Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_10.2957.352ON1141145792e-78
Smik_12.2597.352ON1141145123e-68
Skud_12.2647.352ON1141145072e-67
YLR200W (YKE2)7.352ON1141145012e-66
KAFR0L014907.352ON1071064091e-52
TPHA0F029907.352ON1071063979e-51
ZYRO0F11748g7.352ON1091083961e-50
NCAS0E028607.352ON1051033882e-49
TDEL0C019607.352ON1071063873e-49
TBLA0E004407.352ON1151103841e-48
Kpol_530.297.352ON1071073787e-48
CAGL0A03971g7.352ON1061003787e-48
KLLA0D12298g7.352ON115993683e-46
KNAG0B026107.352ON1191033632e-45
NDAI0E044607.352ON1061023526e-44
SAKL0F11418g7.352ON1151033529e-44
Ecym_47217.352ON1071033466e-43
ACL146C7.352ON1071033388e-42
Kwal_56.246487.352ON1131053362e-41
KLTH0H01210g7.352ON1131043232e-39
TPHA0H027307.69ON51693730.16
TPHA0J003306.20ON110774720.17
KLTH0E11374g8.489ON21639680.57
TBLA0D046107.186ON117434670.86
NDAI0G044402.653ON170895661.2
TPHA0D042503.492ON629106651.8
YHL014C (YLF2)2.549ON40534642.0
Suva_9.254na 1ON23435642.1
Ecym_43118.259ON137640642.3
KNAG0E005705.94ON98169624.2
TBLA0F009003.153ON85351624.4
KNAG0D035204.113ON103063624.8
KLTH0C05346g7.447ON10254595.6
Skud_1.267.53ON28892606.0
SAKL0B01078g8.28ON1302116616.4
NDAI0E024608.609ON48661606.7
KAFR0A080502.5ON45074606.9
KAFR0A073402.101ON12960597.4
KLLA0E04753g7.531ON33047598.4
TPHA0K019904.46ON91048599.5
TDEL0F041408.287ON158759599.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_10.295
         (114 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W...   227   2e-78
Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W...   201   3e-68
Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W...   199   2e-67
YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subuni...   197   2e-66
KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {O...   162   1e-52
TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON...   157   9e-51
ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {O...   157   1e-50
NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.35...   154   2e-49
TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.35...   153   3e-49
TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352 ...   152   1e-48
Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON} (74361..74...   150   7e-48
CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {O...   150   7e-48
KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} simil...   146   3e-46
KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.35...   144   2e-45
NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7....   140   6e-44
SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {O...   140   9e-44
Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar ...   137   6e-43
ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON} Synt...   134   8e-42
Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa] ...   134   2e-41
KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar...   129   2e-39
TPHA0H02730 Chr8 complement(642961..644511) [1551 bp, 516 aa] {O...    33   0.16 
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...    32   0.17 
KLTH0E11374g Chr5 (1017534..1018184) [651 bp, 216 aa] {ON} some ...    31   0.57 
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    30   0.86 
NDAI0G04440 Chr7 complement(1060016..1065142) [5127 bp, 1708 aa]...    30   1.2  
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...    30   1.8  
YHL014C Chr8 complement(76097..77314) [1218 bp, 405 aa] {ON}  YL...    29   2.0  
Suva_9.254 Chr9 complement(408977..409681) [705 bp, 234 aa] {ON}...    29   2.1  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...    29   2.3  
KNAG0E00570 Chr5 (95945..98890) [2946 bp, 981 aa] {ON} Anc_5.94 ...    28   4.2  
TBLA0F00900 Chr6 (227895..230456) [2562 bp, 853 aa] {ON} Anc_3.1...    28   4.4  
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    28   4.8  
KLTH0C05346g Chr3 (460241..460549) [309 bp, 102 aa] {ON} similar...    27   5.6  
Skud_1.26 Chr1 (55314..56180) [867 bp, 288 aa] {ON} YAL034W-A (R...    28   6.0  
SAKL0B01078g Chr2 (97198..101106) [3909 bp, 1302 aa] {ON} simila...    28   6.4  
NDAI0E02460 Chr5 (509417..510877) [1461 bp, 486 aa] {ON}               28   6.7  
KAFR0A08050 Chr1 complement(1612166..1613518) [1353 bp, 450 aa] ...    28   6.9  
KAFR0A07340 Chr1 (1481834..1482223) [390 bp, 129 aa] {ON} Anc_2....    27   7.4  
KLLA0E04753g Chr5 complement(423256..424248) [993 bp, 330 aa] {O...    27   8.4  
TPHA0K01990 Chr11 complement(419705..422437) [2733 bp, 910 aa] {...    27   9.5  
TDEL0F04140 Chr6 (760626..765389) [4764 bp, 1587 aa] {ON} Anc_8....    27   9.9  

>Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  227 bits (579), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 114/114 (100%), Positives = 114/114 (100%)

Query: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60
           MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE
Sbjct: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60

Query: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNAATAAGPDR 114
           QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNAATAAGPDR
Sbjct: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNAATAAGPDR 114

>Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  201 bits (512), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 98/114 (85%), Positives = 107/114 (93%)

Query: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60
           MSELG KYQHLQ ELEEFIVARQKLETQLQENKIVNEEFDQL+E+TPVYKLTGNVLLPV+
Sbjct: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60

Query: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNAATAAGPDR 114
           QSEARGNV+KRLEFIE EI RCEKNI+ KQE+LE+VRN+L+KLNNAA A GPDR
Sbjct: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNAAAATGPDR 114

>Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  199 bits (507), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 98/114 (85%), Positives = 107/114 (93%)

Query: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60
           MSELGA+YQHLQSELEEFIVARQKLETQLQENKIVNEEFDQ+ +DTPVYKLTGNVLLPVE
Sbjct: 1   MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVE 60

Query: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNAATAAGPDR 114
           QSEARGNV+KRLEFIETEIKRCE+NIR KQ+ELE+VRNEL+KLNNA    G +R
Sbjct: 61  QSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNATAVVGAER 114

>YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subunit
           of the heterohexameric Gim/prefoldin protein complex
           involved in the folding of alpha-tubulin, beta-tubulin,
           and actin
          Length = 114

 Score =  197 bits (501), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 98/114 (85%), Positives = 106/114 (92%)

Query: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60
           MSELGAKYQ LQ+ELEEFIVARQKLETQLQENKIVNEEFDQL+EDTPVYKLTGNVLLPVE
Sbjct: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60

Query: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNAATAAGPDR 114
           QSEAR NV+KRLEFIETEI RCEKNIR KQEELE++R+EL+KLNN A + GP R
Sbjct: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAASTGPGR 114

>KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  162 bits (409), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 91/106 (85%)

Query: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60
           MSEL A+YQ LQSELEE IVARQKLETQLQENKIVN+EF  LKE+T VYKLTGNVLLP+E
Sbjct: 1   MSELAAQYQKLQSELEELIVARQKLETQLQENKIVNDEFKSLKEETQVYKLTGNVLLPIE 60

Query: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNA 106
           Q EARGNV+KRLEFIE EI RCE NI+ KQ E+E +RNELVKL + 
Sbjct: 61  QDEARGNVDKRLEFIEKEITRCEGNIKSKQTEIENIRNELVKLRSG 106

>TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  157 bits (397), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 75/106 (70%), Positives = 93/106 (87%)

Query: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60
           MS++ AKYQ +Q ELEE I+ARQKLETQLQENKIVN+EF+ L EDTP+YKLTGNV+LP+E
Sbjct: 1   MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIE 60

Query: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNA 106
           Q EA+ NVEKRLEFIE EIKRCE+NI+ KQ+EL+++R EL+K+  A
Sbjct: 61  QFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGA 106

>ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {ON}
           highly similar to uniprot|P52553 Saccharomyces
           cerevisiae YLR200W YKE2 Yeast nuclear gene
          Length = 109

 Score =  157 bits (396), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 91/108 (84%)

Query: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60
           MSEL A+YQ LQ ELE FIVARQKLETQLQENKIV++EF+ LK D+ VYKLTGNVLLPVE
Sbjct: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60

Query: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNAAT 108
           Q +AR NV KRLEFI+TEI RCE NI+GKQEE E+V+ EL+KL +  T
Sbjct: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRSGDT 108

>NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.352
           YLR200W
          Length = 105

