Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_10.2977.346ON43643623050.0
Skud_12.2667.346ON43643622420.0
Smik_12.2617.346ON43643622180.0
YLR203C (MSS51)7.346ON43643621920.0
TDEL0C020207.346ON42540217790.0
Kpol_530.357.346ON42540417700.0
NCAS0E028807.346ON42941417610.0
CAGL0A03927g7.346ON43741717490.0
TPHA0F029307.346ON43640417470.0
SAKL0F11286g7.346ON42340217440.0
Kwal_56.246317.346ON42241916970.0
KLTH0H01342g7.346ON42240216950.0
ZYRO0F11616g7.346ON41541016690.0
KNAG0B026307.346ON43841116650.0
Ecym_47277.346ON42940816580.0
NDAI0E044807.346ON44341516530.0
KLLA0D12430g7.346ON41840216360.0
NCAS0A141207.346ON42743415450.0
ACL152W7.346ON42840215370.0
TBLA0E005007.346ON43741915350.0
NDAI0A019307.346ON45041715130.0
KAFR0B008407.346ON42643015090.0
KNAG0C037507.346ON42440814790.0
CAGL0M08536g5.646ON40837704.3
TBLA0H002802.406ON149887697.0
Suva_13.1425.550ON58482688.1
Suva_10.2438.354ON300104678.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_10.297
         (436 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {...   892   0.0  
Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {...   868   0.0  
Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {...   858   0.0  
YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON} ...   848   0.0  
TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {O...   689   0.0  
Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}...   686   0.0  
NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {O...   682   0.0  
CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly...   678   0.0  
TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.3...   677   0.0  
SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} simila...   676   0.0  
Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR2...   658   0.0  
KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {...   657   0.0  
ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} simila...   647   0.0  
KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {O...   645   0.0  
Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {O...   643   0.0  
NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa] ...   641   0.0  
KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]...   634   0.0  
NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON} Anc_7...   599   0.0  
ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homo...   596   0.0  
TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346...   595   0.0  
NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {O...   587   0.0  
KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.3...   585   0.0  
KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.3...   574   0.0  
CAGL0M08536g Chr13 complement(852150..853376) [1227 bp, 408 aa] ...    32   4.3  
TBLA0H00280 Chr8 complement(43650..48146) [4497 bp, 1498 aa] {ON...    31   7.0  
Suva_13.142 Chr13 (227330..229084) [1755 bp, 584 aa] {ON} YML017...    31   8.1  
Suva_10.243 Chr10 complement(442966..443868) [903 bp, 300 aa] {O...    30   8.6  

>Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  892 bits (2305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/436 (97%), Positives = 425/436 (97%)

Query: 1   MTALYAPSGAAQLYSHLLRRSPQNRLVVSHQTRRHLMGFVRNALGLXXXXXXXXXXXENR 60
           MTALYAPSGAAQLYSHLLRRSPQNRLVVSHQTRRHLMGFVRNALGL           ENR
Sbjct: 1   MTALYAPSGAAQLYSHLLRRSPQNRLVVSHQTRRHLMGFVRNALGLDPPPSPDDPTPENR 60

Query: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120
           FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK
Sbjct: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120

Query: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLA 180
           KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLA
Sbjct: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLA 180

Query: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTRNR 240
           AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTRNR
Sbjct: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTRNR 240

Query: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQR 300
           AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQR
Sbjct: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQR 300

Query: 301 IDETLKFFHHTDFFQVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLET 360
           IDETLKFFHHTDFFQVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLET
Sbjct: 301 IDETLKFFHHTDFFQVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLET 360

Query: 361 KCAIFTTGFNKKDLMDDINLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM 420
           KCAIFTTGFNKKDLMDDINLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM
Sbjct: 361 KCAIFTTGFNKKDLMDDINLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM 420

Query: 421 YIAGFRGKRYHTIKRQ 436
           YIAGFRGKRYHTIKRQ
Sbjct: 421 YIAGFRGKRYHTIKRQ 436

>Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  868 bits (2242), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/436 (94%), Positives = 417/436 (95%)

Query: 1   MTALYAPSGAAQLYSHLLRRSPQNRLVVSHQTRRHLMGFVRNALGLXXXXXXXXXXXENR 60
           MTALYAPSGAAQ+YSHLLRRSP NRLVV HQTRRHLMGFVRNALGL           ENR
Sbjct: 1   MTALYAPSGAAQMYSHLLRRSPYNRLVVYHQTRRHLMGFVRNALGLDPPPSPDDPTPENR 60

Query: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120
           FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDK YHDSK
Sbjct: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSK 120

Query: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLA 180
           KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLF YTRSFYSMDTEFQLA
Sbjct: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180

Query: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTRNR 240
           AVTKMLSYPITIGS+LHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATT+NR
Sbjct: 181 AVTKMLSYPITIGSVLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTKNR 240

Query: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQR 300
           AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHF+GPECLYKRDKQEYVKSATPVVQR
Sbjct: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQR 300

Query: 301 IDETLKFFHHTDFFQVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLET 360
           +DETL+F HHTDFF VFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETM ALLET
Sbjct: 301 VDETLRFIHHTDFFDVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLET 360

Query: 361 KCAIFTTGFNKKDLMDDINLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM 420
           KCAIFTTGFNKKDLMDDIN VKSKYGKEMDILMDPV+NVFGSTKWELNDMNPQEVYQFNM
Sbjct: 361 KCAIFTTGFNKKDLMDDINAVKSKYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNM 420

Query: 421 YIAGFRGKRYHTIKRQ 436
           YIAGFRGKRYHTIKRQ
Sbjct: 421 YIAGFRGKRYHTIKRQ 436

>Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/436 (93%), Positives = 412/436 (94%)

Query: 1   MTALYAPSGAAQLYSHLLRRSPQNRLVVSHQTRRHLMGFVRNALGLXXXXXXXXXXXENR 60
           MTALY PSGA QLYSHLLRRS  NRLV+SHQTRRHLMGFVRNALGL           ENR
Sbjct: 1   MTALYVPSGATQLYSHLLRRSSHNRLVLSHQTRRHLMGFVRNALGLDPPPSPDDPTPENR 60

