Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_10.2967.351ON26026012950.0
Skud_12.2657.351ON26026011421e-159
YLR201C (COQ9)7.351ON26026011381e-159
Smik_12.2607.351ON26026010561e-146
TDEL0C019707.351ON2602617911e-106
NCAS0E028707.351ON2612617671e-102
TBLA0E004507.351ON2792477671e-102
Kpol_530.307.351ON2602537541e-100
CAGL0A03949g7.351ON2682487482e-99
NDAI0E044707.351ON2642487265e-96
ZYRO0F11726g7.351ON2512537168e-95
KNAG0B026207.351ON2652587143e-94
TPHA0F029807.351ON2642557013e-92
SAKL0F11396g7.351ON2542466855e-90
KLTH0H01232g7.351ON2572476456e-84
KLLA0D12320g7.351ON2502466431e-83
Kwal_56.246447.351ON2582476413e-83
KAFR0L014807.351ON2642456275e-81
Ecym_47227.351ON2532465995e-77
ACL147W7.351ON2462465925e-76
YBR193C (MED8)8.551ON22366665.3
ZYRO0A10318g8.598ON60349667.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_10.296
         (260 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {O...   503   0.0  
Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {O...   444   e-159
YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}  ...   442   e-159
Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {O...   411   e-146
TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON...   309   e-106
NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON...   300   e-102
TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON} ...   300   e-102
Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON} ...   295   e-100
CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar...   292   2e-99
NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {...   284   5e-96
ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar...   280   8e-95
KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON...   279   3e-94
TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.35...   274   3e-92
SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar...   268   5e-90
KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {O...   253   6e-84
KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa] ...   252   1e-83
Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR20...   251   3e-83
KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.3...   246   5e-81
Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON...   235   5e-77
ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homol...   232   5e-76
YBR193C Chr2 complement(609082..609753) [672 bp, 223 aa] {ON}  M...    30   5.3  
ZYRO0A10318g Chr1 complement(839096..840907) [1812 bp, 603 aa] {...    30   7.5  

>Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  503 bits (1295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/260 (94%), Positives = 245/260 (94%)

Query: 1   MFSRNAVRKASASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTE 60
           MFSRNAVRKASASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTE
Sbjct: 1   MFSRNAVRKASASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTE 60

Query: 61  RSIVESLNKLGYXXXXXXXXXXXXXXXFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTP 120
           RSIVESLNKLGY               FVHSSTAVMELLKFQLVDKRYRLTEGINPDVTP
Sbjct: 61  RSIVESLNKLGYPSSMISSIGASNSPSFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTP 120

Query: 121 HYKLPSLEHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE 180
           HYKLPSLEHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE
Sbjct: 121 HYKLPSLEHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE 180

Query: 181 KDHHDSAWYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEE 240
           KDHHDSAWYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEE
Sbjct: 181 KDHHDSAWYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEE 240

Query: 241 FAWYTLMSTVNLVKSQLARG 260
           FAWYTLMSTVNLVKSQLARG
Sbjct: 241 FAWYTLMSTVNLVKSQLARG 260

>Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  444 bits (1142), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 216/260 (83%), Positives = 224/260 (86%)

Query: 1   MFSRNAVRKASASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTE 60
           MF RN  R      RLYHSNPIEHV PLHIKPL YGKQSPQYKVLSLAL EYVPKHGF+E
Sbjct: 1   MFCRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSE 60

Query: 61  RSIVESLNKLGYXXXXXXXXXXXXXXXFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTP 120
           RSIVESLNKLGY               F HSSTAVMEL+KFQLVDKRYRLTEGINPDVT 
Sbjct: 61  RSIVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTS 120

Query: 121 HYKLPSLEHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE 180
            YKLPSLEHLLLKRLEMDK +G QL DLMSQLA+PS  LFETAIPELHRLSDDMIYFSNE
Sbjct: 121 RYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNE 180

Query: 181 KDHHDSAWYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEE 240
           +DHHDSAWYAKRLAVSSTYIGS+LFMAQDKSHDF ETFAFAK+KLH+VMRLGEYYNNTEE
Sbjct: 181 EDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEE 240

