Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_10.2947.353ON27527514570.0
Skud_12.2637.353ON27427512471e-175
Smik_12.2587.353ON27427511671e-163
YLR199C (PBA1)7.353ON27627511651e-162
Kpol_530.287.353ON2742786852e-89
KAFR0L015007.353ON2792816792e-88
NCAS0E028507.353ON2812836627e-86
TDEL0C019507.353ON2732776582e-85
TPHA0F030007.353ON2822836374e-82
ZYRO0F11770g7.353ON2722766052e-77
CAGL0A03993g7.353ON2722795583e-70
KNAG0B026007.353ON2792805541e-69
NDAI0E044507.353ON2212245342e-67
SAKL0F11440g7.353ON2722854671e-56
TBLA0E020707.353ON2522864312e-51
KLTH0H01188g7.353ON2672873764e-43
Kwal_56.246507.353ON2522612944e-31
KLLA0D12276g7.353ON2582792936e-31
Ecym_47207.353ON2612772333e-22
ACL145W7.353ON2342481674e-13
Skud_5.731.455ON146168702.4
KLTH0B10318gsingletonON154853693.7
ZYRO0A01870g2.285ON707142668.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_10.294
         (275 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828...   565   0.0  
Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825...   484   e-175
Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825...   454   e-163
YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,...   453   e-162
Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, ...   268   2e-89
KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 a...   266   2e-88
NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 ...   259   7e-86
TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 ...   258   2e-85
TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa...   249   4e-82
ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 a...   237   2e-77
CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 a...   219   3e-70
KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 ...   218   1e-69
NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {...   210   2e-67
SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 a...   184   1e-56
TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa...   170   2e-51
KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804...   149   4e-43
Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR19...   117   4e-31
KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824) ...   117   6e-31
Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [78...    94   3e-22
ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homol...    69   4e-13
Skud_5.73 Chr5 (110772..115157) [4386 bp, 1461 aa] {ON} YEL022W ...    32   2.4  
KLTH0B10318g Chr2 (869187..873833) [4647 bp, 1548 aa] {ON} no si...    31   3.7  
ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {...    30   8.6  

>Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828
           bp, 275 aa] {ON} YLR199C (REAL)
          Length = 275

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/275 (100%), Positives = 275/275 (100%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFP 60
           FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFP
Sbjct: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFP 60

Query: 61  KNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEETLYNFS 120
           KNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEETLYNFS
Sbjct: 61  KNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEETLYNFS 120

Query: 121 FPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNMKIMT 180
           FPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNMKIMT
Sbjct: 121 FPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNMKIMT 180

Query: 181 EDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDMGSLIDV 240
           EDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDMGSLIDV
Sbjct: 181 EDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDMGSLIDV 240

Query: 241 CSQWFGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275
           CSQWFGLDHSKYSEECHRLWRCDSAAIGAQSGLYI
Sbjct: 241 CSQWFGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275

>Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  484 bits (1247), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 230/275 (83%), Positives = 253/275 (92%), Gaps = 1/275 (0%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFP 60
           FKQWNDLPEPRHQLDFPEISKNLQSLE CP+P+VELPQDL+VSQYS V+ITTKIMNPLFP
Sbjct: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFP 60

Query: 61  KNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEETLYNFS 120
           KNLL+L SIGE+K+SL VK  +P Q TDA+SWNYDENFPNE++P S + TS +ET YNFS
Sbjct: 61  KNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETS-KETQYNFS 119

Query: 121 FPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNMKIMT 180
           FPIYSFG+TLLFSIEENFINISPIFGNMISRSI SQL+KTSPD+I+IG+SDRISNMK MT
Sbjct: 120 FPIYSFGETLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISNMKKMT 179

Query: 181 EDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDMGSLIDV 240
           + ECTLQPPEF+TGFIGSVLTQLI G NKGM FKCL+VPSEGPNGFEK SLSDMGSLIDV
Sbjct: 180 KSECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMGSLIDV 239

Query: 241 CSQWFGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275
           CSQW G DHSKYS+EC+RLWRCDSAAIGAQSGLYI
Sbjct: 240 CSQWLGFDHSKYSQECYRLWRCDSAAIGAQSGLYI 274

>Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  454 bits (1167), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 211/275 (76%), Positives = 245/275 (89%), Gaps = 1/275 (0%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFP 60
           FKQWN++PEPRH LDFPEISKNL SLE CPVPKVELPQDLDVSQYS VVITTKIMNPLFP
Sbjct: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFP 60

Query: 61  KNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEETLYNFS 120
           KNLL+LI++G+I+T+L V     +Q T  HSWN+DENFPNE++P  R A S +ET Y+FS
Sbjct: 61  KNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMS-DETKYDFS 119

