Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_10.2937.354ON50543623300.0
Smik_12.2577.354ON50843622770.0
YLR197W (NOP56)7.354ON50443622750.0
Skud_12.2627.354ON50543622720.0
NDAI0A018807.354ON50343621780.0
NCAS0A141707.354ON51043621620.0
SAKL0F11462g7.354ON49843621560.0
TDEL0C019407.354ON51043621570.0
Kpol_530.277.354ON50843621550.0
ZYRO0F11792g7.354ON51343621490.0
KLTH0H01166g7.354ON50743621430.0
KAFR0L015107.354ON50043621340.0
TPHA0F030107.354ON50943621320.0
CAGL0A04015g7.354ON50843321240.0
KNAG0B025907.354ON49943521230.0
Kwal_56.246547.354ON50743621190.0
TBLA0E020807.354ON51343621090.0
KLLA0D12254g7.354ON51343621050.0
ACL144C7.354ON54943620780.0
Ecym_47197.354ON51343620660.0
KLTH0H15334g8.787ON5114118541e-108
KNAG0G031908.787ON5234118491e-107
KNAG0J006508.787ON5244148481e-107
ZYRO0F12518g8.787ON5194148451e-107
TBLA0B028308.787ON5174118291e-104
KAFR0D015808.787ON5014148241e-104
KAFR0B035408.787ON4994148241e-104
TDEL0B011108.787ON5044118231e-104
Smik_15.4918.787ON5164128231e-103
Skud_15.4788.787ON5124128221e-103
YOR310C (NOP58)8.787ON5114128211e-103
Kpol_1010.58.787ON5144148211e-103
SAKL0B05874g8.787ON5134148211e-103
Suva_8.3618.787ON5054128191e-103
TPHA0G011608.787ON5144128171e-103
NDAI0E005508.787ON5234148161e-102
TPHA0I006508.787ON5404178161e-102
NCAS0B008708.787ON5154168141e-102
KLLA0F08613g8.787ON5114148041e-101
AFR328C8.787ON5134127881e-98
Kwal_34.158948.787ON5124117873e-98
Ecym_14898.787ON5144147855e-98
CAGL0I09790g8.787ON5134147778e-97
KNAG0B011403.429ON4922111812e-13
TPHA0D039303.429ON4712341784e-13
TDEL0F031103.429ON4342241741e-12
TBLA0C023203.429ON5112141687e-12
Kwal_23.39953.429ON4742151679e-12
ADR032W3.429ON4392031661e-11
ZYRO0C12386g3.429ON4442261633e-11
KAFR0K015303.429ON5062241543e-10
NDAI0G012903.429ON4961961544e-10
YGR091W (PRP31)3.429ON4942001544e-10
Kpol_1018.1383.429ON4932451491e-09
Skud_7.3903.429ON4952001439e-09
NCAS0E011603.429ON4792181392e-08
Ecym_44493.429ON4622081392e-08
Smik_6.1773.429ON4821991358e-08
Suva_7.3743.429ON5131991341e-07
SAKL0F06050g3.429ON4732231286e-07
KLTH0F12034g3.429ON5242301251e-06
KLLA0D14883g3.429ON4672201171e-05
CAGL0G03025g3.429ON4791241115e-05
KNAG0G018008.228ON147690706.8
Kpol_1058.418.80ON39441697.3
YNL172W (APC1)2.82ON174847697.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_10.293
         (505 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_10.293 Chr10 (518873..520390) [1518 bp, 505 aa] {ON} YLR197...   902   0.0  
Smik_12.257 Chr12 (493092..494618) [1527 bp, 508 aa] {ON} YLR197...   881   0.0  
YLR197W Chr12 (546097..547611) [1515 bp, 504 aa] {ON}  NOP56Esse...   880   0.0  
Skud_12.262 Chr12 (492745..494262) [1518 bp, 505 aa] {ON} YLR197...   879   0.0  
NDAI0A01880 Chr1 (422978..424489) [1512 bp, 503 aa] {ON} Anc_7.354    843   0.0  
NCAS0A14170 Chr1 complement(2783782..2785314) [1533 bp, 510 aa] ...   837   0.0  
SAKL0F11462g Chr6 complement(889390..890886) [1497 bp, 498 aa] {...   835   0.0  
TDEL0C01940 Chr3 (340658..342190) [1533 bp, 510 aa] {ON} Anc_7.3...   835   0.0  
Kpol_530.27 s530 (71285..72811) [1527 bp, 508 aa] {ON} (71285..7...   834   0.0  
ZYRO0F11792g Chr6 complement(962314..963855) [1542 bp, 513 aa] {...   832   0.0  
KLTH0H01166g Chr8 (116579..118102) [1524 bp, 507 aa] {ON} highly...   830   0.0  
KAFR0L01510 Chr12 complement(276894..278396) [1503 bp, 500 aa] {...   826   0.0  
TPHA0F03010 Chr6 complement(658541..660070) [1530 bp, 509 aa] {O...   825   0.0  
CAGL0A04015g Chr1 complement(402070..403596) [1527 bp, 508 aa] {...   822   0.0  
KNAG0B02590 Chr2 (503498..504997) [1500 bp, 499 aa] {ON} Anc_7.3...   822   0.0  
Kwal_56.24654 s56 complement(1090443..1091966) [1524 bp, 507 aa]...   820   0.0  
TBLA0E02080 Chr5 complement(505617..507158) [1542 bp, 513 aa] {O...   816   0.0  
KLLA0D12254g Chr4 (1045077..1046618) [1542 bp, 513 aa] {ON} high...   815   0.0  
ACL144C Chr3 complement(94809..96458) [1650 bp, 549 aa] {ON} Syn...   805   0.0  
Ecym_4719 Chr4 (1410528..1412069) [1542 bp, 513 aa] {ON} similar...   800   0.0  
KLTH0H15334g Chr8 complement(1329504..1331039) [1536 bp, 511 aa]...   333   e-108
KNAG0G03190 Chr7 complement(687362..688933) [1572 bp, 523 aa] {O...   331   e-107
KNAG0J00650 Chr10 (110685..112259) [1575 bp, 524 aa] {ON} Anc_8....   331   e-107
ZYRO0F12518g Chr6 complement(1017206..1018765) [1560 bp, 519 aa]...   330   e-107
TBLA0B02830 Chr2 (653081..654634) [1554 bp, 517 aa] {ON} Anc_8.7...   323   e-104
KAFR0D01580 Chr4 complement(313631..315136) [1506 bp, 501 aa] {O...   322   e-104
KAFR0B03540 Chr2 complement(735790..737289) [1500 bp, 499 aa] {O...   322   e-104
TDEL0B01110 Chr2 (204471..205985) [1515 bp, 504 aa] {ON} Anc_8.7...   321   e-104
Smik_15.491 Chr15 complement(846605..848155) [1551 bp, 516 aa] {...   321   e-103
Skud_15.478 Chr15 complement(836937..837160,837194..838505) [153...   321   e-103
YOR310C Chr15 complement(896825..898360) [1536 bp, 511 aa] {ON} ...   320   e-103
Kpol_1010.5 s1010 (13325..14869) [1545 bp, 514 aa] {ON} (13325.....   320   e-103
SAKL0B05874g Chr2 complement(499332..500873) [1542 bp, 513 aa] {...   320   e-103
Suva_8.361 Chr8 complement(637602..637804,637835..639149) [1518 ...   320   e-103
TPHA0G01160 Chr7 (234712..236256) [1545 bp, 514 aa] {ON} Anc_8.7...   319   e-103
NDAI0E00550 Chr5 (108986..110557) [1572 bp, 523 aa] {ON} Anc_8.787    318   e-102
TPHA0I00650 Chr9 (135050..136672) [1623 bp, 540 aa] {ON} Anc_8.7...   318   e-102
NCAS0B00870 Chr2 complement(133660..135207) [1548 bp, 515 aa] {O...   318   e-102
KLLA0F08613g Chr6 complement(801623..803158) [1536 bp, 511 aa] {...   314   e-101
AFR328C Chr6 complement(1032025..1033566) [1542 bp, 513 aa] {ON}...   308   1e-98
Kwal_34.15894 s34 (102368..103906) [1539 bp, 512 aa] {ON} YOR310...   307   3e-98
Ecym_1489 Chr1 complement(1006523..1008067) [1545 bp, 514 aa] {O...   306   5e-98
CAGL0I09790g Chr9 complement(935016..936557) [1542 bp, 513 aa] {...   303   8e-97
KNAG0B01140 Chr2 complement(210529..212007) [1479 bp, 492 aa] {O...    74   2e-13
TPHA0D03930 Chr4 (823320..824735) [1416 bp, 471 aa] {ON} Anc_3.4...    73   4e-13
TDEL0F03110 Chr6 (568933..570237) [1305 bp, 434 aa] {ON} Anc_3.4...    72   1e-12
TBLA0C02320 Chr3 complement(549057..550592) [1536 bp, 511 aa] {O...    69   7e-12
Kwal_23.3995 s23 complement(517426..518850) [1425 bp, 474 aa] {O...    69   9e-12
ADR032W Chr4 (763161..764480) [1320 bp, 439 aa] {ON} Syntenic ho...    69   1e-11
ZYRO0C12386g Chr3 (978158..979492) [1335 bp, 444 aa] {ON} simila...    67   3e-11
KAFR0K01530 Chr11 (319205..320725) [1521 bp, 506 aa] {ON} Anc_3....    64   3e-10
NDAI0G01290 Chr7 complement(284145..285635) [1491 bp, 496 aa] {O...    64   4e-10
YGR091W Chr7 (666341..667825) [1485 bp, 494 aa] {ON}  PRP31Splic...    64   4e-10
Kpol_1018.138 s1018 complement(368322..369803) [1482 bp, 493 aa]...    62   1e-09
Skud_7.390 Chr7 (650643..652130) [1488 bp, 495 aa] {ON} YGR091W ...    60   9e-09
NCAS0E01160 Chr5 complement(219669..221108) [1440 bp, 479 aa] {O...    58   2e-08
Ecym_4449 Chr4 complement(919492..920880) [1389 bp, 462 aa] {ON}...    58   2e-08
Smik_6.177 Chr6 (289760..291208) [1449 bp, 482 aa] {ON} YGR091W ...    57   8e-08
Suva_7.374 Chr7 (641967..643508) [1542 bp, 513 aa] {ON} YGR091W ...    56   1e-07
SAKL0F06050g Chr6 (454404..455825) [1422 bp, 473 aa] {ON} simila...    54   6e-07
KLTH0F12034g Chr6 complement(1015072..1016646) [1575 bp, 524 aa]...    53   1e-06
KLLA0D14883g Chr4 (1254381..1255784) [1404 bp, 467 aa] {ON} weak...    50   1e-05
CAGL0G03025g Chr7 (280230..281669) [1440 bp, 479 aa] {ON} simila...    47   5e-05
KNAG0G01800 Chr7 (396618..401048) [4431 bp, 1476 aa] {ON} Anc_8....    32   6.8  
Kpol_1058.41 s1058 complement(116385..117569) [1185 bp, 394 aa] ...    31   7.3  
YNL172W Chr14 (310636..315882) [5247 bp, 1748 aa] {ON}  APC1Larg...    31   7.3  