Query: 241 FAWYTLMSTVNLVKSQLARG 260
           FAWYTLMSTVNLVKSQLARG
Sbjct: 241 FAWYTLMSTVNLVKSQLARG 260

>YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}
           COQ9Protein required for ubiquinone (coenzyme Q)
           biosynthesis and respiratory growth; localizes to the
           matrix face of the mitochondrial inner membrane in a
           large complex with ubiquinone biosynthetic enzymes
          Length = 260

 Score =  442 bits (1138), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 210/260 (80%), Positives = 225/260 (86%)

Query: 1   MFSRNAVRKASASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTE 60
           M  RN  R      RLYHSNPIEHV P+HIKPL YGK+SPQYKVLSLALQ++VP+HGF+E
Sbjct: 1   MLCRNTARTGCKFFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSE 60

Query: 61  RSIVESLNKLGYXXXXXXXXXXXXXXXFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTP 120
           RSIVESLN+LGY               F HSSTAVMEL+KFQLVDKRYRLTEGINPDVTP
Sbjct: 61  RSIVESLNELGYPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTP 120

Query: 121 HYKLPSLEHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE 180
            YKLPSLEHLLLKRLEMDKP+G  L++LMSQLAIPS FLFETAIPELHRLSDDMIYFSNE
Sbjct: 121 QYKLPSLEHLLLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNE 180

Query: 181 KDHHDSAWYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEE 240
           KDHHDSAWYAKRLAVSSTYIGS+LFMAQDKSH++ ETF FAKDKLHRVMRLGEYYNNTEE
Sbjct: 181 KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEE 240

Query: 241 FAWYTLMSTVNLVKSQLARG 260
           FAWYTLMSTVNL+KSQL RG
Sbjct: 241 FAWYTLMSTVNLIKSQLVRG 260

>Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  411 bits (1056), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 208/260 (80%), Positives = 224/260 (86%)

Query: 1   MFSRNAVRKASASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTE 60
           M  RN +RK   S RLYH NPIEHV   HIKPL YGK+SPQYKVLSLAL++YVPKHGF+E
Sbjct: 1   MLCRNILRKGCTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSE 60

Query: 61  RSIVESLNKLGYXXXXXXXXXXXXXXXFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTP 120
           RSIVESLN+LGY               F HSSTAVMEL+KFQLVDKRYRLTE INPDVTP
Sbjct: 61  RSIVESLNELGYPSSMISSISASNSPSFFHSSTAVMELIKFQLVDKRYRLTEAINPDVTP 120

Query: 121 HYKLPSLEHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE 180
            YKLPSLEHLLL+RLEMDKP+G  L++LMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE
Sbjct: 121 QYKLPSLEHLLLRRLEMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE 180

Query: 181 KDHHDSAWYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEE 240
           KDHHDSAWYAKRLAVSSTYIGS+LFMAQDKSH++ +TF FAK KL+RVMRLGEYYNNTEE
Sbjct: 181 KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEE 240

Query: 241 FAWYTLMSTVNLVKSQLARG 260
           FAWYTLMSTVNLVKSQL RG
Sbjct: 241 FAWYTLMSTVNLVKSQLVRG 260

>TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON}
           Anc_7.351 YLR201C
          Length = 260

 Score =  309 bits (791), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 156/261 (59%), Positives = 192/261 (73%), Gaps = 2/261 (0%)

Query: 1   MFSRNAVRKASASLRLYHSNPIEHVNPLHIK-PLAYGKQSPQYKVLSLALQEYVPKHGFT 59
           M S+  +  +    R Y     E++NP++ + PL YGK SPQYKVLS  L + VP +GF 
Sbjct: 1   MISKRLIAGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFN 60

Query: 60  ERSIVESLNKLGYXXXXXXXXXXXXXXXFVHSSTAVMELLKFQLVDKRYRLTEGINPDVT 119
           ER+IV SLN+LGY               F HSS A+MELLKF LVDKR  LTE I+ + T
Sbjct: 61  ERAIVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLE-T 119

Query: 120 PHYKLPSLEHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSN 179
           P  +LPSLEHL++KRLEM+ PV + L+ L+SQL+IP  FL + ++PELHRLSDDMIYFS 
Sbjct: 120 PVDQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFST 179

Query: 180 EKDHHDSAWYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTE 239
           EKDH+D AWY+KRLAVS  Y+ S+LFMAQD+S D+ ETF FA++KLHRV  LGEYYNNTE
Sbjct: 180 EKDHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTE 239