Query: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120
           FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK
Sbjct: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120

Query: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLA 180
           KYEILKKVNIYEHDLRSGRPFPEFDFPQ QGYDKAVNLTNWDLF YTRSFYSMDTEFQLA
Sbjct: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180

Query: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTRNR 240
           AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRS+L  T+NR
Sbjct: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNR 240

Query: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQR 300
           AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKS TPVVQR
Sbjct: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQR 300

Query: 301 IDETLKFFHHTDFFQVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLET 360
           +DETLKF H TDFF+VFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETM ALLET
Sbjct: 301 VDETLKFIHRTDFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLET 360

Query: 361 KCAIFTTGFNKKDLMDDINLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM 420
           KCAIFTTGFNKKDL DD+NLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM
Sbjct: 361 KCAIFTTGFNKKDLTDDLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM 420

Query: 421 YIAGFRGKRYHTIKRQ 436
           YIAGFRGKRYHTIKRQ
Sbjct: 421 YIAGFRGKRYHTIKRQ 436

>YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON}
           MSS51Specific translational activator for the
           mitochondrial COX1 mRNA; loosely associated with the
           matrix face of the mitochondrial inner membrane;
           influences both COX1 mRNA translation and Cox1p assembly
           into cytochrome c oxidase
          Length = 436

 Score =  848 bits (2192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/436 (92%), Positives = 413/436 (94%)

Query: 1   MTALYAPSGAAQLYSHLLRRSPQNRLVVSHQTRRHLMGFVRNALGLXXXXXXXXXXXENR 60
           MT LYAPSGA QLY HLLR+SP NRLVVSHQTRRHLMGFVRNALGL           ENR
Sbjct: 1   MTVLYAPSGATQLYFHLLRKSPHNRLVVSHQTRRHLMGFVRNALGLDPPPSPEDPTPENR 60

Query: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120
           FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK
Sbjct: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120

Query: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLA 180
           KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLF YTRSFYSMDTEFQLA
Sbjct: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180

Query: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTRNR 240
           AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRS+  TT+NR
Sbjct: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLPTTTKNR 240

Query: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQR 300
           AMRIFILGARAEAQLPGHVWKQLQFLFPEQ+FEIHFIGPECLYKRDKQEYVKS TPVVQR
Sbjct: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQR 300

Query: 301 IDETLKFFHHTDFFQVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLET 360
           +DETLKF + T+FF+VFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETM ALLET
Sbjct: 301 VDETLKFIYRTNFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLET 360

Query: 361 KCAIFTTGFNKKDLMDDINLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM 420
           KCAIFTTGFNKKDL DDINLVKSKYGKEMD+LM+PV+NVFGSTKWELNDMNPQEVYQFNM
Sbjct: 361 KCAIFTTGFNKKDLTDDINLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNM 420

Query: 421 YIAGFRGKRYHTIKRQ 436
           YIAGFRGKRYHTIKRQ
Sbjct: 421 YIAGFRGKRYHTIKRQ 436

>TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {ON}
           Anc_7.346 YLR203C
          Length = 425

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/402 (78%), Positives = 355/402 (88%), Gaps = 1/402 (0%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           RR ++GFVRNALGL           ENRFHPWDQSP  DLRERAA+IRTLA CPVTGK+I
Sbjct: 24  RRFIIGFVRNALGLDPPPSPDDPTPENRFHPWDQSPVGDLRERAARIRTLARCPVTGKEI 83

Query: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152
           NYTCPLSGIPTHHSREAWE DK YH SKKYEILKKVNIYEHDLRSGRPFPEFDFPQ Q +
Sbjct: 84  NYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQDF 143

Query: 153 DKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212
           D+ VN+TNWDLF YTR FYSMDTEFQLAAVTKMLSYPI+I S+LH+FSPYSLNPKGP+TL
Sbjct: 144 DRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVTL 203

Query: 213 EGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNF 272
           EGLKSLAALRYTLYPLEN+++ ++T++R MRIFILGARAEAQLPGHVWKQLQ+LFPEQ F
Sbjct: 204 EGLKSLAALRYTLYPLENKTI-SSTKDRPMRIFILGARAEAQLPGHVWKQLQYLFPEQMF 262

Query: 273 EIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQDFFPYDPYMDV 332
           E+HF+GPECL  ++K +YV S+TPVV+R+DET+ F +HTDFF V HEAQDFFPYDPY+DV
Sbjct: 263 ELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPYLDV 322

Query: 333 FFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSKYGKEMDIL 392
           FF FHPG+ +PE+  SW+ ETM  LLETKCAIFTTGFNK DL+ D++ VK KYGKE+D+L
Sbjct: 323 FFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEVDVL 382

Query: 393 MDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           M+PVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 383 MEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424

>Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}
           complement(83032..84309) [1278 nt, 426 aa]
          Length = 425

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/404 (78%), Positives = 355/404 (87%), Gaps = 2/404 (0%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           +R LMGFVRNALGL           ENRFHPWDQSP VDLRERAAKIRTLA CPVT KDI
Sbjct: 21  KRSLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKDI 80

Query: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152
           NYTCPLSGIPTHH +EAW MDK YH+SK+YEILKKVNIYEHDLRSGRPFPEFDFPQ Q Y
Sbjct: 81  NYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQDY 140

Query: 153 DKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212
           D+ +NLTNWDLF YTRSFYSMDTEFQLAAVTKMLSYPITIGSLLH+FSPYSLNPKGP+TL
Sbjct: 141 DRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVTL 200

Query: 213 EGLKSLAALRYTLYPLENRS--VLATTRNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQ 270
           EGLKSLAALRYTLYP +N+S  V   TR+R MRIFILGARAEAQLPGHVWKQ Q+LFPEQ
Sbjct: 201 EGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPEQ 260