Query: 121 FPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNMKIMT 180
           FPIYSFGKTLLFSIEENF++ISPIFGNMISR I S+LV++SP++I+IGTSD+I+NMK+MT
Sbjct: 120 FPIYSFGKTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIANMKVMT 179

Query: 181 EDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDMGSLIDV 240
           +DEC+L+PPEF+TGFIGSVLTQL+ G NKGMKFKCLVVPSEGPNG+EK SLSDMGSL+ +
Sbjct: 180 KDECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMGSLVSL 239

Query: 241 CSQWFGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275
           C QW G DHS Y EEC+RLWRCDSAAIGAQSGLYI
Sbjct: 240 CGQWLGFDHSSYHEECYRLWRCDSAAIGAQSGLYI 274

>YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,
           276 aa] {ON}  PBA1Protein involved in 20S proteasome
           assembly; forms a heterodimer with Add66p that binds to
           proteasome precursors; similar to human PAC1 constituent
           of the PAC1-PAC2 complex involved in proteasome assembly
          Length = 276

 Score =  453 bits (1165), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 214/275 (77%), Positives = 244/275 (88%), Gaps = 1/275 (0%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFP 60
           FKQWNDLPEP+H LD PEISKNLQSLEVCPVPKVE PQDLDV QYS  VITTKIMNPLFP
Sbjct: 3   FKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPLFP 62

Query: 61  KNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEETLYNFS 120
           KNLL+L SIGEIKT+L VK  +  Q +  HSWNYDENFPNE++P+ +  T+ +ET+Y FS
Sbjct: 63  KNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTA-DETVYGFS 121

Query: 121 FPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNMKIMT 180
           FPIYSFGKTLLFS+EENFI+ISPIFGNMISRSI SQL + SPD+I+IGTSD+I++MK+MT
Sbjct: 122 FPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKVMT 181

Query: 181 EDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDMGSLIDV 240
           E+ECTLQPPEF+TGFIGSVLTQLI G +KG+KFKCLV PSEGPNGFEK SLSDMGSL+D+
Sbjct: 182 ENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSLVDL 241

Query: 241 CSQWFGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275
           C QW G + S+YSEEC+RLWRCDSAAIGAQSGLYI
Sbjct: 242 CGQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI 276

>Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, 274
           aa] {ON} complement(73093..73911,74024..74029) [825 nt,
           275 aa]
          Length = 274

 Score =  268 bits (685), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 135/278 (48%), Positives = 190/278 (68%), Gaps = 9/278 (3%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFP 60
           FKQWN+   PRH+LD P I++N  SL++  +P+V +P+  D+S+Y  VV+TTKIM+PLFP
Sbjct: 3   FKQWNEFVAPRHELDSPIIARNDDSLQLLSLPEVHMPE-TDLSKYKNVVLTTKIMDPLFP 61

Query: 61  KNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEETLYNFS 120
             LL    I +I T+L + E   +  ++ HSW+Y+ENFPNE+        SN   L +FS
Sbjct: 62  SKLLSAEKIADITTTLKIDESQDVGESENHSWDYEENFPNEV---GFKRDSNNRRLLSFS 118

Query: 121 FPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQL-VKTSPDV--IIIGTSDRISNMK 177
            PI++F  T++  IEENFI +S IF N+I+  + + L +  +PD+  I IGTSDRI N+K
Sbjct: 119 SPIFAFKDTIIIMIEENFIKMSAIFSNVIAEQVINHLLINGNPDLNFIAIGTSDRILNIK 178

Query: 178 IMTEDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDMGSL 237
            +T+D C+L+PPEFVTGFIGS+LTQLI+   +   F  ++ PSEGP GFEK +L  +  L
Sbjct: 179 KLTQDHCSLEPPEFVTGFIGSILTQLIS--KEVNVFTGILAPSEGPIGFEKMTLDVIKEL 236

Query: 238 IDVCSQWFGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275
           ID+C +   +  ++YS +C R+WR D AAIGAQSGLYI
Sbjct: 237 IDICQELLDIKSTEYSVDCQRMWRLDGAAIGAQSGLYI 274

>KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 aa]
           {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  266 bits (679), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 135/281 (48%), Positives = 190/281 (67%), Gaps = 10/281 (3%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFP 60
           FKQWN+L EPRHQLD P I KN +SL+  P+P+VE+P  ++ S Y ++++TTK+MNPLFP
Sbjct: 3   FKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPLFP 62