 Score =  154 bits (388), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 76/103 (73%), Positives = 92/103 (89%)

Query: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60
           M++L A+YQ LQSELE FI+ARQKLETQLQENKIV +EF+QL ++T VYKLTGNVLLPVE
Sbjct: 1   MADLPAQYQSLQSELESFIIARQKLETQLQENKIVMDEFEQLVDETKVYKLTGNVLLPVE 60

Query: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKL 103
           Q EAR NVEKRLEFI++EI +CEKNI+ KQEELE+VR E++K+
Sbjct: 61  QDEARSNVEKRLEFIQSEITKCEKNIKQKQEELEKVRAEIIKM 103

>TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.352
           YLR200W
          Length = 107

 Score =  153 bits (387), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 77/106 (72%), Positives = 89/106 (83%)

Query: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60
           MS+L A YQ LQSELE  ++ARQKLETQLQENKIV+EEF +LKEDT VYKLTGNVLLPVE
Sbjct: 1   MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE 60

Query: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNA 106
           QSEA  NV KRLEFI+TEI RCE N++ KQ+E E++R EL+KL  A
Sbjct: 61  QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGA 106

>TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352
           YLR200W
          Length = 115

 Score =  152 bits (384), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 91/110 (82%)

Query: 2   SELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVEQ 61
           +EL  KYQ  Q+ELE FIV RQKLETQLQENKIVN+EF++LKE+T V+KLTGNVLLP+EQ
Sbjct: 4   NELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPIEQ 63

Query: 62  SEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNAATAAG 111
            EAR N++KRLEFI+TEI RCEKNI+ KQ E+E++R+EL+    A T A 
Sbjct: 64  DEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELMATAPAPTPAS 113

>Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON}
           (74361..74684) [324 nt, 108 aa]
          Length = 107

 Score =  150 bits (378), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 78/107 (72%), Positives = 89/107 (83%)

Query: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60
           MS+L  KYQ +Q ELEE IVAR++LETQLQENKIVNEEF+ LKEDT VYKLTGNVLLPVE
Sbjct: 1   MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE 60

Query: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNAA 107
           Q EAR NVEKRLEFIE EIK+CE NI+ KQ EL ++R+EL+K    A
Sbjct: 61  QFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRGGA 107

>CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200w YKE2 Gim complex component
          Length = 106

 Score =  150 bits (378), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 85/100 (85%)

Query: 2   SELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVEQ 61
           +ELGAKYQ LQ+ELEE + ARQKLETQLQENKIVNEEF  LKEDT VYKLTGNVLLPVE 
Sbjct: 3   AELGAKYQSLQNELEELVTARQKLETQLQENKIVNEEFATLKEDTVVYKLTGNVLLPVEH 62

Query: 62  SEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELV 101
            +A+ NV+KRLEFI  EIKRCE NIR KQ+ELE +R +L+
Sbjct: 63  DDAKNNVDKRLEFIGEEIKRCEDNIRSKQQELETIRGQLI 102

>KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} similar
           to uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 115

 Score =  146 bits (368), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 74/99 (74%), Positives = 83/99 (83%)

Query: 7   KYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVEQSEARG 66
           KY  LQ ELEE IVARQKLETQLQENKIV++EF  LK+D  VYKLTG VLLPVEQ EA+G
Sbjct: 9   KYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVEQFEAKG 68

Query: 67  NVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNN 105
           NVEKRLEFIE EIKRCE NI+ KQ+ELE  R+EL+KL +
Sbjct: 69  NVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107

>KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.352
           YLR200W
          Length = 119

 Score =  144 bits (363), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 76/103 (73%), Positives = 85/103 (82%)

Query: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60
           MS   AKYQ  QS LEE IVARQKLETQLQENKIV EEFD LKED+ VYKLTG+VLLPV+
Sbjct: 1   MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVD 60

Query: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKL 103
           Q EAR NV+KRLEFI  EI RCE+NI+ KQE LE +R+EL+KL
Sbjct: 61  QDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKL 103

>NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7.352
           YLR200W
          Length = 106

 Score =  140 bits (352), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 70/102 (68%), Positives = 86/102 (84%)