Query: 271 NFEIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQDFFPYDPYM 330
            FEIHFIGPEC   ++K +Y+ S+TP+V+++D+TLK   H D+F VFHEAQDFFPYDP++
Sbjct: 261 EFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPFL 320

Query: 331 DVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSKYGKEMD 390
           DVFFTFHPGYA PE+   W+GETM ALL+TKCAIFTTGF+K+DL+ DI++VK++YG E+D
Sbjct: 321 DVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNELD 380

Query: 391 ILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           +LMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 381 MLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424

>NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {ON}
           Anc_7.346 YLR203C
          Length = 429

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/414 (75%), Positives = 355/414 (85%)

Query: 22  PQNRLVVSHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRT 81
           P+N   V+    RHLMGFVRNALGL           ENRFHPWDQSPS DLRERAA+IRT
Sbjct: 16  PRNAFNVAGNQTRHLMGFVRNALGLDPPTSPDDPTPENRFHPWDQSPSPDLRERAARIRT 75

Query: 82  LAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPF 141
           LA CPVTGK+INYTCP+SGIPTHHSREAWE DK YH SK+YE+LKKVNIYEHDLRSGRPF
Sbjct: 76  LARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPF 135

Query: 142 PEFDFPQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSP 201
           PEFDFP+ QG D+ VN+TNWDLFLYTR+FYSMDTEFQ+AAVTKMLSYPITIGS+LH+FSP
Sbjct: 136 PEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSP 195

Query: 202 YSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHVWK 261
           YSL PKGPI+LEGLKSLAALRYTLYP++NR V++TT+ R MRIFILGARAE+QLPGHVWK
Sbjct: 196 YSLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLPGHVWK 255

Query: 262 QLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQ 321
           QLQ+LFPEQ FEIHFIGPE  Y +DK++Y++  TP+ + +DETLK  +HT++F   HEAQ
Sbjct: 256 QLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHKLHEAQ 315

Query: 322 DFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLV 381
           DFFPYDPYMDVFF FHPG+AS E    WM +TM  LL+TKCAIFTTGF K DL++DI +V
Sbjct: 316 DFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVV 375

Query: 382 KSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKR 435
           + KYGKE+DILM P KNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRY TIKR
Sbjct: 376 QDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIKR 429

>CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203c MSS51
          Length = 437

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/417 (76%), Positives = 353/417 (84%), Gaps = 14/417 (3%)

Query: 32  TRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKD 91
           ++R LMGFVRNALGL           +NRFHPWDQSP+VDLRERAA+I+TLA CPVT K 
Sbjct: 20  SKRQLMGFVRNALGLDPPPSPDEPTEQNRFHPWDQSPAVDLRERAARIKTLAKCPVTHKP 79

Query: 92  INYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQG 151
           I YTCP+SGIPTHHSREAWE DK YH SKKYEILKKVNIYEHDLRSGRPFPEFDFP+ QG
Sbjct: 80  IQYTCPISGIPTHHSREAWEQDKEYHASKKYEILKKVNIYEHDLRSGRPFPEFDFPRDQG 139

Query: 152 YDKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPIT 211
            D+ VNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGS+LH+FSPYSLNPKGPIT
Sbjct: 140 PDRTVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPIT 199

Query: 212 LEGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQN 271
           LEGLKSLAALRYTLYPL+NR+V  T +N+ MRIFILGARAEAQLPGHVWKQLQFLFP+QN
Sbjct: 200 LEGLKSLAALRYTLYPLQNRAVTTTAKNKPMRIFILGARAEAQLPGHVWKQLQFLFPQQN 259

Query: 272 FEIHFIGPECLYKRDKQEYVKSAT--------------PVVQRIDETLKFFHHTDFFQVF 317
           FEIHFIGPE LY R++ EY++SAT              PV +RIDET+KFF+HTD+F   
Sbjct: 260 FEIHFIGPESLYDRERNEYIRSATANGETAADGTTSSIPVTKRIDETMKFFYHTDYFHTL 319

Query: 318 HEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDD 377
           H AQDFFPYDPY DVFF FHPG ASPES  +WM +T+  LL+TKCAIFTTGFNKKD+ DD
Sbjct: 320 HTAQDFFPYDPYQDVFFMFHPGLASPESKDTWMKDTVKGLLDTKCAIFTTGFNKKDMADD 379

Query: 378 INLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           I +++  YGKEMD+LM+PVKNVFGSTKWEL+D +P  VYQFNMYIAGFRGKRYH IK
Sbjct: 380 IQILQDTYGKEMDMLMNPVKNVFGSTKWELDDSDPHSVYQFNMYIAGFRGKRYHPIK 436

>TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.346
           YLR203C
          Length = 436

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/404 (76%), Positives = 354/404 (87%), Gaps = 1/404 (0%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           +R LMGFV+NALGL           ENRFHPWDQSPS DLRERAA+IRTLA CPVT K+I
Sbjct: 33  KRSLMGFVKNALGLDPSPSPDDPTPENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKEI 92

Query: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152
           NYTCPLSGIPTHHSREAWE DK YH SK+YEILKKVNIYEHDLRSGRPFPEFDFP  Q +
Sbjct: 93  NYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQIH 152

Query: 153 DKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212
           D+ VNLTNWDLF YTR+FYSMDTEFQLAAVTKMLSYP+TIGS+LH+FSPYSLNPKGPITL
Sbjct: 153 DRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPITL 212

Query: 213 EGLKSLAALRYTLYPLENRSVLA-TTRNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQN 271
           EGLKSLAALRY+LYP + +S ++    +R MRIFILGARAEAQLPGHVWKQLQFLFP+Q 
Sbjct: 213 EGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQT 272

Query: 272 FEIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQDFFPYDPYMD 331
           FEIHFIG ECL   +K +Y+KSA PVV++IDET+K  +H+D+F V+HEAQDF PYDPY+D
Sbjct: 273 FEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYDPYLD 332

Query: 332 VFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSKYGKEMDI 391
           VFFTFHPG+A+PE+   WMG+TM ALLETKCAIFTTGFNK+D+ +D+ +VK++YGKEMD 
Sbjct: 333 VFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKEMDT 392