>Suva_10.293 Chr10 (518873..520390) [1518 bp, 505 aa] {ON} YLR197W
           (REAL)
          Length = 505

 Score =  902 bits (2330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/436 (100%), Positives = 436/436 (100%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60
           MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
           EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS
Sbjct: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL
Sbjct: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA
Sbjct: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420
           SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420

Query: 421 TLKNELAIQEAMELYN 436
           TLKNELAIQEAMELYN
Sbjct: 421 TLKNELAIQEAMELYN 436

>Smik_12.257 Chr12 (493092..494618) [1527 bp, 508 aa] {ON} YLR197W
           (REAL)
          Length = 508

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/436 (97%), Positives = 434/436 (99%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60
           MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKL+ELASFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLVELASFAPFKGAA 60

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
           EALENANDISEGLVSE LKAILDLNLPKASSK KN+TLAISDKNLGPSIKE+FPYVDCIS
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKASSKNKNVTLAISDKNLGPSIKEEFPYVDCIS 120

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LDQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY+FAKLVLFIKDKASLN+DSLHDLAAL
Sbjct: 181 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAAL 240

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           LN+DSGIAQRVIDNARISMGQD+SETDMENVC+FAQRVASLADYRRQLYDYLCEKMHTVA
Sbjct: 241 LNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420
           SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFG+VLKKQVEQRLEFYNTGKP
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGSVLKKQVEQRLEFYNTGKP 420

Query: 421 TLKNELAIQEAMELYN 436
           TLKNELAIQEAMELYN
Sbjct: 421 TLKNELAIQEAMELYN 436

>YLR197W Chr12 (546097..547611) [1515 bp, 504 aa] {ON}
           NOP56Essential evolutionarily-conserved nucleolar
           protein component of the box C/D snoRNP complexes that
           direct 2'-O-methylation of pre-rRNA during its
           maturation; overexpression causes spindle orientation
           defects
          Length = 504

 Score =  880 bits (2275), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/436 (97%), Positives = 434/436 (99%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60
           MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIEL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
           EALENANDISEGLVSE LKAILDLNLPKASSKKKNITLAISDKNLGPSIKE+FPYVDCIS
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEEFPYVDCIS 120

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LDQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY+FAKLVLFIKDKASLN+DSLHDLAAL
Sbjct: 181 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAAL 240

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           LN+DSGIAQRVIDNARISMGQD+SETDMENVC+FAQRVASLADYRRQLYDYLCEKMHTVA
Sbjct: 241 LNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420
           SGFISKASAKNKGRISRYLANKCSMASRIDNYS+EPSNVFG+VLKKQVEQRLEFYNTGKP
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSEEPSNVFGSVLKKQVEQRLEFYNTGKP 420

Query: 421 TLKNELAIQEAMELYN 436
           TLKNELAIQEAMELYN
Sbjct: 421 TLKNELAIQEAMELYN 436

>Skud_12.262 Chr12 (492745..494262) [1518 bp, 505 aa] {ON} YLR197W
           (REAL)
          Length = 505

 Score =  879 bits (2272), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/436 (97%), Positives = 433/436 (99%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60
           MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKL+ELASFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLVELASFAPFKGAA 60

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
           EALENANDISEGLVSE LKAILDLNLPKASSKKKNITLAISDKNLGPSIKE FPYVDCIS
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEDFPYVDCIS 120

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LDQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY+FAKLVLFIKDKASLN+DSLHDLAAL
Sbjct: 181 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYAFAKLVLFIKDKASLNDDSLHDLAAL 240

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           LN+DSGIAQRVIDNARISMGQD+SETDMENVC+FAQRVASLADYRRQLYDYLCEKMHTVA
Sbjct: 241 LNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420
           SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFG+VLKKQVEQRLEFYNTG P
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGSVLKKQVEQRLEFYNTGTP 420

Query: 421 TLKNELAIQEAMELYN 436
           T+KNELAIQEAMELYN
Sbjct: 421 TMKNELAIQEAMELYN 436

>NDAI0A01880 Chr1 (422978..424489) [1512 bp, 503 aa] {ON} Anc_7.354
          Length = 503

 Score =  843 bits (2178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/436 (92%), Positives = 425/436 (97%), Gaps = 1/436 (0%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60
           MAPIEYLLFEEPTGYA+FKVKLQQDDIGSRLKEVQEQINDFG+FTKL+EL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAIFKVKLQQDDIGSRLKEVQEQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
           EALENAND+SEGLVSE LKAILDLNLPK S K K +TLAISDKNLGPSIKE+FPYVDC++
Sbjct: 61  EALENANDVSEGLVSESLKAILDLNLPKGS-KGKTVTLAISDKNLGPSIKEEFPYVDCLA 119

