: 41
Length of query: 320
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 210
Effective length of database: 40,868,139
Effective search space: 8582309190
Effective search space used: 8582309190
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)