Query: 2   SELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVEQ 61
           S L +KYQ LQ ELE+ I+ARQKLETQLQENKIV EEF+QL  ++ VYKLTGNVLLPV+Q
Sbjct: 3   SNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQ 62

Query: 62  SEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKL 103
            EA  NV+KRLEFI+TEI RCE NI+ KQ+EL+ VR+E++K+
Sbjct: 63  EEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKM 104

>SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200W YKE2 Yeast nuclear gene
          Length = 115

 Score =  140 bits (352), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 87/103 (84%)

Query: 4   LGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVEQSE 63
           L  +Y  +QSELE+ ++ARQKLETQLQENKIV +EFD L++++ VYKLTG VLLPVEQ E
Sbjct: 9   LSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLPVEQEE 68

Query: 64  ARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNA 106
           A+GNVEKRL+FI+ EI RCE+NI+ KQ +LE++RNELV+L  A
Sbjct: 69  AKGNVEKRLQFIKNEITRCEENIKEKQTQLERLRNELVRLRTA 111

>Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar to
           Ashbya gossypii ACL146C
          Length = 107

 Score =  137 bits (346), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 71/103 (68%), Positives = 80/103 (77%)

Query: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60
           + ++ AKY  LQ ELE+ IV RQKLETQLQENKIVNEE   LKED  VYKLTG VLLPVE
Sbjct: 3   VEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVE 62

Query: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKL 103
             EA  NV KRLEFI+ EI RCE NI+ KQ+ELEQ R+EL+KL
Sbjct: 63  HEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKL 105

>ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR200W
           (YKE2)
          Length = 107

 Score =  134 bits (338), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 70/103 (67%), Positives = 79/103 (76%)

Query: 3   ELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVEQS 62
           ++  KY  LQ ELEE +V RQKLETQLQENKIVNEE   L+ +T VYKLTG VLLPVEQ 
Sbjct: 5   QVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQE 64

Query: 63  EARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNN 105
           EA GNV KRLEFIE EI+RCE+NI+ KQEE+E  R  LVKL  
Sbjct: 65  EAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107

>Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa]
           {ON} YLR200W (YKE2) - Polypeptide 6 of a Yeast
           Non-native Actin Binding Complex, homolog of a component
           of the bovine NABC complex [contig 161] FULL
          Length = 113

 Score =  134 bits (336), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 69/105 (65%), Positives = 80/105 (76%)

Query: 3   ELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVEQS 62
           EL   Y   Q ELEE + ARQ+LETQLQENKIV +EFD LKE+T VYKLTG VLLPVEQ 
Sbjct: 7   ELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQF 66

Query: 63  EARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNAA 107
           EA+ NV KRLEFI TEIKRCE NI+ KQ  LE++R EL++   A+
Sbjct: 67  EAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEAS 111

>KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar to
           uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 113

 Score =  129 bits (323), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 80/104 (76%)

Query: 3   ELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVEQS 62
           +L   Y   Q ELEE ++ARQKLETQLQENKIV +EFD L+E+T VYKLTGNVLLPVEQ 
Sbjct: 7   DLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVEQF 66

Query: 63  EARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNA 106
           EA+ NV KRLEFI  EI RCE+NI+ KQ  LE++R EL++   A
Sbjct: 67  EAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQA 110

>TPHA0H02730 Chr8 complement(642961..644511) [1551 bp, 516 aa] {ON}
           Anc_7.69 YOR324C
          Length = 516

 Score = 32.7 bits (73), Expect = 0.16,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 54/93 (58%), Gaps = 8/93 (8%)

Query: 3   ELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVEQS 62
           +L  + Q L+S L +  +A   ++    EN  ++++FD+  E + +Y++T NV   VE+ 
Sbjct: 412 DLSQRLQKLRSNLNDITLA---VKNSHLEN--LDKKFDRNNESSLIYQVTENVAEFVEKL 466

Query: 63  EARGNVEKRLEFIETEIKRCEKNIRGKQEELEQ 95
           E   N++KR +  ++ + R  + IR  ++ELE+
Sbjct: 467 E---NIQKRYDTCKSLVDRHREVIRIMEQELEK 496

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
            YML002W
          Length = 1107

 Score = 32.3 bits (72), Expect = 0.17,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 11/74 (14%)