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 120 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LDQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASLN++SLHDLAA+
Sbjct: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNDESLHDLAAI 239

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           L DD+GIAQRVIDNARISMGQD+SETDMENV IFAQRV SL +YR+QL+DYLCEKMHTVA
Sbjct: 240 LGDDAGIAQRVIDNARISMGQDISETDMENVSIFAQRVVSLVEYRKQLFDYLCEKMHTVA 299

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420
           SGFI+KASAKNKGRISRYLANKCSMASRIDNYSDEP+NVFG+VLKKQVEQRLEFYNTGKP
Sbjct: 360 SGFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYNTGKP 419

Query: 421 TLKNELAIQEAMELYN 436
           TLKNELAIQEAM+LYN
Sbjct: 420 TLKNELAIQEAMDLYN 435

>NCAS0A14170 Chr1 complement(2783782..2785314) [1533 bp, 510 aa]
           {ON} Anc_7.354
          Length = 510

 Score =  837 bits (2162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/436 (91%), Positives = 424/436 (97%), Gaps = 1/436 (0%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60
           MAPIEYLLFEEPTGYA+FKVKLQQDDIGSRLKEVQEQINDFG+FTKL+EL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAIFKVKLQQDDIGSRLKEVQEQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
           EALENANDISEGLVSE LKA+LDLNLPKAS K K ITLAISDKNLGPSIKE FPYVDCI+
Sbjct: 61  EALENANDISEGLVSESLKAVLDLNLPKAS-KSKTITLAISDKNLGPSIKEDFPYVDCIA 119

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           NELAQDLIRGVRLHG+KLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 120 NELAQDLIRGVRLHGDKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LDQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASLN++SLHDLAA+
Sbjct: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNDESLHDLAAI 239

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           LNDD+GIA+RVIDNARISMGQD+SETDMENV +FAQRV SL +YR+QLYDYLCEKMHTVA
Sbjct: 240 LNDDAGIAERVIDNARISMGQDISETDMENVGVFAQRVVSLVEYRKQLYDYLCEKMHTVA 299

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420
           SGFI+KASAKNKGRISRYLANKCSMASRIDNYSDEP++VFG VLKKQVEQRLEFY+TG P
Sbjct: 360 SGFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYSTGTP 419

Query: 421 TLKNELAIQEAMELYN 436
           TLKNELAI+EAM+LYN
Sbjct: 420 TLKNELAIKEAMDLYN 435

>SAKL0F11462g Chr6 complement(889390..890886) [1497 bp, 498 aa] {ON}
           highly similar to uniprot|Q12460 Saccharomyces
           cerevisiae YLR197W SIK1 Component of the small
           (ribosomal) subunit (SSU) processosome that contains U3
           snoRNA
          Length = 498

 Score =  835 bits (2156), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/436 (91%), Positives = 423/436 (97%), Gaps = 1/436 (0%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRLKEVQ+QINDFG+FTKL+EL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
           +ALENANDISEGLVSE LKA+LDLNLPK S+K   +TLAISDKNLGPSIKE FPYVDCIS
Sbjct: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKS-TVTLAISDKNLGPSIKETFPYVDCIS 119

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           NELAQDLIRGVRLHG+KL K LQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 120 NELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LDQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASL+E+SLHDLA++
Sbjct: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASI 239

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           LNDD+GIA+RVIDNARISMGQDLSETDMENVCIFA+RV SLADYRRQLYDYLCEKMHTVA
Sbjct: 240 LNDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVA 299

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420
           SGFI+KASAKNKGRISRYLANKCSMASRIDNYSDEP+NVFG+VLKKQVEQRLEFY+TG P
Sbjct: 360 SGFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAP 419

Query: 421 TLKNELAIQEAMELYN 436
           TLKNELAIQEA+ELYN
Sbjct: 420 TLKNELAIQEAIELYN 435

>TDEL0C01940 Chr3 (340658..342190) [1533 bp, 510 aa] {ON} Anc_7.354
           YLR197W
          Length = 510

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/436 (91%), Positives = 425/436 (97%), Gaps = 1/436 (0%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60
           MAPI+YLLFEEPTGYA+FKVKLQQD+IGSRL EVQEQINDFG+FTKL+EL SFAPFKGAA
Sbjct: 1   MAPIQYLLFEEPTGYAIFKVKLQQDNIGSRLGEVQEQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
           EALENANDISEGLVSE LKAILDLNLPK S KK+ +TL ISD+NLGPSIKE+FPYVD +S
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKGS-KKETVTLGISDRNLGPSIKEEFPYVDSVS 119

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 120 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LDQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLF+KDKASLN++SLHDLAA+
Sbjct: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFVKDKASLNDESLHDLAAI 239

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           LNDD+ IAQRVIDNARISMGQDLSETDMENVC+FA+RVASLADYRRQLY+YLCEKMHTVA
Sbjct: 240 LNDDAAIAQRVIDNARISMGQDLSETDMENVCVFAERVASLADYRRQLYEYLCEKMHTVA 299

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420
           SGFI+KA+ KNKGRISRYLANKCSMASRIDNYSDEP+NVFGTVL+KQVEQRLEFY+TG+P
Sbjct: 360 SGFIAKAATKNKGRISRYLANKCSMASRIDNYSDEPTNVFGTVLRKQVEQRLEFYSTGQP 419

Query: 421 TLKNELAIQEAMELYN 436
           TLKNELAI+EAM+LYN
Sbjct: 420 TLKNELAIKEAMDLYN 435

>Kpol_530.27 s530 (71285..72811) [1527 bp, 508 aa] {ON}
           (71285..72811) [1527 nt, 509 aa]
          Length = 508

 Score =  834 bits (2155), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/436 (91%), Positives = 423/436 (97%), Gaps = 1/436 (0%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60
           MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRL+EVQ+QIN+FG+FTKL+EL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
           EALENANDISEGLVS+ LKA+LDLNLPK S +KK++ +AISDKNLGPSIKE FPYVDCIS
Sbjct: 61  EALENANDISEGLVSDSLKAVLDLNLPKGS-EKKSVVMAISDKNLGPSIKEVFPYVDCIS 119

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           NELAQDLIRGVRLHGEKL KGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 120 NELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LDQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASLNEDSLHDL+A+
Sbjct: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAI 239

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           L++D+G+A+RVIDNARISMGQDLSETDM+NVCIFAQRV SLADYR+QLYDYLCEKMHTVA
Sbjct: 240 LDNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVA 299

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420
           SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEP++VFG VLKKQVEQRLEFY TG P
Sbjct: 360 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTP 419

Query: 421 TLKNELAIQEAMELYN 436
           TLKNE+AI EAMELYN
Sbjct: 420 TLKNEVAIHEAMELYN 435

>ZYRO0F11792g Chr6 complement(962314..963855) [1542 bp, 513 aa] {ON}
           highly similar to uniprot|Q12460 Saccharomyces
           cerevisiae YLR197W SIK1 Component of the small
           (ribosomal) subunit (SSU) processosome that contains U3
           snoRNA
          Length = 513

 Score =  832 bits (2149), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/436 (91%), Positives = 422/436 (96%), Gaps = 1/436 (0%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60
           MAPIEYLLFEEPTGYA+FKVKLQQD+IGSRL+EVQ+QINDFG+FTKL+EL SF+PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
           EALENANDISEGL+SE LKA+LDLNLPK S KK+++TL ISDKNLGPSIKE FPYVDC S
Sbjct: 61  EALENANDISEGLLSESLKAVLDLNLPKGS-KKQSVTLGISDKNLGPSIKEVFPYVDCFS 119