Query: 61  KNLLKLISIGEIKTSLMVKELNPIQPTDAH-SWNYDENFPNEINPNSRTATSNEETLYNF 119
           KNLLK+  +G I+T+L++ E         H SW+++ENFPNE NP+  +AT N    ++F
Sbjct: 63  KNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDFNENFPNEFNPSMESATGNNN--FSF 120

Query: 120 SFPIY--SFGKTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRIS-NM 176
            FPIY  S   TLL SI+ENF+ +SPIF N+IS+ + S +      ++++G SD+IS N+
Sbjct: 121 KFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISNNI 180

Query: 177 KIMTEDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDMGS 236
           K +T   C++ PPEF+TGFIGS+L +L+        F+C++VPSEGP GFEK SLS M  
Sbjct: 181 KTVTNKNCSINPPEFITGFIGSLLYELLEIGTDN--FECIIVPSEGPIGFEKLSLSTMEE 238

Query: 237 LIDVCSQWFG--LDHSKYSEECHRLWRCDSAAIGAQSGLYI 275
           LI+      G  +D   Y +ECHR W+ + +A   QSGLYI
Sbjct: 239 LINQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279

>NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 bp,
           281 aa] {ON} Anc_7.353 YLR199C
          Length = 281

 Score =  259 bits (662), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 130/283 (45%), Positives = 193/283 (68%), Gaps = 12/283 (4%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFP 60
           FKQWN+  EPRHQLDFP +SKN +SL+  P+PKV  P  +    Y +++ITT++MNPLFP
Sbjct: 3   FKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFP-SIAFQNYEKIIITTQLMNPLFP 61

Query: 61  KNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEETLYNFS 120
           + L++  ++G+I+T L + E       D HSWN++ENFPNE +P++     N++  +NF 
Sbjct: 62  EKLIESKNLGKIETQLTLTEDQNAVNEDGHSWNFNENFPNEFDPDNED-RENQQQAFNFE 120

Query: 121 FPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNMKIMT 180
           FP+++ GK ++ SI++NF+ ISPIF N+IS+ +  QL +T    +I+G+SDRI+++K + 
Sbjct: 121 FPVFAVGKVVIISIQDNFLKISPIFSNIISKKLIEQLPRTI-KPLILGSSDRIASVKEIN 179

Query: 181 EDECTLQPPEFVTGFIGSVLTQLI-------TGANKGMKFKCLVVPSEGPNGFEKFSLSD 233
           +  CTL PPEF+TGFI S+LT+L         G NK  +F  ++VPSEGP GFEK +L+ 
Sbjct: 180 DHTCTLVPPEFITGFIASLLTELTIHNETLQNGENK-FQFDAILVPSEGPLGFEKLNLTV 238

Query: 234 MGSLIDVCS-QWFGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275
           +  LID+   +W  LD   Y+EE +R W+   + +GAQSGLYI
Sbjct: 239 IQDLIDLFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281

>TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 bp,
           273 aa] {ON} Anc_7.353 YLR199C
          Length = 273

 Score =  258 bits (658), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 129/277 (46%), Positives = 181/277 (65%), Gaps = 8/277 (2%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFP 60
           FKQWN++ EPRHQLD P I  N  +L+   +P+V LP  +D+  +SRV++T+ IMNPLFP
Sbjct: 3   FKQWNEIAEPRHQLDSPVIIANEGTLQTSVLPQVTLP-PIDLQNFSRVILTSAIMNPLFP 61

Query: 61  KNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEETLYNFS 120
           + LLK   +G++K  L +           HSWN+DENFPNE++P            +   
Sbjct: 62  EKLLKSTILGDLKVILDLSSGKMALDHPMHSWNFDENFPNEVDP--AYVVEERSKTFELC 119

Query: 121 FPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQLVKTS--PDVIIIGTSDRISNMKI 178
            PI SFG+TLL S++ENF+  SPIF N I++S+  +L + +   +V+++GTSD+I+ +K 
Sbjct: 120 APIVSFGRTLLISVKENFLKTSPIFLNQIAKSVVCKLAQGAFEGEVVVLGTSDQITELKP 179

Query: 179 MTEDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDMGSLI 238
           +++ E TL PPEFVT F+G+V+TQLI    K + F+ L+ PSEGP GFEK +L  M  LI
Sbjct: 180 VSDKETTLNPPEFVTSFVGAVITQLI---EKSLPFQGLIAPSEGPVGFEKLNLVTMEELI 236

Query: 239 DVCSQWFGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275
            +C QW   +   Y  EC+R WR D AA+GAQSGLYI
Sbjct: 237 TLCHQWVDSNKEIYRNECYRRWRLDGAALGAQSGLYI 273

>TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa]
           {ON} Anc_7.353 YLR199C
          Length = 282

 Score =  249 bits (637), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 123/283 (43%), Positives = 184/283 (65%), Gaps = 11/283 (3%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFP 60
           FKQWNDL EPRHQL  P +S N++SL++  +P+V +  +L    +  V++TTK MN LFP
Sbjct: 3   FKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSM-TNLKYEDFENVIVTTKTMNALFP 61

Query: 61  KNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTAT-----SNEET 115
              L L  +GE+ +SL++ E   +   + +SW+Y ENFPNE++  S+ A      SNE  
Sbjct: 62  NKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGSNESK 121

Query: 116 LYNFSFPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQLV---KTSPDVIIIGTSDR 172
            YNF  PI ++ KTLL SIEENFI +SPIF N+ +  I   ++    ++  ++ +GTSDR
Sbjct: 122 KYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTLGTSDR 181

Query: 173 ISNMKIMTEDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLS 232
           ++ ++ +T +  TL  PEF+TGF+GS ++QL+    +   +K ++VPSEGP GFEK S+ 
Sbjct: 182 VAAIRKLTPENSTLVAPEFITGFVGSFISQLVIL--EVPNYKAVIVPSEGPIGFEKLSIE 239

Query: 233 DMGSLIDVCSQWFGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275
            +  LID+C +   ++  KYS E HRLW+   +A+GAQ+GLYI
Sbjct: 240 TISELIDICKENLNINDPKYSNESHRLWKVAGSAMGAQTGLYI 282

>ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 aa]
           {ON} weakly similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 272

 Score =  237 bits (605), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 119/276 (43%), Positives = 179/276 (64%), Gaps = 7/276 (2%)

Query: 1   FKQWNDLPEPRHQLDFP-EISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLF 59
           FKQWN++ EPRH LD P  +  + +SL+   +P VELP +++ +++ ++ +TT IM+PLF
Sbjct: 3   FKQWNEIAEPRHHLDSPLAVGIDDESLQKGSLPLVELP-NINWNKFHKIFLTTGIMDPLF 61

Query: 60  PKNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEETLYNF 119
           PK LL ++ +G+I+T+L +   N       +SWN++ENFPNE+N N      + ++L  F
Sbjct: 62  PKELLGVMKLGDIRTTLTIDR-NQQHENGEYSWNFEENFPNEVNLNGGQDNDDGQSL-TF 119

Query: 120 SFPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNMKIM 179
              + +FG  LL  ++ENF+ +SPI  N I++ + S    T  ++ ++GTSDRI+ +K +
Sbjct: 120 VTTVEAFGDCLLVGVKENFLKVSPIIYNRIAQVLLSVFDGTHHELKVLGTSDRITELKSI 179

Query: 180 TEDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDMGSLID 239
           +     LQPPEFVTGFIGS+LTQL     K + F+  + PSEG  GFEK S++ M  LID
Sbjct: 180 SHLRSDLQPPEFVTGFIGSILTQLTV---KNIPFEGFIAPSEGAIGFEKMSMNTMPELID 236

Query: 240 VCSQWFGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275
           +C QW   +  KY  EC+R WR DS A+G+ SGLY+
Sbjct: 237 ICGQWINGNSEKYRSECYRHWRLDSGAVGSLSGLYV 272

>CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score =  219 bits (558), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 118/279 (42%), Positives = 177/279 (63%), Gaps = 13/279 (4%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDL-DVSQYSRVVITTKIMNPLF 59
           FKQWN+L EPR+ LD P +  N +SL++ P+P V +P +L +     RV++TTK M+  F
Sbjct: 3   FKQWNELSEPRNHLDAPNLVNNTESLQLLPLPDVHIPDELFEGGNVKRVILTTKTMDTFF 62

Query: 60  P-KNLLKLISIGEIKTSLMV-KELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEETLY 117
                +K+  + +I  SL + K L   + T  H+W++ ENFPNE+ P        E+  +
Sbjct: 63  LLDKTMKVKKLADITCSLEIPKNLQTHEAT--HTWDFGENFPNEVEP----LQDEEQRTF 116

Query: 118 NFSFPIYSF-GKTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNM 176
           +  FPIY    +TL  SI+ENF+ +SPIF   IS  I+ +L +   +++I+G SDRI + 
Sbjct: 117 SLRFPIYLLEDQTLYVSIDENFLTVSPIFTAQISDVISKKLNR-GHEIVILGCSDRIEDT 175