Query: 36   NEEFDQLKEDTPVYKLTGNVLLPVEQSEARGNVEKRLEF----IETEIKRCEKNIRGKQE 91
            NEE   L E+T V++   NV    E+       E+RL+F    +E ++K+    IR K E
Sbjct: 1005 NEETGNLSENTSVFRYAWNVTYRKEE-------ERRLKFAMLELERDLKKLGTEIRVKHE 1057

Query: 92   ELEQVRNELVKLNN 105
            EL +  ++ V++ +
Sbjct: 1058 ELAEEFSDYVRMKS 1071

>KLTH0E11374g Chr5 (1017534..1018184) [651 bp, 216 aa] {ON} some
           similarities with uniprot|Q6LE92 Saccharomyces
           cerevisiae YPL041C Hypothetical ORF
          Length = 216

 Score = 30.8 bits (68), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 24/39 (61%)

Query: 19  IVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLL 57
           ++++ KL T+L +   +   FD+L E +PV  ++  ++L
Sbjct: 69  LISKSKLLTRLSKRPAIGHYFDKLAETSPVSTISSFLIL 107

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1174

 Score = 30.4 bits (67), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%)

Query: 70  KRLEFIETEIKRCEKNIRGKQEELEQVRNELVKL 103
           KR E I  EIK CE +I  +Q +LE ++N ++++
Sbjct: 749 KRNEAISLEIKSCENSITQEQNKLESIQNSIIQI 782

>NDAI0G04440 Chr7 complement(1060016..1065142) [5127 bp, 1708 aa] {ON}
            Anc_2.653 YKL014C
          Length = 1708

 Score = 30.0 bits (66), Expect = 1.2,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 10/95 (10%)

Query: 13   SELEEFIVARQKLETQLQEN----KIVNEEFDQLKEDTPVYKLTGNVLLPVEQSEARGNV 68
            S+L   I   + LE  LQ       +++E  + LKE+    K+   +L   +Q +     
Sbjct: 994  SQLLNNISTSKLLEVFLQSPYFSIDVISENLETLKENKYAKKIAIGILEKNQQEQ----- 1048

Query: 69   EKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKL 103
            E   EF+E  +K+C +N+R  QE  E + + L  L
Sbjct: 1049 ENIKEFVELCVKQCYENLRTPQEN-EDIEDSLALL 1082

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score = 29.6 bits (65), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 55/106 (51%), Gaps = 8/106 (7%)

Query: 7   KYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVEQSEARG 66
           KY   + E E+ +V  QK    ++E K ++    Q K +   Y+L  NVL      +++ 
Sbjct: 362 KYNTKKQEYEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVL----DVQSKY 417

Query: 67  NVEKRLEFIETEIKRCEKNIRGKQEELEQ---VRNELVKLNNAATA 109
           NV+K     ETE+ + +K I  K++ L +   V+NE+ KLNN   A
Sbjct: 418 NVDKGKVIKETELMKLQK-INAKEDLLAKQLDVKNEIEKLNNEKEA 462

>YHL014C Chr8 complement(76097..77314) [1218 bp, 405 aa] {ON}
           YLF2Protein of unknown function, has weak similarity to
           E. coli GTP-binding protein gtp1; the authentic,
           non-tagged protein is detected in highly purified
           mitochondria in high-throughput studies
          Length = 405

 Score = 29.3 bits (64), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 24/34 (70%), Gaps = 1/34 (2%)

Query: 16  EEFIVARQKLETQLQENK-IVNEEFDQLKEDTPV 48
           ++F++   + E+QL E K I +E FD++KEDT V
Sbjct: 258 DKFLLFSAEFESQLMECKGIASEYFDKIKEDTNV 291

>Suva_9.254 Chr9 complement(408977..409681) [705 bp, 234 aa] {ON}
           YIR038C (REAL)
          Length = 234

 Score = 29.3 bits (64), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 22/35 (62%)

Query: 47  PVYKLTGNVLLPVEQSEARGNVEKRLEFIETEIKR 81
           P+  L G V   + Q+ + G ++ +L+F+E EIK+
Sbjct: 135 PISYLAGKVADKISQAYSSGEMKNQLDFLEAEIKK 169

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
           similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 29.3 bits (64), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (52%)