Query: 240 EFAWYTLMSTVNLVKSQLARG 260
           EFAWYTL+ST+NLVKSQLARG
Sbjct: 240 EFAWYTLLSTINLVKSQLARG 260

>NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON}
           Anc_7.351 YLR201C
          Length = 261

 Score =  300 bits (767), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 152/261 (58%), Positives = 190/261 (72%), Gaps = 1/261 (0%)

Query: 1   MFSRNAVRKASASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTE 60
           M +R+ ++K   S R YH +  E+V P  + PL Y K+S QYK+LS AL ++VPKHGF E
Sbjct: 1   MLNRSILKKGLFSYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKE 60

Query: 61  RSIVESLNKLGYXXXXXXXXXXXXXXXFVHS-STAVMELLKFQLVDKRYRLTEGINPDVT 119
           ++I +SLN+LG+                  S S AVMEL+KFQLV KRY LTE + PD T
Sbjct: 61  KAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTT 120

Query: 120 PHYKLPSLEHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSN 179
           P  +LPSLE LLLKRLEMDK +G+Q+  L ++LA PS FLF+ A+PELHRLSDDMIYFSN
Sbjct: 121 PKNELPSLESLLLKRLEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSN 180

Query: 180 EKDHHDSAWYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTE 239
           EKDHHD AWY KRL VS  Y+ S+L+MAQD S DF +T +FAKDKLHR+M+LGEYYNNTE
Sbjct: 181 EKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTE 240

Query: 240 EFAWYTLMSTVNLVKSQLARG 260
           E+AWY  M + NLV+++LAR 
Sbjct: 241 EYAWYMFMVSTNLVRARLARS 261

>TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON}
           Anc_7.351 YLR201C
          Length = 279

 Score =  300 bits (767), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 144/247 (58%), Positives = 184/247 (74%), Gaps = 3/247 (1%)

Query: 14  LRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESLNKLGYX 73
           +R Y+S   +     H++PL YGK S QY++L  A+Q  VP  GFTER+I+ S+NKLGY 
Sbjct: 36  IRTYYSVSNDVKKSDHLEPLLYGKDSAQYRILEDAVQNSVPTFGFTERAIINSINKLGYN 95

Query: 74  XXXXXXXXXXXXXXFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTPHYKLPSLEHLLLK 133
                          +HSS AV+ELLKF LV KR +L+EGI+P+      LPSLE+LLLK
Sbjct: 96  SSMISVLGSSNTHNILHSSPAVLELLKFNLVSKRLKLSEGIDPETK---DLPSLEYLLLK 152

Query: 134 RLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRL 193
           RL+MDK +  +L +++++L+IP  FL ET+IPEL RLSDDMIYFSNEKDHHD AWY+KRL
Sbjct: 153 RLQMDKAIQSRLNEMITKLSIPGTFLAETSIPELFRLSDDMIYFSNEKDHHDMAWYSKRL 212

Query: 194 AVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLV 253
           AVS+TYI SQ+FMAQD S D ++T  FA+DKL++VM LGEYYNNTEEF W+TLM++VN+V
Sbjct: 213 AVSTTYIASQIFMAQDTSVDCYKTLEFAQDKLNKVMNLGEYYNNTEEFLWFTLMTSVNIV 272

Query: 254 KSQLARG 260
           KSQLAR 
Sbjct: 273 KSQLARS 279

>Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON}
           complement(75011..75793) [783 nt, 261 aa]
          Length = 260

 Score =  295 bits (754), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 145/253 (57%), Positives = 185/253 (73%), Gaps = 1/253 (0%)

Query: 8   RKASASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESL 67
           R A    R YH NP E+V  L + PL YGK S QYK+LS +L   VP+ GF ER+IV S+
Sbjct: 9   RTAFGLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSI 68

Query: 68  NKLGYXXXXXXXXXXXXXXXFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTPHYKLPSL 127
           N LGY               F+HSSTA+MELLKF LV KRY+L+E I  D TP  +LPSL
Sbjct: 69  NLLGYPSSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLD-TPVEELPSL 127

Query: 128 EHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSA 187
           E LL+KRL+MD P+G  L+ L++QL+IP  FL +T++PELHRL+DDMIYFS+EKDH D A
Sbjct: 128 EDLLIKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFA 187