Query: 392 LMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKR 435
           LMDP+KN +GSTKWELNDMNPQE++QFNMY+AGFRGKRYHTIKR
Sbjct: 393 LMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIKR 436

>SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 423

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/402 (76%), Positives = 349/402 (86%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           +RH++GFVRNALGL           +NRFHPWDQSPS DLR RAA IR LA CPVTGK+I
Sbjct: 21  KRHIIGFVRNALGLDPPPSPDDPTPDNRFHPWDQSPSPDLRTRAATIRALARCPVTGKEI 80

Query: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152
           NYTCP SGIPTHHSREAWE D  YH +KKYEILKKVNIYEHDLRSGRPFPEFDFPQ Q Y
Sbjct: 81  NYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQDY 140

Query: 153 DKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212
           D+ VN+TNWDLF YTR FYSMDTEFQLAAVTKMLSYP T+GS+LH+FSPY+LNPKGPITL
Sbjct: 141 DRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPITL 200

Query: 213 EGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNF 272
           EGLKSLAALRYTLYP ++R V A T++R MRIFILGARAEAQLPGHVWKQ QFLFPE NF
Sbjct: 201 EGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEINF 260

Query: 273 EIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQDFFPYDPYMDV 332
           E+HFIGPE  Y R+K+EY+ S+TP+V+R+DETL F +HTD+F VFHEAQDFFPYDPY+D+
Sbjct: 261 ELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYLDI 320

Query: 333 FFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSKYGKEMDIL 392
           FF FHPG+A+PES   WMG+TM  LLETKCAIFTTGFN++DL+ D+  V+ KYG EMD+L
Sbjct: 321 FFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKYGNEMDML 380

Query: 393 MDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           M+PV+N+FGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 381 MEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 422

>Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR203C
           (MSS51) - involved in maturation of COX1 and COB mRNA
           [contig 161] FULL
          Length = 422

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/419 (73%), Positives = 350/419 (83%), Gaps = 1/419 (0%)

Query: 16  HLLRRSPQNRLVVSHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRER 75
           ++L RS       S Q +RH+MGFVRNALGL           ENRFHPWDQSPS DLRER
Sbjct: 4   YILNRSSLRNSHCSLQ-KRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRER 62

Query: 76  AAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDL 135
           AA IR LA CPVTG++INYTCP SGIPTHHSREAWE D  Y  SK+ EILKKVNIYEHDL
Sbjct: 63  AATIRALAKCPVTGREINYTCPKSGIPTHHSREAWEKDLDYQQSKRPEILKKVNIYEHDL 122

Query: 136 RSGRPFPEFDFPQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSL 195
           RSGRPFPEFDFP  Q +D+ VNLTNWDLF YTR F+SMDTEFQLAAVTKMLSYPITIGS+
Sbjct: 123 RSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFFSMDTEFQLAAVTKMLSYPITIGSV 182

Query: 196 LHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQL 255
           LH+FSPYSLNPKGPITLEGLKSLAALRYTLYP +NR V +  +N  +RIF+LGARAEAQL
Sbjct: 183 LHQFSPYSLNPKGPITLEGLKSLAALRYTLYPDQNRRVTSIAKNSPLRIFVLGARAEAQL 242

Query: 256 PGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQ 315
           PGHVWKQLQF+FPE   EIHF+GPE  Y R+K+EYV SA P+++R+DETL F +HTD+F 
Sbjct: 243 PGHVWKQLQFMFPETQMEIHFVGPESYYDRNKREYVHSAAPIIRRVDETLNFVYHTDYFH 302

Query: 316 VFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLM 375
           VFHEAQDFFPYDPY D+FF FHPG+A+PES  +WMG+TM ALLETKCAIFTTGFN+ DL 
Sbjct: 303 VFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAIFTTGFNEVDLQ 362

Query: 376 DDINLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
            D++ V ++YGKE+DI+MDP KN FGSTKWELND+NPQEVYQFNM++AGFRGKRYH I+
Sbjct: 363 RDLDAVVAEYGKELDIIMDPAKNAFGSTKWELNDVNPQEVYQFNMFMAGFRGKRYHAIE 421

>KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {ON}
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 422

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/402 (75%), Positives = 344/402 (85%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           +RH+MGFVRNALGL           ENRFHPWDQSPS DLRERAA IR LA CPVTG++I
Sbjct: 20  KRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGREI 79

Query: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152
           NYTCP SGIPTH+SREAWE D  Y  SK+ EILKKVNIYEHDLRSGRPFPEFDFP  Q +
Sbjct: 80  NYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDF 139

Query: 153 DKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212
           D+ VNLTNWDLF YTR FYSMDTEFQLAAVTKMLSYP+TIGS+LH+FSPYSLNPKGP+TL
Sbjct: 140 DRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPVTL 199

Query: 213 EGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNF 272
           EGLKSLAALRYTLYP +NR V + T+N  +RIFILGARAEAQLPGHVWKQLQF+FPE N 
Sbjct: 200 EGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVWKQLQFMFPETNI 259

Query: 273 EIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQDFFPYDPYMDV 332
           E+HF+GPE  Y R+K+EYV S++P+V+R+DETL F +HTD+F VFHEAQDFFPYDPY D+
Sbjct: 260 ELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYTDI 319

Query: 333 FFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSKYGKEMDIL 392
           FF FHPG+A+PES  +WMG+TM ALLETKCA+FTTGFN+ DL  D+  V  K+GKE+D+L
Sbjct: 320 FFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVGKHGKELDML 379

Query: 393 MDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           M+PV N FGSTKWELNDMNPQEVYQFNM+IAGFRGKRYH I+
Sbjct: 380 MEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIE 421

>ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 415

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/410 (73%), Positives = 343/410 (83%), Gaps = 1/410 (0%)

Query: 25  RLVVSHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAH 84
           RL      RR ++GFVRNALGL           ENRFH WDQSP+ DLRERAA+IR LA 
Sbjct: 6   RLCRPITQRRTIIGFVRNALGLDPPPSPDDPTPENRFHLWDQSPAGDLRERAARIRALAQ 65