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           NEL+QDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 120 NELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LDQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY+FAKLVLFIKDK SL+EDSLHDLAAL
Sbjct: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEDSLHDLAAL 239

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           LNDD+ IA+RV+DNARISMGQDLS  DMENVCIFAQRV +LADYRRQLYDYLCEKMHTVA
Sbjct: 240 LNDDAAIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVA 299

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420
           SGFISKA+AKNKGRISRYLANKC+MASRIDNYSDEP+N+FGTVLKKQVEQRLEFY TG P
Sbjct: 360 SGFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHP 419

Query: 421 TLKNELAIQEAMELYN 436
           TLKNELAIQEA+ELYN
Sbjct: 420 TLKNELAIQEAIELYN 435

>KLTH0H01166g Chr8 (116579..118102) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12460 Saccharomyces cerevisiae
           YLR197W SIK1 Component of the small (ribosomal) subunit
           (SSU) processosome that contains U3 snoRNA
          Length = 507

 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/436 (91%), Positives = 418/436 (95%), Gaps = 1/436 (0%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRLKEVQ QINDFG+FTKL+EL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
           +ALENANDISEGLVSE LKA+LD+NLPK S+KK  +TLAISDKNLGPSIKE FPY+DC+S
Sbjct: 61  QALENANDISEGLVSEYLKAVLDMNLPKGSNKK-TVTLAISDKNLGPSIKEVFPYIDCMS 119

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           NELAQDLIRGVRLHG+KL K LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 120 NELAQDLIRGVRLHGDKLLKDLQQGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LDQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY FAKLVLFIKDKASL EDSLHDL A+
Sbjct: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIKDKASLTEDSLHDLTAI 239

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           L+DD+GIA+RVIDNARISMGQDLSETDMENVC+FA+RV SLADYRRQLYDYLC KMHTVA
Sbjct: 240 LDDDAGIAERVIDNARISMGQDLSETDMENVCVFAERVTSLADYRRQLYDYLCSKMHTVA 299

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420
           SGFI KASAKNKGRISRYLANKCS+ASRIDNYSDEPSNVFGTVLKKQVEQRLEFY+TG P
Sbjct: 360 SGFIGKASAKNKGRISRYLANKCSIASRIDNYSDEPSNVFGTVLKKQVEQRLEFYSTGAP 419

Query: 421 TLKNELAIQEAMELYN 436
           TLKNELAIQEA+ELYN
Sbjct: 420 TLKNELAIQEAIELYN 435

>KAFR0L01510 Chr12 complement(276894..278396) [1503 bp, 500 aa] {ON}
           Anc_7.354 YLR197W
          Length = 500

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/436 (90%), Positives = 420/436 (96%), Gaps = 1/436 (0%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60
           MAPIEYLLFEEPTGYAVFKVKLQQDDI SRL EVQ+QIN+FG+FTKL+EL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIASRLAEVQQQINEFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
           +ALENANDISEGL+S+ LK+IL+LNLPKAS K K +TL ISDKNLGPSIKEQFPYVDCIS
Sbjct: 61  DALENANDISEGLLSDSLKSILELNLPKAS-KSKTVTLGISDKNLGPSIKEQFPYVDCIS 119

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           NELAQDL+RGVR HGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 120 NELAQDLLRGVRQHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           +DQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY+FAKLVLFIKDKASLN++SLH+LA  
Sbjct: 180 VDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDESLHELAGH 239

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           LN+D+GIAQRVIDNARISMGQDLSE DM+NVC+FA+RV SL DYRR LYDYLCEKMHTVA
Sbjct: 240 LNEDAGIAQRVIDNARISMGQDLSEIDMQNVCVFAERVVSLVDYRRGLYDYLCEKMHTVA 299

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420
           SGFI+KASAKNKGRISRYLANKCS+ASRIDNYSDEPSNVFG+VLKKQVEQRLEFYN GKP
Sbjct: 360 SGFIAKASAKNKGRISRYLANKCSIASRIDNYSDEPSNVFGSVLKKQVEQRLEFYNIGKP 419

Query: 421 TLKNELAIQEAMELYN 436
           TLKNELAIQEAMELYN
Sbjct: 420 TLKNELAIQEAMELYN 435

>TPHA0F03010 Chr6 complement(658541..660070) [1530 bp, 509 aa] {ON}
           Anc_7.354 YLR197W
          Length = 509

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/436 (89%), Positives = 422/436 (96%), Gaps = 1/436 (0%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60
           MAPIEYLL+EEPTGYA+FKVKLQQDDIGSRL EVQ+QINDFG+FTKL+EL SFAPFKGAA
Sbjct: 1   MAPIEYLLYEEPTGYAIFKVKLQQDDIGSRLGEVQQQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
           EALENANDISEGLVSE LKA+LDLNLPK S +KK++ L ISDKNLGPSIKE FPYVDC++
Sbjct: 61  EALENANDISEGLVSENLKALLDLNLPKGS-EKKSVVLGISDKNLGPSIKEDFPYVDCMA 119

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           NELAQDL+RG+RLHGEKLFK LQ+GDL+RAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 120 NELAQDLLRGIRLHGEKLFKDLQTGDLDRAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LDQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNYSFA+LVLFIKDKASLN++SLHDL A+
Sbjct: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYSFARLVLFIKDKASLNDESLHDLTAI 239

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           LNDD+GI+QRVIDNARISMGQDLSETDM+N+C+FA+RV SL +YRRQLYDYLCEKMHTVA
Sbjct: 240 LNDDAGISQRVIDNARISMGQDLSETDMDNICVFAKRVVSLVEYRRQLYDYLCEKMHTVA 299

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420
           SGFI+KA+AKNKGRISRYLANKCSMASRIDNYSDEP+NVFG+VLKKQVEQRLEFY TG P
Sbjct: 360 SGFIAKAAAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYATGSP 419

Query: 421 TLKNELAIQEAMELYN 436
           TLKNELAIQEAM+LYN
Sbjct: 420 TLKNELAIQEAMKLYN 435

>CAGL0A04015g Chr1 complement(402070..403596) [1527 bp, 508 aa] {ON}
           similar to uniprot|Q12460 Saccharomyces cerevisiae
           YLR197w SIK1 involved in pre-rRNA processing
          Length = 508

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/433 (90%), Positives = 417/433 (96%), Gaps = 1/433 (0%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAAEAL 63
           IEYLLFEEPTGYAVFKVKL QD+IGS+LKEVQEQINDFG FTKL+EL SFAPFKGAAEAL
Sbjct: 3   IEYLLFEEPTGYAVFKVKLNQDNIGSKLKEVQEQINDFGGFTKLVELVSFAPFKGAAEAL 62

Query: 64  ENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCISNEL 123
           ENANDISEGLVSE LK +L+LNLPK S+K   +TLAISDKNLGPSIKE FPYVDCI+NEL
Sbjct: 63  ENANDISEGLVSESLKNVLELNLPKGSAKS-TVTLAISDKNLGPSIKEAFPYVDCIANEL 121

Query: 124 AQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQ 183
           AQDLIRGVRLHGEKL KGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQ
Sbjct: 122 AQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQ 181

Query: 184 LDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAALLND 243
           LDKD+NTFAMRVKEWYGWHFPELAKLVPDNY+FAKLVLFIKDKASLNE+SLHDLAA++N+
Sbjct: 182 LDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNEESLHDLAAVVNE 241

Query: 244 DSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVAPNL 303
           D+GIA+R+IDNARISMGQDLSETDMENVC+FAQRV SL DYR+QLYDYLCEKMHTVAPNL
Sbjct: 242 DAGIAERIIDNARISMGQDLSETDMENVCVFAQRVVSLVDYRKQLYDYLCEKMHTVAPNL 301