Query: 188 WYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLM 247
           WYAKR+ VS+ Y+ S+LFMAQD+S  + +TF FAKDKL R+M+LG+YYNN EE+AWY LM
Sbjct: 188 WYAKRMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLM 247

Query: 248 STVNLVKSQLARG 260
           +++N+ KS+ ARG
Sbjct: 248 NSINMAKSKAARG 260

>CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201c
          Length = 268

 Score =  292 bits (748), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 137/248 (55%), Positives = 180/248 (72%), Gaps = 1/248 (0%)

Query: 12  ASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESLNKLG 71
           +++R YH    E+VNP   +PL Y  +SP++K+LS  ++  VP+HGFTE++IV SLN + 
Sbjct: 21  SAVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMK 80

Query: 72  YXXXXXXXXXXXXXXXFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTPHYKLPSLEHLL 131
                           F+HSS AVMEL+KFQLV+KR+R+ EGI  ++    KLPSLE LL
Sbjct: 81  MPSGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGIT-EIAEASKLPSLESLL 139

Query: 132 LKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAK 191
           LKRL+MD P+   LT + +QL +PS F+   ++PEL RL+DDMIY+SNEKDHHD AWY K
Sbjct: 140 LKRLKMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTK 199

Query: 192 RLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVN 251
           R A+++TY+ S+ FMAQDKSH+F ET  FA+DKLH+VM LG+YYNN EEF W+TLMS VN
Sbjct: 200 RAALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVN 259

Query: 252 LVKSQLAR 259
           L KSQ+AR
Sbjct: 260 LTKSQMAR 267

>NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {ON}
           Anc_7.351 YLR201C
          Length = 264

 Score =  284 bits (726), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 140/248 (56%), Positives = 174/248 (70%), Gaps = 2/248 (0%)

Query: 15  RLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESLNKLGYXX 74
           R +HSN +E+     + PL Y K S QYK+LS AL ++VPK GFT+ +I  SLN+L    
Sbjct: 17  RAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITSSLNELDLSS 76

Query: 75  XXXXXXXXXXXXXFVHS-STAVMELLKFQLVDKRYRLTEGINPDV-TPHYKLPSLEHLLL 132
                           S S AVMELLKFQLV KRY+LTE I P + T   KLPSLE LL+
Sbjct: 77  SLFSVLGSSNSPSIFRSISPAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLETLLI 136

Query: 133 KRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKR 192
           +RL+MD+P+  QL+ L +QL IPS  LF  A+PEL  LSDD+IYFSNEKDHHD AWYAKR
Sbjct: 137 ERLKMDQPLNNQLSSLFNQLIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYAKR 196

Query: 193 LAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNL 252
           L VS  Y+ S+L+M ++   +F +T  FAKDKLHR+M LGEYYNNTEE+AWYTLM ++NL
Sbjct: 197 LGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSMNL 256

Query: 253 VKSQLARG 260
           VK++LARG
Sbjct: 257 VKARLARG 264

>ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 251

 Score =  280 bits (716), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 136/253 (53%), Positives = 178/253 (70%), Gaps = 5/253 (1%)

Query: 8   RKASASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESL 67
           R    SLR YH +  EH+N   + PL YG  SPQY VLS AL+  VP  GF ER+IV SL
Sbjct: 4   RLCQVSLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSL 63

Query: 68  NKLGYXXXXXXXXXXXXXXXFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTPHYKLPSL 127
           N+L Y                +HSS AVMEL+KF LV KR +L++ ++ +     + PSL
Sbjct: 64  NQLNYPSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLSSE-----EKPSL 118

Query: 128 EHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSA 187
           E L +KRLE++ P+   L+ L+S +++P  F  +TA+PELHRLSDD+IY+SNEKDHHD A
Sbjct: 119 EDLFIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFA 178

Query: 188 WYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLM 247
           WY+KRL +S  Y+ S+LFMAQDKSH++ ETF FA+DKL R M+LGEYYNNTEE+ WYTL+
Sbjct: 179 WYSKRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLL 238

Query: 248 STVNLVKSQLARG 260
           +++NL KSQ+ARG
Sbjct: 239 NSINLAKSQMARG 251

>KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON}
           Anc_7.351 YLR201C
          Length = 265

 Score =  279 bits (714), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 138/258 (53%), Positives = 177/258 (68%), Gaps = 2/258 (0%)