Query: 85  CPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEF 144
           CPVTGK+INYTCPLSGIPTHHS+EAWE DK YH+SKK+E+LKKVNIYEHDLRSGRPFPEF
Sbjct: 66  CPVTGKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEF 125

Query: 145 DFPQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSL 204
           DFPQ   +D+ VN+TNWDLF YTR FYSMDTEFQLAAVTKMLSYPITI S+L++FSPYSL
Sbjct: 126 DFPQDLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSL 185

Query: 205 NPKGPITLEGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHVWKQLQ 264
           NPKGPITLEGLKSLAALRYTLYP EN++V A T++R MR+FILGARAEA LPGHVWKQLQ
Sbjct: 186 NPKGPITLEGLKSLAALRYTLYPFENKTV-AATKDRPMRLFILGARAEALLPGHVWKQLQ 244

Query: 265 FLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQDFF 324
           FLFPE  FE+HFIGPECL  ++K +YV S  PVV+RIDETL F +HTD+F V+H+AQDFF
Sbjct: 245 FLFPETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFF 304

Query: 325 PYDPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSK 384
           PYDPY+D FF FHPG+ +PES   W+ +T+  LLETKCAIF TG NK  L+ DIN V  K
Sbjct: 305 PYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDK 364

Query: 385 YGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           + KE+DILM+P KN++GSTKWELND+NPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 365 HSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIE 414

>KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {ON}
           Anc_7.346 YLR203C
          Length = 438

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/411 (73%), Positives = 341/411 (82%), Gaps = 8/411 (1%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           RR LMGFVRNALGL           ENRFHPWDQSP   LRERAA+I+TLA CPVTG ++
Sbjct: 28  RRQLMGFVRNALGLEPPPSPMDPTPENRFHPWDQSPVDALRERAARIKTLAKCPVTGLNV 87

Query: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152
            YTCPLSGIPTHHSREAWE D  YH +K+YE LKKVNIYEHDLRSGRPFPEFDFPQ+QGY
Sbjct: 88  EYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQGY 147

Query: 153 DKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212
           DK VN+TNWDLF YTR FYSMDTEFQLAAVTKMLSYP+TI SLL +FSPYSLNPKGPITL
Sbjct: 148 DKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPITL 207

Query: 213 EGLKSLAALRYTLYPLE-NRSVLA-------TTRNRAMRIFILGARAEAQLPGHVWKQLQ 264
           EGLKSLAA+RYTLY    N S  A         +NR MR+F+LGARAEAQLPGHVWKQL 
Sbjct: 208 EGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQLS 267

Query: 265 FLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQDFF 324
           +LFPEQ+FE+ FIGPE  Y R + +YV+S TPVV+++DETLKF H+TD+F V HE+QDFF
Sbjct: 268 YLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQDFF 327

Query: 325 PYDPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSK 384
           PYDPY D FFTFHPG+ASPE+  +W+  T+ ALL+TKCAIFTTGF++ DLM+D+ L+  K
Sbjct: 328 PYDPYFDCFFTFHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLNEK 387

Query: 385 YGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKR 435
           +G EMDILM+P KNVFGSTKWELND+NP EVYQFNMYIAGFRGKRYHTIKR
Sbjct: 388 FGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIKR 438

>Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {ON}
           similar to Ashbya gossypii ACL152W
          Length = 429

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/408 (72%), Positives = 344/408 (84%), Gaps = 1/408 (0%)

Query: 27  VVSHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCP 86
           V   Q RR +MGFVRNALGL           +NRFHPWDQSPS +LRERAA+I+ LA CP
Sbjct: 22  VCGKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCP 81

Query: 87  VTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDF 146
           VTGK+I ++C  SGIPTHHS EAW+ D  YH+SK+Y +LKKVNIYEHDLRSGRPF EFDF
Sbjct: 82  VTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDF 141

Query: 147 PQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNP 206
           P+QQ YD+ VN+ NWDL+ YTRSF+SMDTEFQLAAVTKMLSYPITIGS+LH++SPYSLNP
Sbjct: 142 PEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNP 201

Query: 207 KGPITLEGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHVWKQLQFL 266
           KGPITLEGLKSLAALRYTLYP +NR V  + +++ +R+FILGARAEAQLPGHVWKQLQ+L
Sbjct: 202 KGPITLEGLKSLAALRYTLYPEQNRRV-RSIQDKPLRVFILGARAEAQLPGHVWKQLQYL 260

Query: 267 FPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQDFFPY 326
           FPE   E+HF+GPE  Y R+K+EYV S+ PVV+RID+T+K  +HTD+F VFHEAQDFFPY
Sbjct: 261 FPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEAQDFFPY 320

Query: 327 DPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSKYG 386
           DPY D+FF FHPG+ SPE+  +WM  T+ ALL+TKCAIFTTGFNKKDLMDD+  VK KYG
Sbjct: 321 DPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKEKYG 380

Query: 387 KEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
            E+D+L+DP KNVFGSTKWELND+NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 381 DELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIE 428

>NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa]
           {ON} Anc_7.346 YLR203C
          Length = 443

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/415 (70%), Positives = 347/415 (83%)

Query: 20  RSPQNRLVVSHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKI 79
           R+ +N   VSH + R LMGFVRNALGL           ENRFHPWDQSP  DLRERAAKI
Sbjct: 28  RNFRNNAHVSHHSSRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKI 87

Query: 80  RTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGR 139
           RTLAHCPVT K+INYTCP+SGIPTHHS+ AWEMD+ YH +K YEILKKVNIYEHDLRSGR
Sbjct: 88  RTLAHCPVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGR 147

Query: 140 PFPEFDFPQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKF 199
           PFPEF FPQ Q +D+ +N+TNWDLFLYTRSFYSMDTEFQ+AAVTKMLSYPITIGS+LH+F
Sbjct: 148 PFPEFVFPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQF 207