Query: 177 KIMTEDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDMGS 236
           KI T + C+L PPEFVTGF+GS+++ L T  N  + F   + PSEGP GFEK S + + S
Sbjct: 176 KICTNNNCSLVPPEFVTGFLGSLMSDL-TKTNDQL-FTAAIFPSEGPQGFEKLSSTTVDS 233

Query: 237 LIDVCSQWFGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275
           +ID CSQ    D S+Y+EEC++ W+ ++++ GAQSGLY+
Sbjct: 234 IIDFCSQLVSTDKSRYTEECYKRWKRNASSNGAQSGLYL 272

>KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 bp,
           279 aa] {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  218 bits (554), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 112/280 (40%), Positives = 168/280 (60%), Gaps = 8/280 (2%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFP 60
           FK WN+  EPRH LD P +  N +SL+  P+P V +P   D  +        KIMNPLF 
Sbjct: 3   FKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNPLFN 62

Query: 61  KNLLKLISIGEIKTSLMVKELNPIQPTD--AHSWNYDENFPNEINPNSRTATSNEETLYN 118
            +    ++ GE+ TSL + E    Q     +  W+Y ENFPNE +P S T    +  +  
Sbjct: 63  TSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTREDTKSIVLR 122

Query: 119 FSFPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNMKI 178
                 +   TLL S++ENF+ +SPIF N+++R + + L+ T   ++++G+SD+I + K+
Sbjct: 123 LPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRT-LLNTQTKILLVGSSDKIYSTKM 181

Query: 179 MTEDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDMGSLI 238
           ++ +ECTLQPPEF+TGF+G ++ +L+   N+   FK  +V SEGP GFEK SL  M  LI
Sbjct: 182 VSLNECTLQPPEFITGFLGGMIDELV--KNRFSNFKGFIVQSEGPTGFEKLSLESMDELI 239

Query: 239 D-VCSQW--FGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275
           D +  +W  + ++   + E CH+LW+ D AA+ AQSGLYI
Sbjct: 240 DFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279

>NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {ON}
           Anc_7.353 YLR199C
          Length = 221

 Score =  210 bits (534), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 105/224 (46%), Positives = 159/224 (70%), Gaps = 6/224 (2%)

Query: 55  MNPLFPKNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEE 114
           MNPLFP++LL L+S+  I T+L +     +     HSWNY+ENFPNE +P+ +   S+E+
Sbjct: 1   MNPLFPEDLLPLVSVSNISTTLTLNPDQLMGNEGKHSWNYNENFPNEFDPSDKDMKSSEK 60

Query: 115 TLYNFSFPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRIS 174
           + Y+F+FPI++  +TL+ SI+ENF+ ISPIF N+IS+++  Q +  + +++I+GTSDR++
Sbjct: 61  S-YDFNFPIFAIDRTLVISIQENFLKISPIFSNVISQTLV-QALPLNKEILILGTSDRVA 118

Query: 175 NMKIMTEDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDM 234
            M+ ++ +  TL+PPEFVTGFIGS++T+L    N    F  ++VPSEGP GFEK +L+ M
Sbjct: 119 VMRKISNEIDTLEPPEFVTGFIGSLITEL-NLHNAKYNFDAIIVPSEGPTGFEKLNLTIM 177

Query: 235 GSLIDVC-SQW--FGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275
             LID+  ++W    +D   Y+E+C+R W+   AAIGAQSGLYI
Sbjct: 178 QDLIDIFKNEWNYLNIDSKVYTEQCYRHWKLAGAAIGAQSGLYI 221

>SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score =  184 bits (467), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 114/285 (40%), Positives = 164/285 (57%), Gaps = 25/285 (8%)

Query: 1   FKQWNDLPEPRHQLDFPEISK-NLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLF 59
           FK WN+  EPRHQLD P     N +SL+  P+P V L + +D+SQ++++V+ TK++ PLF
Sbjct: 3   FKHWNEQAEPRHQLDTPYAPNVNYESLQKTPLPTVILTEPIDISQFNQIVLCTKVLRPLF 62

Query: 60  PKNLLKLISIGEIKTSLMVKELNPIQPT---DAHSWNY-DENFPNEINPNSRTATSNEET 115
           P  +  + +I E + ++      P QPT    AH  +Y DE++  E  P+ +     EE 
Sbjct: 63  PSTICPMTTISEFQVTI------PPQPTAIKKAHGSSYGDEDYEQESLPDKKP----EEI 112

Query: 116 LYNFSFPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQL-VKTSPDVIIIGTSDRIS 174
           +   SF +  F   L   IEENF+++SPI  N++S+ I      K +   I++GTSDRI+
Sbjct: 113 I--VSFQVEKFNDILFICIEENFLHVSPIAWNLLSQQIIRLCKSKNTLQTIVLGTSDRIT 170