Query: 4   RNAV-RKASASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERS 62
           +N+V R+A  S RLYH NPIE+ N   + PL Y   SPQ ++L+  LQ  VP  GFTER+
Sbjct: 7   KNSVSRRALLSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERA 66

Query: 63  IVESLNKLGYXXXXXXXXXXXXXXXFVHSSTAVMELLKFQLVDKRYRLTEGINP-DVTPH 121
           +++S+  +GY                 HSS AVMEL+KF LV KR+ LTE +    +   
Sbjct: 67  LLKSIQAVGYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTESLAAAGLGSP 126

Query: 122 YKLPSLEHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEK 181
             LPSLEHLL+KRL+MD P+ +QL DL +QLA+PS F+   A+PEL RLSDDMIYFSNEK
Sbjct: 127 AALPSLEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEK 186

Query: 182 DHHDSAWYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEF 241
           DH D+AWY+KRL VS  Y  S+LFMAQD S +  +T  FA+DKLHR+M LGEYYNN EE+
Sbjct: 187 DHFDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEY 246

Query: 242 AWYTLMSTVNLVKSQLAR 259
           AWY++M+TVN  K+  +R
Sbjct: 247 AWYSIMTTVNRAKAGFSR 264

>TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  274 bits (701), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 140/255 (54%), Positives = 182/255 (71%), Gaps = 2/255 (0%)

Query: 8   RKASASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESL 67
           RK+  + R +H    E+V P  + P  Y K SPQ+K+LS A+   V K GF+ER+I+E++
Sbjct: 10  RKSGVNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAM 69

Query: 68  NKLGYXXXXXXXXXXXXXXX--FVHSSTAVMELLKFQLVDKRYRLTEGINPDVTPHYKLP 125
            +L                   F+HSS +VMELLKF LV KRYR+ EG++P      +LP
Sbjct: 70  KELKIENQSTMLSAIGSSNSPSFLHSSPSVMELLKFNLVLKRYRMIEGLDPLTMQQEELP 129

Query: 126 SLEHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHD 185
           SLE LLLKRLEMD P+G+ ++  MSQL IP  FL ++A+PELHRL+DDMIYFSNEKDHHD
Sbjct: 130 SLESLLLKRLEMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHD 189

Query: 186 SAWYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYT 245
            AWY+KRL VSS YI S+LFMAQD S ++ ET  FAKDKL +VMRLG+YYNNTEE+AWY 
Sbjct: 190 FAWYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYV 249

Query: 246 LMSTVNLVKSQLARG 260
           L+++VN+VKS+++R 
Sbjct: 250 LLNSVNMVKSRMSRA 264

>SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 254

 Score =  268 bits (685), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 135/246 (54%), Positives = 174/246 (70%), Gaps = 3/246 (1%)

Query: 15  RLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESLNKLGYXX 74
           R YH N +EH +   + PL Y K SPQ+K+L+ AL E VPK+GF ER++  S + LGY  
Sbjct: 12  RGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLGYSS 71

Query: 75  XXXXXXXXXXXXXFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTPHYKLPSLEHLLLKR 134
                        F +SS AV+ELLKF LV KRY LT+G+  D T   + PSLE+L LKR
Sbjct: 72  SFLSVLGASNSPSFFNSSPAVLELLKFHLVSKRYSLTDGV-ADGT--LESPSLENLFLKR 128

Query: 135 LEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194
           LEM+KP+   L+ L+S LA+P  FL E AIPELHRLSDDM+YFSNE DH+D AWY+KRLA
Sbjct: 129 LEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRLA 188

Query: 195 VSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLVK 254
           +S+ Y+ S+LFMAQDKS D+ +T  FAK+KL  + +LGE YNN EE+AWYTL+S+++L K
Sbjct: 189 ISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLAK 248

Query: 255 SQLARG 260
           SQ+ R 
Sbjct: 249 SQMTRS 254

>KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {ON}
           similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53
          Length = 257

 Score =  253 bits (645), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 125/247 (50%), Positives = 169/247 (68%), Gaps = 1/247 (0%)

Query: 15  RLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESLNKLGYXX 74
           RLYH + +EH       PL YG  S Q+KVL  AL ++VP +GF ER++V SLN L    
Sbjct: 11  RLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDLGP 70

Query: 75  XXXXXXXXXXXXXFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTPH-YKLPSLEHLLLK 133
                        F+++S AV+EL+KF LV KRY LT+ ++P  T    + P+LE L  +
Sbjct: 71  SLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLFHR 130

Query: 134 RLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRL 193
           RLE++KP+   LT L+S L+IP  FL +TA+PELHRLSDDM+YFS E D +D AWY+KR+
Sbjct: 131 RLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSKRI 190

Query: 194 AVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLV 253
           A+S  ++ S+LFMAQD+S ++ +TF FA +KLH V +LG+YYNNTEE+ WYTL+ +VNL 
Sbjct: 191 ALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVNLA 250

Query: 254 KSQLARG 260
           KSQL R 
Sbjct: 251 KSQLTRS 257

>KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa]
           {ON} similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53,
          Length = 250

 Score =  252 bits (643), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 123/246 (50%), Positives = 173/246 (70%), Gaps = 2/246 (0%)

Query: 15  RLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESLNKLGYXX 74
           RLYH N +EH  P  IKPL YG  S Q+KVLS AL ++VP++GF ER+IV+SLN+LG   
Sbjct: 7   RLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNELGMGS 66

Query: 75  XXXXXXXXXXXXXFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTPHYKLPSLEHLLLKR 134
                        F + S +V+EL+KF LV KR +L   +  D      LP L+ L L+R
Sbjct: 67  SYLSVLGSSNSPSFFNVSPSVLELVKFHLVSKRNQLITDLPLDSDK--PLPDLKTLFLQR 124

Query: 135 LEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194
           L++++ V   L+ L+S +++P  FL  TA+ ELH+L+DDMI++SNE+DH+D AWY+KR+A
Sbjct: 125 LKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKRIA 184

Query: 195 VSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLVK 254
           +S+ Y+ S+LFMAQDKSH+F ET  FA+ KL++V +LG  YNNTEE+ W+TL+S++NL K
Sbjct: 185 LSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINLAK 244

Query: 255 SQLARG 260
           SQ+ RG
Sbjct: 245 SQITRG 250

>Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR201C
           - Hypothetical ORF [contig 161] FULL
          Length = 258

 Score =  251 bits (641), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 123/247 (49%), Positives = 167/247 (67%), Gaps = 1/247 (0%)

Query: 15  RLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESLNKLGYXX 74
           R Y  NP+E+     + PLAYG QS Q+KVL  AL+ +VP +GF ER++V SLN LG   
Sbjct: 12  RFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVASLNDLGLGS 71

Query: 75  XXXXXXXXXXXXXFVHSSTAVMELLKFQLVDKRYRLTEGIN-PDVTPHYKLPSLEHLLLK 133
                         ++SS AV+EL+KF LV KRY LT+ ++        + P+LE L  K
Sbjct: 72  QVLSSIGAPNSPPLLNSSPAVLELVKFHLVTKRYALTKDLDIARCASPAEPPALETLFHK 131

Query: 134 RLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRL 193
           RLE++ P+ + +T L++ LA+P  FL ++A+PELHRLSDDMIYFS E D +D AWY+KR 
Sbjct: 132 RLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFAWYSKRA 191

Query: 194 AVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLV 253
           A+S  ++ S+LFMAQDKS ++ +TF FA DKLH V +LG+YY NTEE+ WYTL+ +VNL 
Sbjct: 192 AISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLLMSVNLA 251

Query: 254 KSQLARG 260
           KSQ+ R 
Sbjct: 252 KSQITRS 258

>KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  246 bits (627), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 167/245 (68%), Gaps = 5/245 (2%)

Query: 15  RLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESLNKLGYXX 74
           RLYH    E+VNP  I PL Y   S Q K+LS +L+EYVP  GF E+SI++S+N LGY  
Sbjct: 24  RLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGYSS 83

Query: 75  XXXXXXXXXXXXXFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTPHYKLPSLEHLLLKR 134
                        F HSS AV+EL+K+ LV KR  LT+      T      +L+ LLLKR
Sbjct: 84  SMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIELTK-----DTNDNTTTTLKELLLKR 138

Query: 135 LEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194
           LEMD P+  QL  L +QLA P  F+F+ ++PEL +L+DDMI+FSNEKDHHD AWY+KRLA
Sbjct: 139 LEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRLA 198

Query: 195 VSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLVK 254
           VS  Y+ S++FM QD S++F  T  FA DK+ RVM LGEYYNN EE+AW+TLM+++NLVK
Sbjct: 199 VSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLVK 258