Query: 200 SPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHV 259
           SPYSL PKGPITLEGLKS+AALRYTLYP  N+S +  T+NR MRIF+LGARAEAQLPGH+
Sbjct: 208 SPYSLQPKGPITLEGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHI 267

Query: 260 WKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHE 319
           WKQLQ+LFPEQ FE+ FIGPE  Y ++K++Y+K   P++Q ID+TLK    T++F   HE
Sbjct: 268 WKQLQYLFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHE 327

Query: 320 AQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDIN 379
           +QD FPYDPYMDVFF FHPG+++ E+   WM +TM +LLET+CAIF TGF++ D+++D+N
Sbjct: 328 SQDLFPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMN 387

Query: 380 LVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           ++  KY  ++DILM PVKNVFGSTKWELND+NPQ+VYQFNMYIAGFRGKRY T++
Sbjct: 388 ILDEKYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVE 442

>KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]
           {ON} similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 418

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/402 (72%), Positives = 340/402 (84%), Gaps = 2/402 (0%)

Query: 34  RHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDIN 93
           R +MGFVRNALGL           ENRFHPWDQSPS DLRERAA+I+ +A CPVT KDI 
Sbjct: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76

Query: 94  YTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYD 153
           +TCPLSGIPTHHSREAWE D  YH SK+YE+LKKVNIYEHDLRSGRPFPEFDFPQ Q YD
Sbjct: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136

Query: 154 KAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITLE 213
           + VN++NWDLF YTRSFYSMDTEFQLAAVTKMLSYPITIGS+LH++SPYSLNPKGPITLE
Sbjct: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196

Query: 214 GLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNFE 273
           GLKSLAALRYTLYP E        ++  +RIFILG RAEAQLPGHVWKQLQ+L P+ + E
Sbjct: 197 GLKSLAALRYTLYP-EQSGRFRAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIE 255

Query: 274 IHFIGPECLYKRDKQEYVKSATP-VVQRIDETLKFFHHTDFFQVFHEAQDFFPYDPYMDV 332
           +HF+GPE  Y R+K+ YV+S+T  +V+RIDE ++ F+HTDFF VFHEAQDFFPYDPY DV
Sbjct: 256 LHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYNDV 315

Query: 333 FFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSKYGKEMDIL 392
           FF FHPG+A+PE+   WMG+TM AL++TKCA+FTTGF+K+DL+ DI++V+ KYG E+D+L
Sbjct: 316 FFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDML 375

Query: 393 MDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           M+PV NVFGSTKWELND NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 376 MEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIE 417

>NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON}
           Anc_7.346 YLR203C
          Length = 427

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/434 (65%), Positives = 342/434 (78%), Gaps = 8/434 (1%)

Query: 1   MTALYAPSGAAQLYSHLLRRSPQNRLVVSHQTRRHLMGFVRNALGLXXXXXXXXXXXENR 60
           M A  +P+ A QL  H +     +  + SH+T   L+GFV+NALG+            NR
Sbjct: 1   MFAFKSPA-ATQLSLHPVSLFAIDSRISSHRT---LVGFVKNALGIDPPPLPTEPVFANR 56

Query: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120
           F+PWD+SPS  +RERAA+I+  A CPVTGK+I +TCPLSGIPTH+S+EAWE D  YH +K
Sbjct: 57  FYPWDESPSPAIRERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNK 116

Query: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLA 180
            YE L+KVNIYEHDLRSGRPFPEFDFP +Q  D  VN+TNWDLF YTR FYSMDTEFQLA
Sbjct: 117 IYEKLRKVNIYEHDLRSGRPFPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLA 176

Query: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTRNR 240
            VTKMLSYPITIGS+L+K+SPY+L PKGP+TLEGLKSLAALRYTL      +  ATT+ R
Sbjct: 177 TVTKMLSYPITIGSILYKYSPYNLIPKGPVTLEGLKSLAALRYTL----RNNAFATTKTR 232

Query: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQR 300
            MRIFILGARAE+QLP H+WKQLQFLFP Q FEI+FIGPEC        Y+ S + +V+R
Sbjct: 233 PMRIFILGARAESQLPIHIWKQLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKR 292

Query: 301 IDETLKFFHHTDFFQVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLET 360
           +DE+L   ++ D+F  FH+AQDFFPYDPY D+FFTFHPG+ASPES  +WMG+TM ALL+T
Sbjct: 293 VDESLTLAYYPDYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDT 352

Query: 361 KCAIFTTGFNKKDLMDDINLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM 420
           KCAIFTTGF++ D+M DI  V+  YG+E+D+LM+P+KNVFGSTKWELND+NPQ+VYQFNM
Sbjct: 353 KCAIFTTGFSQDDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNM 412

Query: 421 YIAGFRGKRYHTIK 434
           YIAGFRGKRYHT+K
Sbjct: 413 YIAGFRGKRYHTVK 426

>ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR203C (MSS51)
          Length = 428

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/402 (72%), Positives = 330/402 (82%), Gaps = 2/402 (0%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           RR +MGFVRNALGL           ENRFH W+QSPS DLRERAA+IR LA CPVTGKDI
Sbjct: 28  RRPIMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDLRERAARIRALARCPVTGKDI 87

Query: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152
            Y+C  SGIPTHHSREAWE D+ YH SK++  L+KVN+YEHDLRSGRPF EFDFPQ+QG 
Sbjct: 88  RYSCERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGR 147

Query: 153 DKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212
           D+ VN+ NWDLFLYTR FYSMDT+FQLAAVTKMLSYPITIGSLLH+FSPY+L P+GPITL
Sbjct: 148 DRMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITL 207

Query: 213 EGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNF 272
           EGLKSLAALRYTLYP E+ S  A  R++ MRIFILGARAEAQLPGHVWKQLQ+LFP  N 
Sbjct: 208 EGLKSLAALRYTLYP-ESESARA-VRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNM 265

Query: 273 EIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQDFFPYDPYMDV 332
           EIHFIGPE LY R ++EYV S+TPV +R+D TLK  HHTD+  VFHEAQDFFPYDPY DV
Sbjct: 266 EIHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDV 325