Query: 65  RGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLN 104
           R   EK L+  E  I+ CE NIR   E   +  N L++LN
Sbjct: 436 RTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELN 475

>KNAG0E00570 Chr5 (95945..98890) [2946 bp, 981 aa] {ON} Anc_5.94
           YHR154W
          Length = 981

 Score = 28.5 bits (62), Expect = 4.2,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 7/69 (10%)

Query: 45  DTPVYKLTGNVLLPVEQSEARGNVEKRLEFIETEIKRCEKNIRGKQ------EELEQVRN 98
           DTP+   T   L  V + +AR   EKRL      +   +KN + K+      EE+EQ+ +
Sbjct: 650 DTPITPPTEPALSGVGRRQARAEAEKRLHTDIEALNAFQKNSKRKRIGDLLPEEIEQLES 709

Query: 99  ELVKLNNAA 107
            + ++NN A
Sbjct: 710 -VKRVNNEA 717

>TBLA0F00900 Chr6 (227895..230456) [2562 bp, 853 aa] {ON} Anc_3.153
           YDL040C
          Length = 853

 Score = 28.5 bits (62), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 20  VARQKLETQLQE---NKIVNEEFDQLKEDTPVYKLTGNVLLPVEQSEARGN 67
           VA + LET++ E   N+I N EFD +K     YK+   + L + +   RGN
Sbjct: 775 VALKGLETEISEFPINEINNNEFDWMKYFQDNYKIHNLISLVLLKHYLRGN 825

>KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1030

 Score = 28.5 bits (62), Expect = 4.8,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 3/63 (4%)

Query: 26  ETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVEQSEARGNVEKRLEFIETEIKRCEKN 85
           + Q++E +++    D L   + VYK    +L PV+QS    +V K L+ +    ++CE+N
Sbjct: 855 QLQVKEPQLIACTRDILDTKSQVYKY---LLTPVQQSGFHISVRKLLKDLGVVGQQCEEN 911

Query: 86  IRG 88
            +G
Sbjct: 912 EKG 914

>KLTH0C05346g Chr3 (460241..460549) [309 bp, 102 aa] {ON} similar
          to uniprot|P47128 Saccharomyces cerevisiae YJR082C EAF6
          Esa1p-associated factor subunit of the NuA4
          acetyltransferase complex
          Length = 102

 Score = 27.3 bits (59), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 7/54 (12%)

Query: 1  MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGN 54
          M E    YQ L+ EL+E +V R+ LE Q   ++I  E FD+       Y LTGN
Sbjct: 1  MDEAHQHYQKLKQELQEALVDRETLEKQW--DQIQQEIFDK----ESAY-LTGN 47

>Skud_1.26 Chr1 (55314..56180) [867 bp, 288 aa] {ON} YAL034W-A
           (REAL)
          Length = 288

 Score = 27.7 bits (60), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 51/92 (55%), Gaps = 12/92 (13%)

Query: 16  EEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVEQSEA---RGNVEKRL 72
           EE      KLE+ L+ +  V++ FD+L+    +Y L   + +P E  +A   R   +K L
Sbjct: 59  EEIKSGVAKLESLLENS--VDKNFDKLE----LYVLRNVLRIPEEYLDANVFRLESQKDL 112

Query: 73  EFI-ETEIKRCEKNIRGKQEELEQV--RNELV 101
             + +TEIKR E+ +RGK  ++E    RNE++
Sbjct: 113 VIVNDTEIKRSEEELRGKVNDVELAFKRNEML 144

>SAKL0B01078g Chr2 (97198..101106) [3909 bp, 1302 aa] {ON} similar
           to uniprot|P13433 Saccharomyces cerevisiae YFL036W
          Length = 1302

 Score = 28.1 bits (61), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 51/116 (43%), Gaps = 31/116 (26%)

Query: 11  LQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVEQSEARGNVE- 69
            +S L+EF   RQ+   QL EN+  +   ++ K D              E+++ARG++  
Sbjct: 354 FESALDEFNQERQR---QL-ENRATDAAKERWKHD-------------FEEAKARGDISI 396

