Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_10.2987.345ON112813458e-43
Skud_12.2677.345ON110812521e-28
Smik_12.2627.345ON111812408e-27
YLR204W (QRI5)7.345ON111812321e-25
NOTE: 13 genes in the same pillar as Suva_10.298 were not hit in these BLAST results
LIST: Kpol_2001.72 Zrou_YGOB_Anc_7.345 KAFR0L01475 CAGL0A03883g KLTH0H01364g Kwal_56.24628 ACL153C Ecym_4728 TPHA0D04575 KLLA0D12452g KNAG0B02635 NDAI0E04490 SAKL0F11264g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_10.298
         (112 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_10.298 Chr10 (525092..525430) [339 bp, 112 aa] {ON} YLR204W...   137   8e-43
Skud_12.267 Chr12 (498907..499239) [333 bp, 110 aa] {ON} YLR204W...   101   1e-28
Smik_12.262 Chr12 (499287..499622) [336 bp, 111 aa] {ON} YLR204W...    97   8e-27
YLR204W Chr12 (552270..552605) [336 bp, 111 aa] {ON}  QRI5Mitoch...    94   1e-25

>Suva_10.298 Chr10 (525092..525430) [339 bp, 112 aa] {ON} YLR204W
          (REAL)
          Length = 112

 Score =  137 bits (345), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 70/81 (86%)

Query: 1  MLGRALRPGWLGITRATARYPICGTCANRTMHTPTTTSMPAMQEGMLSXXXXXXXXXXXR 60
          MLGRALRPGWLGITRATARYPICGTCANRTMHTPTTTSMPAMQEGMLS           R
Sbjct: 1  MLGRALRPGWLGITRATARYPICGTCANRTMHTPTTTSMPAMQEGMLSTMMMMTTMTTTR 60

Query: 61 IGSTVSEPLTGSSIVMQLDSV 81
          IGSTVSEPLTGSSIVMQLDSV
Sbjct: 61 IGSTVSEPLTGSSIVMQLDSV 81

>Skud_12.267 Chr12 (498907..499239) [333 bp, 110 aa] {ON} YLR204W
          (REAL)
          Length = 110

 Score =  101 bits (252), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 56/81 (69%), Gaps = 2/81 (2%)

Query: 1  MLGRALRPGWLGITRATARYPICGTCANRTMHTPTTTSMPAMQEGMLSXXXXXXXXXXXR 60
          MLGRALRPGWLGITR  AR P CG C NRTM T T T M  MQEGMLS           R
Sbjct: 1  MLGRALRPGWLGITRTVARNPTCGACFNRTMQTTTNTGMSVMQEGMLS--AMTIMMTTTR 58

Query: 61 IGSTVSEPLTGSSIVMQLDSV 81
          IGS V+EPL+G +IVMQLDSV
Sbjct: 59 IGSKVNEPLSGPNIVMQLDSV 79

>Smik_12.262 Chr12 (499287..499622) [336 bp, 111 aa] {ON} YLR204W
          (REAL)
          Length = 111

 Score = 97.1 bits (240), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 56/81 (69%), Gaps = 1/81 (1%)

Query: 1  MLGRALRPGWLGITRATARYPICGTCANRTMHTPTTTSMPAMQEGMLSXXXXXXXXXXXR 60
          MLGRALRPGWLGITRA AR PICG+C  RT+ T   T MPAM EGMLS           R
Sbjct: 1  MLGRALRPGWLGITRAVARKPICGSCFVRTLQTEMNTGMPAMHEGMLS-TIMMTTTTGTR 59

Query: 61 IGSTVSEPLTGSSIVMQLDSV 81
          I +TV E L+ SSIVMQLDSV
Sbjct: 60 ISNTVRESLSESSIVMQLDSV 80

>YLR204W Chr12 (552270..552605) [336 bp, 111 aa] {ON}
          QRI5Mitochondrial inner membrane protein, required for
          accumulation of spliced COX1 mRNA; may have an
          additional role in translation of COX1 mRNA
          Length = 111

 Score = 94.0 bits (232), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 50/81 (61%), Positives = 54/81 (66%), Gaps = 1/81 (1%)

Query: 1  MLGRALRPGWLGITRATARYPICGTCANRTMHTPTTTSMPAMQEGMLSXXXXXXXXXXXR 60
          MLGRALRPGWLGITR   + P CG+  NRT  T   T+MP MQEGMLS           R
Sbjct: 1  MLGRALRPGWLGITRTVVKKPSCGSYFNRTFQTAINTTMPPMQEGMLS-TMMMMTATATR 59

Query: 61 IGSTVSEPLTGSSIVMQLDSV 81
          I  TVSEPL GS+IVMQLDSV
Sbjct: 60 ITGTVSEPLNGSNIVMQLDSV 80

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.129    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,743,837
Number of extensions: 119608
Number of successful extensions: 168
Number of sequences better than 10.0: 4
Number of HSP's gapped: 165
Number of HSP's successfully gapped: 4
Length of query: 112
Length of database: 53,481,399
Length adjustment: 82
Effective length of query: 30
Effective length of database: 44,078,787
Effective search space: 1322363610
Effective search space used: 1322363610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)