Query: 333 FFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSKYGKEMDIL 392
           FF FHPG+AS E   SWM +T+ ALLETKCAIF TGF++ D+  D   +++ +  EMD+L
Sbjct: 326 FFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVL 385

Query: 393 MDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           M P KN+FGSTKWELNDMNP EVYQFNMYIAGFRGKRYH I+
Sbjct: 386 MHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQ 427

>TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346
           YLR203C
          Length = 437

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/419 (64%), Positives = 332/419 (79%), Gaps = 12/419 (2%)

Query: 23  QNRLVVSHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTL 82
           +N +  S+ ++R+LMGFVR+ LGL           ENRFHPW+ SP  DLRERAA+I+T+
Sbjct: 14  KNIIACSNYSKRNLMGFVRSTLGLDPPPSPNDPTPENRFHPWETSPCDDLRERAARIKTM 73

Query: 83  AHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFP 142
           A CPV+  DINYTCP+SGIPTHHSR+ WEMD  YH +   +ILKKVNIYEHDLRSGRPFP
Sbjct: 74  AKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFP 133

Query: 143 EFDFPQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPY 202
           EFDFP++Q YD  +NL NWDL+ YTR+F+SMDTEFQLAAVTKMLSYP+TI S+LH+FSPY
Sbjct: 134 EFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPY 193

Query: 203 SLNPKGPITLEGLKSLAALRYTLY----------PLENRSVLATTRNRAMRIFILGARAE 252
           SL PKGP+TLEGLKSLAALRYTL             ++ ++ AT++NR MRIFILGARAE
Sbjct: 194 SLTPKGPVTLEGLKSLAALRYTLNNNSLSDTSSGNSDSTTITATSKNRPMRIFILGARAE 253

Query: 253 AQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTD 312
           AQLP HVWKQLQ+LFP  NFEIHFIGPE L  +DK  YV S TP+ +RID+++   +HTD
Sbjct: 254 AQLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTD 313

Query: 313 FFQVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKK 372
           +F V+H+AQDF+PYDPY D+FF FHPG A+ +   +W+ ETM  LL++KC IF TGF++K
Sbjct: 314 YFHVYHKAQDFYPYDPYFDIFFMFHPGLAATKE--TWLNETMQGLLDSKCPIFMTGFHEK 371

Query: 373 DLMDDINLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH 431
           D+  DI+++   + K+MDILM PVKNVFGSTKWELND NPQEVYQFNMYIAG+RGKRYH
Sbjct: 372 DITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYH 430

>NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {ON}
           Anc_7.346 YLR203C
          Length = 450

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/417 (65%), Positives = 323/417 (77%), Gaps = 18/417 (4%)

Query: 32  TRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKD 91
           + RH +GFV+NALG+           ENRFHPWDQSPS DLRERAA+IR LA CPVTGK+
Sbjct: 37  SNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDLRERAARIRALAKCPVTGKE 96

Query: 92  INYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQG 151
           INYTCP+SGIPTHHS+EAWE D  YH +K Y+ILKKVN++EHDLRSGR FPEF+FPQ Q 
Sbjct: 97  INYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQD 156

Query: 152 YDKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPIT 211
           +D AV++ NWD+F YTR F SMD+EFQLA VTKMLSYPITI S+LHK+ PY+L P GPIT
Sbjct: 157 HDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPIT 216

Query: 212 LEGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQN 271
           LEGLKS+AAL+Y+L      +   TT+ R MRIFILGARAE+QLP H+WKQ  +LFP QN
Sbjct: 217 LEGLKSIAALKYSL----RHNEFETTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQN 272

Query: 272 FEIHFIGPEC----LYKRDKQEYVKSATP----------VVQRIDETLKFFHHTDFFQVF 317
           FEI+FIGPEC           E   + T           +V+RIDE L   +HTDFF   
Sbjct: 273 FEINFIGPECSVLMNNNNMNAEETNTTTSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTL 332

Query: 318 HEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDD 377
           H A+DFFPYD Y DVFFTFHPG+ASPE+  SWMGETM ALL+TKCAIFTTGFNK+DL+ D
Sbjct: 333 HNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKD 392

Query: 378 INLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           I++V+  YGKE+D+LM P KNVFGSTKWELNDM+PQEVYQ+NMYIAGFRGKRYH +K
Sbjct: 393 IDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVK 449

>KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.346
           YLR203C
          Length = 426

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/430 (65%), Positives = 334/430 (77%), Gaps = 11/430 (2%)

Query: 8   SGAAQLYSHLLRRSPQNRLVVSHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQS 67
           SGA  +Y+    +  Q R++      R L+GFVRNALGL            NRF+PWDQS
Sbjct: 4   SGAPHVYARGRLQHLQRRVL-----SRTLVGFVRNALGLEPPPTPDEPRVSNRFYPWDQS 58

Query: 68  PSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKK 127
           PS +LRERAAKI+ +A CP+TGK+INYTCP+SGIPTHHSREAWE D+AYH +K  +ILKK
Sbjct: 59  PSPELRERAAKIKAMARCPITGKEINYTCPISGIPTHHSREAWEQDEAYHRNKIPDILKK 118

Query: 128 VNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLS 187
           VNIYEHDLRSGR FPEFDFP  Q +D+AVNL NWDL+ YTRSFYSMDTEFQLA VTKMLS
Sbjct: 119 VNIYEHDLRSGRSFPEFDFPSDQTFDRAVNLANWDLYFYTRSFYSMDTEFQLATVTKMLS 178

Query: 188 YPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLE---NRSVLATTRNRAMRI 244
           YPITI S+LH++SPYSL P GPITLEGLKS+AALRY+LYP +   +RSVL  T  R MRI
Sbjct: 179 YPITIASVLHQYSPYSLYPHGPITLEGLKSIAALRYSLYPSQHKSSRSVLNKT--RPMRI 236