Query: 304 SELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGF 363
           S LIGEVIGARLISHAGSLT+LSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGF
Sbjct: 302 SGLIGEVIGARLISHAGSLTSLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGF 361

Query: 364 ISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKPTLK 423
           I+KASAKNKGRISRYLANKCSMASRIDNYSDEP+NVFG+VLKKQVEQRLEFY TGKPTLK
Sbjct: 362 IAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYATGKPTLK 421

Query: 424 NELAIQEAMELYN 436
           NELAI EAMEL+N
Sbjct: 422 NELAIHEAMELFN 434

>KNAG0B02590 Chr2 (503498..504997) [1500 bp, 499 aa] {ON} Anc_7.354
           YLR197W
          Length = 499

 Score =  822 bits (2123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/435 (90%), Positives = 417/435 (95%), Gaps = 1/435 (0%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60
           MA IEYLLFEEPTGYAVFKVKLQQDDIGSRL EVQEQINDFG+FTK++EL SFAPFKGAA
Sbjct: 1   MAAIEYLLFEEPTGYAVFKVKLQQDDIGSRLAEVQEQINDFGSFTKMVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
           EALENAN+ISEGLVSE LK++LDLNLPK  SKKK+I L ISDKNLGPSIKE FPYVD +S
Sbjct: 61  EALENANEISEGLVSESLKSVLDLNLPK-PSKKKSIALGISDKNLGPSIKETFPYVDSVS 119

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           NEL QD++RG+RLHGEKLFKGLQSGDL+RA LGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 120 NELVQDMLRGIRLHGEKLFKGLQSGDLDRAHLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           +DQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASLN++SLHDLAAL
Sbjct: 180 VDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNDESLHDLAAL 239

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           LNDD+GIAQRVIDNARISMGQDLSETDMENV +FAQRV SL +YRRQLYDYLCEKMHTVA
Sbjct: 240 LNDDAGIAQRVIDNARISMGQDLSETDMENVGVFAQRVVSLVEYRRQLYDYLCEKMHTVA 299

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420
           SGFI+KA+AKNKGRISRYLANKCS+ASRIDNYSDEPSNVFGTVLKKQVEQRLEFY TGKP
Sbjct: 360 SGFIAKAAAKNKGRISRYLANKCSIASRIDNYSDEPSNVFGTVLKKQVEQRLEFYATGKP 419

Query: 421 TLKNELAIQEAMELY 435
           TLKNELAI EAMELY
Sbjct: 420 TLKNELAIHEAMELY 434

>Kwal_56.24654 s56 complement(1090443..1091966) [1524 bp, 507 aa]
           {ON} YLR197W (SIK1) - homology to microtubule binding
           proteins and to X90565_5.cds [contig 161] FULL
          Length = 507

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/436 (89%), Positives = 420/436 (96%), Gaps = 1/436 (0%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRLKEVQ QIN+FG+FTKL+EL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
           +ALENANDISEGLVS+ LKA+LD+NLPK SSKK  +TLAISDKNLGPSIKE FPYVDC+S
Sbjct: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKK-TVTLAISDKNLGPSIKEAFPYVDCMS 119

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           NELAQDLIRGVRLHG+KL K LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 120 NELAQDLIRGVRLHGDKLLKDLQQGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LDQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASL+EDSLHDL+A+
Sbjct: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAI 239

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           L++D+GIA+RVIDNARISMGQDLSETDM+NVC+FA+RV SLADYRRQLY+YLC KMHTVA
Sbjct: 240 LDNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVA 299

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420
           SGFI KA+AKNKGRISRYLANKCS+ASRIDNYSDEP+NVFGTVLKKQVEQRLEFY+TG P
Sbjct: 360 SGFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSP 419

Query: 421 TLKNELAIQEAMELYN 436
           TLKNELAIQEA+ELYN
Sbjct: 420 TLKNELAIQEAIELYN 435

>TBLA0E02080 Chr5 complement(505617..507158) [1542 bp, 513 aa] {ON}
           Anc_7.354 YLR197W
          Length = 513

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/436 (88%), Positives = 418/436 (95%), Gaps = 1/436 (0%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60
           M+ I+YLLFEEPTGYAVF+VKLQQD+IGS+L EVQ+QINDF +FTKL+EL SFAPFKGAA
Sbjct: 1   MSAIQYLLFEEPTGYAVFQVKLQQDNIGSKLAEVQKQINDFASFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
           EALENANDISEGLVSE LK++L+LNLPK S +KK + L ISDKNLGPSIKE+FPYVDCIS
Sbjct: 61  EALENANDISEGLVSENLKSLLELNLPKGS-EKKTVILGISDKNLGPSIKEEFPYVDCIS 119

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           NEL QDL+RG+R HGEKLFKGLQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 120 NELVQDLLRGIRQHGEKLFKGLQQGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LDQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASLNE+SLHDL A+
Sbjct: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEESLHDLTAI 239

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           LNDD+GIA+RVIDNARISMGQDLSETDMENVC+FA+RV S+ADYR+QLYDYLCEKMHTVA
Sbjct: 240 LNDDAGIAERVIDNARISMGQDLSETDMENVCVFAKRVVSIADYRKQLYDYLCEKMHTVA 299

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420
           SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPS+VFG V+KKQVEQRLEFY+TGKP
Sbjct: 360 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSSVFGAVMKKQVEQRLEFYSTGKP 419

Query: 421 TLKNELAIQEAMELYN 436
           TLKNE+AI EAMELYN
Sbjct: 420 TLKNEVAIHEAMELYN 435

>KLLA0D12254g Chr4 (1045077..1046618) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|Q12460 Saccharomyces cerevisiae
           YLR197W SIK1 Component of the small (ribosomal) subunit
           (SSU) processosome that contains U3 snoRNA
          Length = 513

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/436 (89%), Positives = 417/436 (95%), Gaps = 1/436 (0%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRLKEVQ+QINDFG+FTKL+EL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
           +ALENANDISEGLVSE LKA+LDLNLPK SSKK  +TLAISDKNLGPSIKE FP+VDCIS
Sbjct: 61  QALENANDISEGLVSEHLKALLDLNLPKGSSKK-TVTLAISDKNLGPSIKEVFPFVDCIS 119

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           NELAQDLIRGVRLHG+KL K LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 120 NELAQDLIRGVRLHGDKLLKDLQPGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LDQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY FAKLVLFIKDKASLNE+SLHDL+ +
Sbjct: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIKDKASLNEESLHDLSEI 239

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           L++D+GI++RVIDNARISMGQDLSETDMENV IFA+RV SL +YR+QLYDYLCEKMHTVA
Sbjct: 240 LDNDAGISERVIDNARISMGQDLSETDMENVTIFAKRVVSLVEYRKQLYDYLCEKMHTVA 299

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNLSELIGEVIGARLISH+GSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 300 PNLSELIGEVIGARLISHSGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420
           SGFI+KASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFG VLKKQVEQRLEFY +G P
Sbjct: 360 SGFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGQVLKKQVEQRLEFYASGTP 419

Query: 421 TLKNELAIQEAMELYN 436
           TLKNE AI+EA+ELYN
Sbjct: 420 TLKNESAIKEAIELYN 435

>ACL144C Chr3 complement(94809..96458) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR197W
           (SIK1)
          Length = 549

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/436 (87%), Positives = 414/436 (94%), Gaps = 1/436 (0%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRLKEVQ+QINDFG+FTKL+EL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
            ALENANDISEGL+SE LKA+LDLNLPK S+KK ++ LA+SDKNLGPSIKE+FPYVDCIS
Sbjct: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKK-SVVLAVSDKNLGPSIKEEFPYVDCIS 119

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           NELAQDL+RGVRLHG KL K LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 120 NELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LDQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY FAKLVLFI+DKASLN++SLHDL+A+
Sbjct: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAI 239