Query: 255 SQLAR 259
           SQ +R
Sbjct: 259 SQFSR 263

>Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii ACL147W
          Length = 253

 Score =  235 bits (599), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 117/246 (47%), Positives = 158/246 (64%), Gaps = 7/246 (2%)

Query: 15  RLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESLNKLGYXX 74
           R YH N  E+     ++PL YG+ SPQYKVL+ AL++YVP  GF + +IV++ N+LGY  
Sbjct: 15  RFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGYNS 74

Query: 75  XXXXXXXXXXXXXFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTPHYKLPSLEHLLLKR 134
                          + ST+V EL+KF LV KRY L E             +LE L LKR
Sbjct: 75  AVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQE-------DQEGTKTLEELFLKR 127

Query: 135 LEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194
           LE +K +G  L +++S LAIP  FL  T +PEL +L+DDMIY+S EKD +D AWY+KRLA
Sbjct: 128 LEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKRLA 187

Query: 195 VSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLVK 254
           VS  YI ++LFMA+D S +F  T  FAK +++++  +G  YNN EEFAW+ L++TVNL +
Sbjct: 188 VSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNLAR 247

Query: 255 SQLARG 260
           SQL RG
Sbjct: 248 SQLVRG 253

>ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR201C
          Length = 246

 Score =  232 bits (592), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 118/246 (47%), Positives = 154/246 (62%), Gaps = 6/246 (2%)

Query: 15  RLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESLNKLGYXX 74
           RLYH N +EH     ++PLAY + SPQYKVL  AL+ +VP  GF ER+IV +   LGY  
Sbjct: 7   RLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGYGS 66

Query: 75  XXXXXXXXXXXXXFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTPHYKLPSLEHLLLKR 134
                         ++  +AV+EL+KF LV KR  L +             S+E L L+R
Sbjct: 67  AVLSALAAPNSPALLNVPSAVLELVKFHLVTKRVALADAAAQGNV------SMEQLFLQR 120

Query: 135 LEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194
           +E D+P+  QLT L+S L++P  FL  TA+PEL RLSDD+IY+S EKDH D AWY+KR A
Sbjct: 121 VEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRAA 180

Query: 195 VSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLVK 254
           V+  Y+ + LFMA+D+S    ET  FA+ +L +V  LG  YNN EEFAWY L+  +NLVK
Sbjct: 181 VAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLVK 240

Query: 255 SQLARG 260
           SQL RG
Sbjct: 241 SQLTRG 246

>YBR193C Chr2 complement(609082..609753) [672 bp, 223 aa] {ON}
           MED8Subunit of the RNA polymerase II mediator complex;
           associates with core polymerase subunits to form the RNA
           polymerase II holoenzyme; essential for transcriptional
           regulation
          Length = 223

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 8/66 (12%)

Query: 201 GSQLFMAQDKSHDFHETFAFAKDKL--------HRVMRLGEYYNNTEEFAWYTLMSTVNL 252
           G+Q  + +D S DF+     A D +        H + R+ +  +  E   WYTL S +N+
Sbjct: 12  GNQGSLQEDVSFDFNGVPGQALDAVRMRLAQLTHSLRRIRDEMSKAELPQWYTLQSQLNV 71

Query: 253 VKSQLA 258
             SQL 
Sbjct: 72  TLSQLV 77

>ZYRO0A10318g Chr1 complement(839096..840907) [1812 bp, 603 aa] {ON}
           similar to uniprot|Q02981 Saccharomyces cerevisiae
           YPL109C Hypothetical ORF
          Length = 603

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 23  EHVNPLH-IKPLAYGKQSPQ-YKVLSLALQEYVPKHGFTERSIVESLNK 69
           EH + +H ++ LA+   S +  K L  ALQEY P+  F +  ++  LNK
Sbjct: 432 EHFSIVHKLRQLAHENNSDELVKELKYALQEYTPQICFIDAGLITELNK 480

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,324,088
Number of extensions: 999632
Number of successful extensions: 2380
Number of sequences better than 10.0: 25
Number of HSP's gapped: 2421
Number of HSP's successfully gapped: 25
Length of query: 260
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 153
Effective length of database: 41,212,137
Effective search space: 6305456961
Effective search space used: 6305456961
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)