Query: 245 FILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQRIDET 304
           FILGARAE+QLPGHVWKQ Q+LFP Q FEI FIGPEC   R+    V  A  +V+RID+T
Sbjct: 237 FILGARAESQLPGHVWKQFQYLFPLQTFEIIFIGPECQL-REPSNSVGGANNIVKRIDDT 295

Query: 305 LKFFHHTDFFQVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAI 364
           +   +H   F   H+AQDFFPYDPY DVFF FHPG+ASPE+   WM +T+ ALL+TKCA+
Sbjct: 296 ISLVYHPKLFHDIHKAQDFFPYDPYNDVFFVFHPGFASPETKELWMNDTVKALLDTKCAV 355

Query: 365 FTTGFNKKDLMDDINLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAG 424
           F TGF+KKDL +D+ L+   YG ++D LM PVKN+FGSTKWELND+NPQEVYQFNMYI+ 
Sbjct: 356 FHTGFSKKDLSNDVKLLNKMYGDKLDTLMTPVKNLFGSTKWELNDLNPQEVYQFNMYISA 415

Query: 425 FRGKRYHTIK 434
           FRGKRYH I+
Sbjct: 416 FRGKRYHPIE 425

>KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.346
           YLR203C
          Length = 424

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/408 (64%), Positives = 319/408 (78%), Gaps = 6/408 (1%)

Query: 27  VVSHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCP 86
           +V +   R +MG+VRNA GL            NRFHPW++SP  DLR+RAA+I+TLA CP
Sbjct: 22  IVRYTFHRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCP 81

Query: 87  VTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDF 146
           VTGK+INYTCP+SGIPTHHSR+AWE D  YH +K YE LKKVNIYEHDLRSGR FPEFDF
Sbjct: 82  VTGKNINYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDF 141

Query: 147 PQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNP 206
           P +QG D+AVNL NWDLFLYTR FYSMDTEF LA VTKMLSYPITI S+LH+FSPY L P
Sbjct: 142 PAEQGRDRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQP 201

Query: 207 KGPITLEGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHVWKQLQFL 266
           +GP+TLEGLKS+AALRYTLYP   ++ L+   N  MRIFI+G RAE+QLPGHVWKQLQ+L
Sbjct: 202 RGPVTLEGLKSIAALRYTLYPKLGKTSLSN--NSPMRIFIVGTRAESQLPGHVWKQLQYL 259

Query: 267 FPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQDFFPY 326
           F E+ FEIHFIGPEC  K  K     ++TP+++++D+TL   +H  +F   H++ D FPY
Sbjct: 260 FSERIFEIHFIGPECQLKEPKN----TSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPY 315

Query: 327 DPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSKYG 386
           +PY DVFF FHPG+A P++   W+ ET+  LLETKCAIF TGFN+ D+ +D+ L+   Y 
Sbjct: 316 NPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYR 375

Query: 387 KEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
            E+D+LM P+KNVFGS KWELND+NPQEVYQFNMYIAGFRGKRYH IK
Sbjct: 376 NEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIK 423

>CAGL0M08536g Chr13 complement(852150..853376) [1227 bp, 408 aa]
           {ON} weakly similar to uniprot|P36052 Saccharomyces
           cerevisiae YKL162c
          Length = 408

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 24/37 (64%), Gaps = 6/37 (16%)

Query: 2   TALYAPSGAAQLYSHLLRRSPQNRLV------VSHQT 32
           T +Y PS AA L+SHL RR P+++L       V+H+T
Sbjct: 260 TEVYVPSQAALLFSHLKRRFPEHKLFAVDSFEVTHET 296

>TBLA0H00280 Chr8 complement(43650..48146) [4497 bp, 1498 aa] {ON}
           Anc_2.406 YMR129W
          Length = 1498

 Score = 31.2 bits (69), Expect = 7.0,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 40/87 (45%), Gaps = 7/87 (8%)

Query: 326 YDPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSKY 385
           ++P+ D F  F+P +A+PE         +   + +  +I     N KDL  + N     +
Sbjct: 371 FNPFHDSFCQFNPTFATPEF------INVPIRINSTSSIKFIQLNYKDLSKNSNEQLLNF 424

Query: 386 -GKEMDILMDPVKNVFGSTKWELNDMN 411
             K+  ++ DP K +   TK +L  +N
Sbjct: 425 TNKDFKLIKDPTKLLSKKTKQQLQQIN 451

>Suva_13.142 Chr13 (227330..229084) [1755 bp, 584 aa] {ON} YML017W
           (REAL)
          Length = 584

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 36/82 (43%), Gaps = 2/82 (2%)

Query: 76  AAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDL 135
            +KI  L   P+TG++   T P    P  +S EA E       SKK   L K+     DL
Sbjct: 284 GSKITILKKQPLTGEESTSTTPTP-KPLSYS-EAVERSVVNETSKKSTPLSKIGTPSSDL 341

Query: 136 RSGRPFPEFDFPQQQGYDKAVN 157
           +S      F+   +QG +K  N
Sbjct: 342 QSTDKSDNFEGEDRQGSEKYEN 363

>Suva_10.243 Chr10 complement(442966..443868) [903 bp, 300 aa] {ON}
           YLR146C (REAL)
          Length = 300

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 42/104 (40%), Gaps = 13/104 (12%)

Query: 195 LLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQ 254
           LLH    ++LNP G + ++  +++           N   L   +N A R+F         
Sbjct: 193 LLH----HALNPNGIVIMQSSENIWL---------NLDYLRDLKNTAKRVFPNTEYCYTM 239

Query: 255 LPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVV 298
           +P +   QL  +    N  I  I P+ L    +QE +K   P +
Sbjct: 240 VPTYTSGQLGLIVCSNNDSIPLIAPQRLLSGQEQEQLKYYNPQI 283

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,889,989
Number of extensions: 2033278
Number of successful extensions: 4165
Number of sequences better than 10.0: 28
Number of HSP's gapped: 4239
Number of HSP's successfully gapped: 28
Length of query: 436
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 323
Effective length of database: 40,524,141
Effective search space: 13089297543
Effective search space used: 13089297543
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 67 (30.4 bits)