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           L +D+GIA+RVI NARISMGQDLSE DMENV +FA+RV +L +YRRQLY+YLCEKMHTVA
Sbjct: 240 LGEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVA 299

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420
           SGFISKASAKNKGRISRYLANKCSMASRIDNYSD+P+NVFG VLKKQVEQRLEFY TG P
Sbjct: 360 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSP 419

Query: 421 TLKNELAIQEAMELYN 436
           TLKNE+AIQEA+ L+N
Sbjct: 420 TLKNEIAIQEAIALFN 435

>Ecym_4719 Chr4 (1410528..1412069) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ACL144C
          Length = 513

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/436 (87%), Positives = 412/436 (94%), Gaps = 1/436 (0%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRLKEVQ+QINDFG+FTKL+ELASF PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELASFVPFKGAA 60

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
           +ALEN NDISEGL+SE LKA+LDLNLPK SSKK  + LAISDKNLGPSIKE+FPYVDCI+
Sbjct: 61  QALENCNDISEGLLSEHLKAVLDLNLPKGSSKKA-VVLAISDKNLGPSIKEEFPYVDCIA 119

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           +ELAQDLIRGVRLHG KL K LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 120 SELAQDLIRGVRLHGSKLLKDLQPGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LDQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY FAKLVL I+DK SL +DSLHDLAA+
Sbjct: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLHIRDKTSLTDDSLHDLAAI 239

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           L+DD+GIA+RVI NARISMGQDLSE DM+NVC+FA+RVA+L DYR+QLYDYLC KMHTVA
Sbjct: 240 LDDDAGIAERVISNARISMGQDLSEVDMDNVCVFAERVANLVDYRKQLYDYLCAKMHTVA 299

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420
           SGFISKASAKNKGRISRYLANKCS+ASRIDNY+D+P+N FG VLKKQVEQRLEFY TG P
Sbjct: 360 SGFISKASAKNKGRISRYLANKCSIASRIDNYADDPTNAFGQVLKKQVEQRLEFYATGTP 419

Query: 421 TLKNELAIQEAMELYN 436
           TLKNE+AIQEA++L+N
Sbjct: 420 TLKNEVAIQEAIDLFN 435

>KLTH0H15334g Chr8 complement(1329504..1331039) [1536 bp, 511 aa]
           {ON} highly similar to uniprot|Q12499 Saccharomyces
           cerevisiae YOR310C NOP58 Protein involved in pre-rRNA
           processing 18S rRNA synthesis and snoRNA synthesis
           component of the small subunit processome complex which
           is required for processing of pre-18S rRNA
          Length = 511

 Score =  333 bits (854), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 183/411 (44%), Positives = 264/411 (64%), Gaps = 15/411 (3%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAAEAL 63
           + Y+L E   GYA+ K   ++    S L  +Q+ +N      K  ++A+F+ F  AAEAL
Sbjct: 1   MAYVLTETSAGYALLKASDKKIYKSSSL--IQD-LNTSDKVLKQFKVAAFSKFGSAAEAL 57

Query: 64  ENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCISNEL 123
           E AN I EG VS  L+ +LD      S   K  TL +S+  L  +I +     + +S+ +
Sbjct: 58  EEANSIVEGKVSSQLQKLLD-----ESKADKKATLVVSETKLANAINKLGLNFNVVSDAV 112

Query: 124 AQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQ 183
             D+ R V+ H  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIALLD 
Sbjct: 113 TLDIFRAVKEHLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDD 172

Query: 184 LDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAALLND 243
           LDK++NT+AMR KEWYGWHFPELAK+V D+ +FA+++L +  +++  E    DL+ +L +
Sbjct: 173 LDKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAET---DLSEILPE 229

Query: 244 DSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVAPNL 303
           +  I +RV   A ISMG +++ TD+EN+   A ++   A YR QL +YL  +M  +APNL
Sbjct: 230 E--IEERVKAAAEISMGTEITPTDLENIKALATQITEFAAYREQLSNYLSARMKAIAPNL 287

Query: 304 SELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGF 363
           ++L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  
Sbjct: 288 TQLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASL 347

Query: 364 ISKASAKNKGRISRYLANKCSMASRIDNYSD--EPSNVFGTVLKKQVEQRL 412
           + +A+ KNKG+I+R LA K +++ R D  ++  + S   G   + +VE RL
Sbjct: 348 VGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDVGLEARSKVESRL 398

>KNAG0G03190 Chr7 complement(687362..688933) [1572 bp, 523 aa] {ON}
           Anc_8.787 YOR310C
          Length = 523

 Score =  331 bits (849), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 178/411 (43%), Positives = 264/411 (64%), Gaps = 15/411 (3%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAAEAL 63
           + Y+L E   GYA+ K     D    +   + E +N      K  ++A+F+ F  AA AL
Sbjct: 1   MSYVLTETSAGYALLKA---SDKKIYKSPSLIEDLNTSEKLLKEFKIAAFSKFNSAANAL 57

Query: 64  ENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCISNEL 123
           E AN + EG VS  L+ +L+        K K  TL +S+  L  SI +     + +S+ +
Sbjct: 58  EEANSVIEGKVSPQLEKLLE-----DIKKDKKATLVVSETKLANSINKLGLNFNVVSDAV 112

Query: 124 AQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQ 183
             D+ R V+ H  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIALLD 
Sbjct: 113 TLDIYRAVKEHLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDD 172

Query: 184 LDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAALLND 243
           LDK++NT+AMR KEWYGWHFPELAK+V D+ ++A+++L +  ++  +E    D++ +L +
Sbjct: 173 LDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGVRSKAHET---DMSEILPE 229

Query: 244 DSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVAPNL 303
           +  I +RV   A +SMG ++++TD++N+   A ++   A YR QL +YL  +M  +APNL
Sbjct: 230 E--IEERVKAAAEVSMGTEITQTDLDNIKALADQIVDFAAYREQLSNYLSARMKAIAPNL 287

Query: 304 SELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGF 363
           ++L+GE++GARLI+HAGSLT+L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  
Sbjct: 288 TQLVGELVGARLIAHAGSLTSLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHASL 347

Query: 364 ISKASAKNKGRISRYLANKCSMASRIDNYSD--EPSNVFGTVLKKQVEQRL 412
           + +A+ KNKG+I+R LA K +++ R D +S+  + S   G  ++ +VE RL
Sbjct: 348 VGQATGKNKGKIARVLAAKAAVSLRYDAFSEDRDDSGDVGLDVRVKVENRL 398

>KNAG0J00650 Chr10 (110685..112259) [1575 bp, 524 aa] {ON} Anc_8.787
           YOR310C
          Length = 524

 Score =  331 bits (848), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 178/414 (42%), Positives = 266/414 (64%), Gaps = 21/414 (5%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIE---LASFAPFKGAA 60
           + Y+L E   GYA+ K          +L +    I D  +  K+++   +A+F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKAS------DKKLYKSATLIQDLDSSEKVLKEFKIAAFSKFNSAA 54

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
            ALE AN + EG VS  L+ +LD        K K  TL +S+  L  SI +     + +S
Sbjct: 55  NALEEANSVIEGKVSPQLQKLLD-----DIKKDKKATLVVSETKLANSINKLGLNFNVVS 109

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           + +  D+ R V+ H  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIAL
Sbjct: 110 DAVTLDIYRAVKEHLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIAL 169

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LD LDK++NT+AMR KEWYGWHFPELAK+V D+ ++A+++L +  ++  +E    D++ +
Sbjct: 170 LDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGVRSKAHE---IDMSEI 226

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           L ++  I +RV   A +SMG ++++TD++N+   A ++   A YR QL +YL  +M  +A
Sbjct: 227 LPEE--IEERVKAAAEVSMGTEITQTDLDNIKALADQIVDFAAYREQLSNYLSARMKAIA 284