Query: 175 NMKIM--TEDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLS 232
            +K +  T     L+PPEFVT    S++T LI      + FK L+ PSEGP+GFEK SL 
Sbjct: 171 TLKSVGSTLGLPDLEPPEFVTNCTASLITTLIL---HDLPFKSLIAPSEGPSGFEKLSLV 227

Query: 233 DMGSLIDVCSQWFG--LDHSKYSEECHRLWRCDSAAIGAQSGLYI 275
            M  L + C +      + S Y EECHR WR    A+GAQ+GLYI
Sbjct: 228 SMDQLAESCFELVKPVENVSSYIEECHRAWRLQGTAMGAQTGLYI 272

>TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa]
           {ON} Anc_7.353 YLR199C
          Length = 252

 Score =  170 bits (431), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 104/286 (36%), Positives = 150/286 (52%), Gaps = 47/286 (16%)

Query: 1   FKQWNDLPEPRHQLD----FPEISKNLQSLEVCPVPKVELPQDL-DVSQYSRVVITTKIM 55
           FKQW++  EPRH +D     P   +N  SL+  P+P V++P  L D++ Y ++++ T+++
Sbjct: 3   FKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATRVL 62

Query: 56  NPLFPKNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEET 115
            PLFPK +L   S+G I+  L V                                 +E T
Sbjct: 63  MPLFPKEILNFTSLGNIEVKLNV---------------------------------SEAT 89

Query: 116 LYNFSFPIYSFG-KTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRIS 174
            +    PIY    +TL+  ++EN + + PIF N+IS++I + +       +I GTSDRIS
Sbjct: 90  AHLVKTPIYKCNERTLIIIVDENVMQVCPIFLNVISKTICT-MFGNQLKFLIFGTSDRIS 148

Query: 175 NMKIMTEDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDM 234
            +K +    CTL PPEF+TGFIGS+++ L   AN   KF   +VPSEGP GFEK +L  M
Sbjct: 149 KIKTINHLNCTLIPPEFITGFIGSIISDLSLTANS--KFNGFLVPSEGPLGFEKLTLETM 206

Query: 235 GSLIDVCSQWF-----GLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275
             LI    +        L+   Y +EC+R WR     IG QSGLYI
Sbjct: 207 EFLIKEGGRIVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252

>KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804
           bp, 267 aa] {ON} similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 267

 Score =  149 bits (376), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 98/287 (34%), Positives = 149/287 (51%), Gaps = 34/287 (11%)

Query: 1   FKQWNDLPEPRHQLDFP-EISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLF 59
           FKQWN+  EPRH LD P E + +L SL+  P+P+V L + +D + + R  I T I   LF
Sbjct: 3   FKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRSLF 62

Query: 60  PKNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEETLYNF 119
              L +   I         K        + H   Y E++  + +  S   T   E     
Sbjct: 63  EDRLARAEQISSFVVVWQTK------GREQHL--YREDYQTQEDSRSTDETKRLE----- 109

Query: 120 SFPIYSFGK-TLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNMKI 178
            FP++     TL   + E+F+++ PI  N++SR IA   +    +V++ G+SDR+  +K 
Sbjct: 110 -FPVHKLDDGTLFICVREDFLHVPPISINLLSREIAK--LCGGLEVLLFGSSDRVERVKY 166

Query: 179 MT------EDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLS 232
           +       +    L PPE +T F  S++TQL++  NK ++F   V PSEGP+G+EK S+ 
Sbjct: 167 VGFPGNVGKGLPLLTPPELITNFTASIMTQLLS--NK-VRFDGYVAPSEGPSGYEKLSME 223

Query: 233 DMGSLIDVCSQW----FGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275
            M  LID+C  W    FG +   Y + CHR WR +   +GAQ+GLY+
Sbjct: 224 TMDLLIDLC--WSEVRFG-NREDYVKSCHRNWRLNGTVMGAQTGLYL 267

>Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR199C
           - Hypothetical ORF [contig 161] FULL
          Length = 252

 Score =  117 bits (294), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 83/261 (31%), Positives = 129/261 (49%), Gaps = 31/261 (11%)

Query: 25  SLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFPKNLLKL--ISIGEIKTSLMVKELN 82
           SL++ P+P+V L + L  + + RV I T+I   LF   L     IS  E+K     +E +
Sbjct: 13  SLQLAPLPEVRLTEPLKSNSFKRVFIITEIFRSLFVGKLAHAEQISTFEVKWQTKGREQH 72