Query: 70  -------------KRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNAATAAGP 112
                        + L  ++ E+KRC + + G  ++LE +  +  K N A    GP
Sbjct: 397 QKKLNVKLWEWYNQMLPLVKEEVKRCSQVVSGPLKDLETLSAQEKKQNKARLEYGP 452

>NDAI0E02460 Chr5 (509417..510877) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score = 27.7 bits (60), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 6/61 (9%)

Query: 55  VLLPVEQSEARGNV----EKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNAATAA 110
           +++P+ Q E    +    EKR ++IE + +  EKNI   ++ELE+V  +  K    AT  
Sbjct: 413 IVIPISQEELEKTISQLREKRKDYIERQKEVTEKNILTVEKELERVEQDFAK--KEATIK 470

Query: 111 G 111
           G
Sbjct: 471 G 471

>KAFR0A08050 Chr1 complement(1612166..1613518) [1353 bp, 450 aa]
           {ON} Anc_2.5 YNL239W
          Length = 450

 Score = 27.7 bits (60), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 4/74 (5%)

Query: 30  QENKIVNEEFDQLKEDTPVY--KLTGNVLLPVEQSEARGNVEKRLEFIETEIKRCEKNIR 87
           Q+N++ N   D   + TPV   + +G   L    ++ RGNV K L   E EI +      
Sbjct: 46  QDNRVFNISLDD--DTTPVTNQRASGRCWLFAATNQLRGNVIKNLNLKEFEISQAYLFFY 103

Query: 88  GKQEELEQVRNELV 101
            K E+     +++V
Sbjct: 104 DKLEKANYFLDQIV 117

>KAFR0A07340 Chr1 (1481834..1482223) [390 bp, 129 aa] {ON}
          Anc_2.101 YNL153C
          Length = 129

 Score = 27.3 bits (59), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 3/60 (5%)

Query: 23 QKLETQLQENKIVNE---EFDQLKEDTPVYKLTGNVLLPVEQSEARGNVEKRLEFIETEI 79
          Q+L  ++QE + +++   E + + ED  V    G++ L  +QSEA   +EK +E I+ +I
Sbjct: 37 QELSKEMQEKEYLDDVSLEIELIDEDEKVQYKIGDIFLFFKQSEAVEQLEKDVESIDAKI 96

>KLLA0E04753g Chr5 complement(423256..424248) [993 bp, 330 aa] {ON}
           similar to uniprot|P52919 Saccharomyces cerevisiae
           YLR457C NBP1 Component of the mitotic apparatus
           containing a coiled-coil domain essential for the G2/M
           transition
          Length = 330

 Score = 27.3 bits (59), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%)

Query: 9   QHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNV 55
           Q L   +EE ++ ++KLE   Q+N ++ E FD  K +T   K   N+
Sbjct: 179 QRLSDAVEELVITKKKLEFVQQKNNLLEELFDDGKMETEYVKSRRNI 225

>TPHA0K01990 Chr11 complement(419705..422437) [2733 bp, 910 aa] {ON}
           Anc_4.46 YLR309C
          Length = 910

 Score = 27.3 bits (59), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 7/48 (14%)

Query: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVR-------NELV 101
           QSE   N++K    ++ E+ + + N++GK +E+E+VR       NELV
Sbjct: 354 QSETLPNLKKEHLSLQDELTKTKANLKGKTDEVEEVREMLRDVGNELV 401

>TDEL0F04140 Chr6 (760626..765389) [4764 bp, 1587 aa] {ON} Anc_8.287
           YDR127W
          Length = 1587

 Score = 27.3 bits (59), Expect = 9.9,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 12  QSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVEQSEARGNVEK 70
           +  +++F+      E + QE+KI NE  ++  +D  V+   G +   VE S+AR  +++
Sbjct: 928 KGSVKDFVAEHGWDEFRAQESKIFNEVIEKHGDDGYVFSTGGGI---VESSDARKALQR 983

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.129    0.336 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,623,109
Number of extensions: 474654
Number of successful extensions: 3242
Number of sequences better than 10.0: 357
Number of HSP's gapped: 3210
Number of HSP's successfully gapped: 414
Length of query: 114
Length of database: 53,481,399
Length adjustment: 84
Effective length of query: 30
Effective length of database: 43,849,455
Effective search space: 1315483650
Effective search space used: 1315483650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)