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNL++L+GE++GARLI+HAGSLT+L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH
Sbjct: 285 PNLTQLVGELVGARLIAHAGSLTSLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYH 344

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSD--EPSNVFGTVLKKQVEQRL 412
           +  + +A+ KNKG+I+R LA K +++ R D +++  + S   G  ++ +VE RL
Sbjct: 345 ASLVGQATGKNKGKIARVLAAKAAVSLRYDAFAEDRDDSGDVGLDVRAKVENRL 398

>ZYRO0F12518g Chr6 complement(1017206..1018765) [1560 bp, 519 aa]
           {ON} similar to uniprot|Q12499 Saccharomyces cerevisiae
           YOR310C NOP58 Protein involved in pre-rRNA processing
           18S rRNA synthesis and snoRNA synthesis component of the
           small subunit processome complex which is required for
           processing of pre-18S rRNA
          Length = 519

 Score =  330 bits (845), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 177/414 (42%), Positives = 266/414 (64%), Gaps = 21/414 (5%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIE---LASFAPFKGAA 60
           + Y+L E   GYA+ K          ++ +  + I D  +  K+++   +A+F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKAS------DKKIHKSPKLIQDLDSSEKVLDEFKIAAFSKFNSAA 54

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
            ALE AN I+EG V+  L+++LD        K K  TL +S+  L  SI +     + +S
Sbjct: 55  NALEEANSITEGKVTPQLQSLLD-----EVKKDKKSTLIVSETKLANSINKLGLNFNVVS 109

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           + +  D+ R V+ +  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIAL
Sbjct: 110 DAVTLDIYRAVKEYLPELLPGLTDNDLNKMSLGLAHSIGRHKLKFSADKVDVMIIQAIAL 169

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LD LDK++NT++MR KEWYGWHFPELAK+V D  ++A+++L +  ++   E    D++A+
Sbjct: 170 LDDLDKEINTYSMRCKEWYGWHFPELAKIVTDLVAYARIILTMGVRSKAAE---TDMSAI 226

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           L ++  I +RV   A +SMG ++++TD++N+   AQ++   A YR QL +YL  +M  +A
Sbjct: 227 LPEE--IEERVKAAAEVSMGTEITKTDLDNIGALAQQIVDFATYREQLSNYLTARMKAIA 284

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNL++L+GE++GARLISHAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH
Sbjct: 285 PNLTQLVGELVGARLISHAGSLVSLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYH 344

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSD--EPSNVFGTVLKKQVEQRL 412
           +  + +A+ KNKG+I+R LA K +++ R D  ++  + S   G   + +VE RL
Sbjct: 345 ASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDVGLESRSKVENRL 398

>TBLA0B02830 Chr2 (653081..654634) [1554 bp, 517 aa] {ON} Anc_8.787
           YOR310C
          Length = 517

 Score =  323 bits (829), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 172/411 (41%), Positives = 261/411 (63%), Gaps = 15/411 (3%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAAEAL 63
           + Y+L E P GYA+ K     D    +   + + ++      K  ++A+F+ F  AA AL
Sbjct: 1   MSYVLTETPAGYALLKA---SDKKIYKSSSLLQDLDTTDKVLKEFKIAAFSKFNSAANAL 57

Query: 64  ENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCISNEL 123
           E +  I EG VS  L+ +LD        K K  TL +S+  L  +I +    ++ +S+ +
Sbjct: 58  EESTAIIEGKVSPQLEKLLD-----EIKKDKKTTLIVSETKLANAINKLGLNLNIVSDAV 112

Query: 124 AQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQ 183
             D+ R V+ +   L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIALLD 
Sbjct: 113 TLDIYRAVKEYLPDLLPGLSDSDLNKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDD 172

Query: 184 LDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAALLND 243
           LDK++NT+AMR KEWYGWHFPELAK+V D+ ++A+L+L +  ++  +E    D++ +L +
Sbjct: 173 LDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARLILTMGIRSKASE---TDMSEILPE 229

Query: 244 DSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVAPNL 303
           +  I +RV   A +SMG +++ TD++N+   A+++   A YR QL +YL  +M  +APNL
Sbjct: 230 E--IEERVKTAAEVSMGTEITPTDLDNIKALAEQIVEFASYREQLSNYLSSRMKAIAPNL 287

Query: 304 SELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGF 363
           ++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  
Sbjct: 288 TQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASL 347

Query: 364 ISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNV--FGTVLKKQVEQRL 412
           + +A+ KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 348 VGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDAGDVGLEARTKVENRL 398

>KAFR0D01580 Chr4 complement(313631..315136) [1506 bp, 501 aa] {ON}
           Anc_8.787 YOR310C
          Length = 501

 Score =  322 bits (824), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 172/414 (41%), Positives = 264/414 (63%), Gaps = 21/414 (5%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIE---LASFAPFKGAA 60
           + Y+L E   GYA+ K          ++ +    ++D  +  K+++   +A+F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKAS------DKKIYKSTTLLSDLDSSEKVLKEFKIAAFSKFSSAA 54

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
            ALE AN I EG VS  L+ IL+        K K  TL +S+  L  +I +     + +S
Sbjct: 55  NALEEANSIIEGKVSSQLEKILE-----QIKKDKKSTLIVSETKLANAINKLGLNFNVVS 109

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           + +  D+ R V+ H  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIAL
Sbjct: 110 DAVTLDIYRAVKEHLPELLPGLNDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIAL 169

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LD LDK++NT+AMR KEWYGWHFPELAK+V D+ ++A+++L +  ++   E    D++ +
Sbjct: 170 LDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKAAET---DMSEI 226

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           L ++  + +RV   A +SMG +++++D++N+   A+++   A YR QL +YL  +M  +A
Sbjct: 227 LPEE--VEERVKTAAEVSMGTEITQSDLDNIKSLAEQIVEFAAYREQLSNYLSNRMKAIA 284

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH
Sbjct: 285 PNLTQLVGELVGARLIAHSGSLVSLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYH 344

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSD--EPSNVFGTVLKKQVEQRL 412
           +  + +A+ KNKG+I+R LA K +++ R D  ++  + S   G   + +VE RL
Sbjct: 345 ASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLECRAKVENRL 398

>KAFR0B03540 Chr2 complement(735790..737289) [1500 bp, 499 aa] {ON}
           Anc_8.787 YOR310C
          Length = 499

 Score =  322 bits (824), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 173/414 (41%), Positives = 264/414 (63%), Gaps = 21/414 (5%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLI---ELASFAPFKGAA 60
           + Y+L E   GYA+ K   ++    S L      + D  +  K++   ++A+F+ F  AA
Sbjct: 1   MSYILTETSAGYALLKASDKKIYKSSTL------LQDLDSSEKVLRQFKIAAFSKFSSAA 54

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
            ALE AN I EG VS  L+ +LD        K K  TL +S+  L  +I +    +  +S
Sbjct: 55  NALEEANSIVEGKVSTQLEKLLD-----EIKKDKKSTLVVSETKLANAINKLGLNLSVVS 109

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           + +  D+ R V+ +  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIAL
Sbjct: 110 DAVTLDIYRAVKEYLPELLPGLDDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIAL 169

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LD LDK++NT+AMR KEWYGWHFPELAK+V D+ ++A+++L +  ++   E    D++ +
Sbjct: 170 LDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKAAE---TDMSEI 226

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           L ++  + +RV   A +SMG +++++D++N+   A+++   A YR QL +YL  +M  +A
Sbjct: 227 LPEE--VEERVKTAAEVSMGTEITQSDLDNIKSLAEQIVEFAAYREQLSNYLSNRMKAIA 284

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH
Sbjct: 285 PNLTQLVGELVGARLIAHSGSLVSLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYH 344

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSD--EPSNVFGTVLKKQVEQRL 412
           +  + +A+ KNKG+I+R LA K +++ R D  ++  + S   G   + +VE RL
Sbjct: 345 ASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLECRAKVENRL 398