Query: 83  PIQPTDAHSWNYDENFPNEINPNSRTATSNEETLYNFSFPIYSFGK-TLLFSIEENFINI 141
                      Y E+F        +   + E      S P+    + T L  + E+F+++
Sbjct: 73  L----------YREDF------QVQEDCTKENESCGLSIPVLKIDEDTFLLCVAEDFLHV 116

Query: 142 SPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNMKIMTEDECT------LQPPEFVTGF 195
            PI GN++S+ +A   +     V++IGTSDRI  +K +   +        L PPE +T F
Sbjct: 117 PPIVGNLLSQEMAK--LCRDLRVLVIGTSDRIEEVKYVGSAQNGRNGVPPLTPPELITSF 174

Query: 196 IGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDMGSLIDVC-SQWFGLDHSKYSE 254
             S+ TQL+      + F   V PSEGP+G+EK S+  M  LID+C S+    +  +Y +
Sbjct: 175 TASITTQLLLCK---VPFDGYVAPSEGPSGYEKLSMETMDKLIDLCWSEISTGNRDEYVK 231

Query: 255 ECHRLWRCDSAAIGAQSGLYI 275
           E HR WR    + G Q+GLY+
Sbjct: 232 ETHRNWRLHGTSTGTQTGLYL 252

>KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824)
           [777 bp, 258 aa] {ON} similar to uniprot|Q05778
           Saccharomyces cerevisiae YLR199C Hypothetical ORF
          Length = 258

 Score =  117 bits (293), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 84/279 (30%), Positives = 142/279 (50%), Gaps = 28/279 (10%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVEL-PQDLDVSQYSRVVITTKIMNPLF 59
           FKQW +   PRHQ+D P +  +  SL     P V + P+ LD+S Y+  ++    +  L 
Sbjct: 4   FKQWQNDQVPRHQID-PVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKWLL 62

Query: 60  PKNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEETLYNF 119
           PK+++ L+ IG I  +L          ++ + W   +  P   +       S E+ + ++
Sbjct: 63  PKSIINLVHIGIISGTL----------SNMNEWESMKPVPGMYDTEEHMINSTEQFVIHY 112

Query: 120 SFPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNMKIM 179
           +  ++    TL+  I+EN +    I  N ++R++A QL++   D+ I+  SD+I+ +K +
Sbjct: 113 N--LWRLEDTLIAIIDENEVKYPAIVTNFMTRNLA-QLLRDIKDITILVNSDKITELKQL 169

Query: 180 TEDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDMGSLID 239
           +     L PPEF+TG I + +  L        + K +VVPSEGP GFEK++   + +L+D
Sbjct: 170 S----YLVPPEFITGSITNFILAL-----PRKELKVIVVPSEGPIGFEKYNFPTVDALVD 220

Query: 240 VCSQWFGLDHSK---YSEECHRLWRCDSAAIGAQSGLYI 275
             S+      S+   Y  EC +LW+ D      Q GLYI
Sbjct: 221 EMSKLLCSYPSQTEYYVSECLKLWKLDECT-TTQGGLYI 258

>Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [786
           bp, 261 aa] {ON} similar to Ashbya gossypii ACL145W
           1-intron
          Length = 261

 Score = 94.4 bits (233), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 137/277 (49%), Gaps = 20/277 (7%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFP 60
           FKQW     PRHQ+     S +  SL + P P + L  D++   Y + +     +  L P
Sbjct: 3   FKQWEFDRIPRHQVQSIN-SADPTSLLLSPEPVITLDNDIN-KGYEKAIALPSSLTWLLP 60

Query: 61  KNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEETLYNFS 120
            +L+    I  + T+++ +  NP  P +    N    +  ++ P+++   +        S
Sbjct: 61  ADLIHFKQISCL-TAVLKQSSNP-DPVEIEDVNTSGFYEVDVKPSTKEVRA--------S 110

Query: 121 FPIYSFG-KTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNMKIM 179
           +PIY     TL+  I+E+ +   PI  N ++ ++A  L      V ++  SD+I   K +
Sbjct: 111 YPIYELDDHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKIIGFKSL 170

Query: 180 TEDECTLQPPEFVTGFIGSVLTQLIT-GANKGMKFKCLVVPSEGPNGFEKFSLSDMGSLI 238
           +E    LQPPEF+ G + +++T L +  ++K  + + +VV SEGP G+E  +++ +  L+
Sbjct: 171 SE----LQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITVVDLLV 226

Query: 239 DVCSQWFGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275
           +      G    +Y    +R W+ +SA+   QSGLY+
Sbjct: 227 EYMKSTLGYSE-EYVTSAYRRWKSNSAS-QFQSGLYL 261

>ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR199C
          Length = 234

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 115/248 (46%), Gaps = 29/248 (11%)

Query: 32  PKVELPQDLDVSQYSRVVITTKIMNPLFPKNLLKLISIGEIKTSLMVKELNPIQPT-DAH 90
           P+VE    L   +YS  ++    ++ L P  +++L  + ++  +L             A 
Sbjct: 12  PQVEFSGKLG-ERYSAALVVPSTLSWLMPPEMVQLTPVAQLVGTLTQAGGGECATRLVAA 70

Query: 91  SWNYDENFPNEINPNSRTATSNEETLYNFSFPIYSFG-KTLLFSIEENFINISPIFGNMI 149
              Y+ + P              E     ++ +Y  G   L+  +EEN +   PI  N +
Sbjct: 71  DQFYEADVPQA------------ERHVRVAYQLYERGPGQLVVVVEENDLKYPPIVHNRL 118

Query: 150 SRSIASQLVKTSPDVIIIGTSDRISNMKIMTEDECTLQPPEFVTGFIGSVLTQLI-TGAN 208
           ++ +A +L     +  ++  SD+ + +K + E    L PPEF+TG + +++  L  +GA 
Sbjct: 119 AQQLAEKLRAVGAETTVLVNSDKSTGVKDLEE----LVPPEFITGALAALVCALAPSGAG 174

Query: 209 KGMKFKCLVVPSEGPNGFEKFSLSDMGSLIDVCSQWFGLDH-SKYSEECHRLWRCDSAAI 267
           +      LVV SEGP+GFEK +L+ + +L++   Q   LD   +Y   C R W+  + + 
Sbjct: 175 R-----VLVVQSEGPHGFEKHNLTVVDALVERVRQI--LDQPPEYVAACTRHWKLQAGS- 226

Query: 268 GAQSGLYI 275
             Q GLY+
Sbjct: 227 QFQGGLYL 234

>Skud_5.73 Chr5 (110772..115157) [4386 bp, 1461 aa] {ON} YEL022W
           (REAL)
          Length = 1461

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 145 FGNMISRSIASQLVKTSPDVIIIGTSDRISNMKIMTEDECTLQPPEFVTGFIG--SVLTQ 202
           F   I + +   +V T  ++ ++ + DRIS   I + D+C+     F++ F G   +   
Sbjct: 805 FDRAIFKQVGPSIVSTLFNIYVVASDDRISTRMITSLDKCS-----FISAFFGFKDLFND 859

Query: 203 LITGANKG 210
           ++T   KG
Sbjct: 860 ILTSIAKG 867

>KLTH0B10318g Chr2 (869187..873833) [4647 bp, 1548 aa] {ON} no
           similarity
          Length = 1548

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 2   KQWND-LPEPRHQLDFPEISKNLQSLE-VCPVPKVELPQDLDVSQYSRVVITT 52
           K W +  PE +  L   +  +NL  +E  C  P + LP+D+D+ Q+ R+++TT
Sbjct: 885 KHWKEQFPETQLGLLVFDEFQNLPDVESYCKTP-LHLPKDIDIEQFQRLILTT 936

>ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 707

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 63/142 (44%), Gaps = 14/142 (9%)

Query: 30  PVPKVELPQDL-----DVSQYSRVVITTKIMNPLFPKNLLKLISIGEIKTSLMVKE-LNP 83
           PVPK+ELP+D      DV Q S V+I       ++ K  + +  + +  TS+ V   L+ 
Sbjct: 480 PVPKLELPEDTVLCSPDVFQESTVIIFVHDTPEIWAKRDV-ITGMIDPSTSITVDSPLDF 538

Query: 84  IQPTDAHSWNY-DENFPN---EINPNSRTATSNEETLY---NFSFPIYSFGKTLLFSIEE 136
           I+ + A  +   D N P    E +  S   TS E  +Y   NF     S  K     + +
Sbjct: 539 IKWSLARKYGVIDVNIPQSLFEQDNYSAMITSQEVLIYLWDNFVKYFPSLSKVAFVGVGD 598

Query: 137 NFINISPIFGNMISRSIASQLV 158
            +  I  + G+  +RS+   ++
Sbjct: 599 AYSGIVHLLGHRDTRSVVKAVI 620

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,788,993
Number of extensions: 1371271
Number of successful extensions: 4266
Number of sequences better than 10.0: 36
Number of HSP's gapped: 4340
Number of HSP's successfully gapped: 37
Length of query: 275
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 167
Effective length of database: 41,097,471
Effective search space: 6863277657
Effective search space used: 6863277657
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)