>TDEL0B01110 Chr2 (204471..205985) [1515 bp, 504 aa] {ON} Anc_8.787
           YOR310C
          Length = 504

 Score =  321 bits (823), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 176/411 (42%), Positives = 265/411 (64%), Gaps = 15/411 (3%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAAEAL 63
           + Y+L E   GYA+ K   ++  I    K +Q+ ++      K  ++A+F+ F  AA AL
Sbjct: 1   MAYVLTETSAGYALLKASDKK--IYKSTKLIQD-LDSSDKVLKEFKIAAFSKFNSAANAL 57

Query: 64  ENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCISNEL 123
           E A+ I EG VS  L+     NL +   K K  TL +S+  L  +I +     + IS+ +
Sbjct: 58  EEASAIIEGKVSPQLQ-----NLLEDIKKDKKSTLIVSETKLANAINKLGLNFNVISDAV 112

Query: 124 AQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQ 183
             D+ R V+ +   L  GL  GDL +  LGL H+  R K+KFS  K D  IIQAIALLD 
Sbjct: 113 TLDIYRAVKEYLPDLLPGLTDGDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDD 172

Query: 184 LDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAALLND 243
           LDK++NT+AMR KEWYGWHFPELAK+V D+ ++A+++L I  ++  +E    D++++L +
Sbjct: 173 LDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILSIGVRSKASE---TDMSSILPE 229

Query: 244 DSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVAPNL 303
           +  I +RV   A +SMG ++++ D++N+   A+++   A YR QL +YL  +M  +APNL
Sbjct: 230 E--IEERVKTAAEVSMGTEITQVDLDNIKCLAEQIVDFASYREQLSNYLSARMKAIAPNL 287

Query: 304 SELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGF 363
           ++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  
Sbjct: 288 TQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASL 347

Query: 364 ISKASAKNKGRISRYLANKCSMASRIDNYSD--EPSNVFGTVLKKQVEQRL 412
           + +A+ KNKG+I+R LA K +++ R D  ++  + S   G   + +VE RL
Sbjct: 348 VGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLDSRAKVENRL 398

>Smik_15.491 Chr15 complement(846605..848155) [1551 bp, 516 aa] {ON}
           YOR310C (REAL)
          Length = 516

 Score =  321 bits (823), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 175/412 (42%), Positives = 264/412 (64%), Gaps = 21/412 (5%)

Query: 6   YLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIE---LASFAPFKGAAEA 62
           Y+L E   GYA+ K   ++    S L      I D  +  K+++   +A+F+ F  AA A
Sbjct: 3   YVLTETSAGYALLKASDKKIYKSSSL------IQDLDSSDKVLKEFKIAAFSKFNSAANA 56

Query: 63  LENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCISNE 122
           LE AN I EG VS  L+ +L+        K K  TL +S+  L  +I +     + +S+ 
Sbjct: 57  LEEANSIIEGKVSSQLEKLLE-----EIKKDKKSTLIVSETKLANAINKLGLNFNVVSDA 111

Query: 123 LAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLD 182
           +  D+ R V+ +  +L  G+   DL +  LGL H+  R K+KFS  K D  IIQAIALLD
Sbjct: 112 VTLDIYRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLD 171

Query: 183 QLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAALLN 242
            LDK++NT+AMR KEWYGWHFPELAK+V D+ ++A+++L +  ++  +E    DL+ +L 
Sbjct: 172 DLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASET---DLSEILP 228

Query: 243 DDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVAPN 302
           ++  I +RV   A +SMG ++++TD++N+   A+++   A YR QL +YL  +M  +APN
Sbjct: 229 EE--IEERVKTAAEVSMGTEITQTDLDNINALAEQIVEFAAYREQLSNYLSARMKAIAPN 286

Query: 303 LSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSG 362
           L++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+ 
Sbjct: 287 LTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHAS 346

Query: 363 FISKASAKNKGRISRYLANKCSMASRIDNYSD--EPSNVFGTVLKKQVEQRL 412
            + +A+ KNKG+I+R LA K +++ R D  ++  + S   G   + +VE RL
Sbjct: 347 LVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>Skud_15.478 Chr15 complement(836937..837160,837194..838505) [1536
           bp, 512 aa] {ON} YOR310C (REAL)
          Length = 512

 Score =  321 bits (822), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 175/412 (42%), Positives = 264/412 (64%), Gaps = 21/412 (5%)

Query: 6   YLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIE---LASFAPFKGAAEA 62
           Y+L E   GYA+ K   ++    S L      I D  +  K+++   +A+F+ F  AA A
Sbjct: 3   YVLTETSAGYALLKASDKKIYKSSSL------IQDLDSSDKVLKEFKIAAFSKFNSAANA 56

Query: 63  LENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCISNE 122
           LE AN I EG VS  L+ +L+        K K  TL +S+  L  +I +     + +S+ 
Sbjct: 57  LEEANSIIEGKVSSQLEKLLE-----EIKKDKKSTLIVSETKLANAINKLGLNFNVVSDA 111

Query: 123 LAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLD 182
           +  D+ R V+ +  +L  G+   DL +  LGL H+  R K+KFS  K D  IIQAIALLD
Sbjct: 112 VTLDIYRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLD 171

Query: 183 QLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAALLN 242
            LDK++NT+AMR KEWYGWHFPELAK+V D+ ++A+++L +  ++  +E    DL+ +L 
Sbjct: 172 DLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASE---TDLSEILP 228

Query: 243 DDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVAPN 302
           ++  I +RV   A +SMG ++++TD++N+   A+++   A YR QL +YL  +M  +APN
Sbjct: 229 EE--IEERVKTAAEVSMGTEITQTDLDNINALAEQIVDFAAYREQLSNYLSARMKAIAPN 286

Query: 303 LSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSG 362
           L++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+ 
Sbjct: 287 LTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHAS 346

Query: 363 FISKASAKNKGRISRYLANKCSMASRIDNYSD--EPSNVFGTVLKKQVEQRL 412
            + +A+ KNKG+I+R LA K +++ R D  ++  + S   G   + +VE RL
Sbjct: 347 LVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>YOR310C Chr15 complement(896825..898360) [1536 bp, 511 aa] {ON}
           NOP58Protein involved in pre-rRNA processing, 18S rRNA
           synthesis, and snoRNA synthesis; component of the small
           subunit processome complex, which is required for
           processing of pre-18S rRNA
          Length = 511

 Score =  320 bits (821), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 174/412 (42%), Positives = 264/412 (64%), Gaps = 21/412 (5%)

Query: 6   YLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIE---LASFAPFKGAAEA 62
           Y+L E   GYA+ K   ++    S L      I D  +  K+++   +A+F+ F  AA A
Sbjct: 3   YVLTETSAGYALLKASDKKIYKSSSL------IQDLDSSDKVLKEFKIAAFSKFNSAANA 56

Query: 63  LENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCISNE 122
           LE AN I EG VS  L+ +L+        K K  TL +S+  L  +I +     + +S+ 
Sbjct: 57  LEEANSIIEGKVSSQLEKLLE-----EIKKDKKSTLIVSETKLANAINKLGLNFNVVSDA 111

Query: 123 LAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLD 182
           +  D+ R ++ +  +L  G+   DL +  LGL H+  R K+KFS  K D  IIQAIALLD
Sbjct: 112 VTLDIYRAIKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLD 171

Query: 183 QLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAALLN 242
            LDK++NT+AMR KEWYGWHFPELAK+V D+ ++A+++L +  ++  +E    DL+ +L 
Sbjct: 172 DLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASET---DLSEILP 228

Query: 243 DDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVAPN 302
           ++  I +RV   A +SMG ++++TD++N+   A+++   A YR QL +YL  +M  +APN
Sbjct: 229 EE--IEERVKTAAEVSMGTEITQTDLDNINALAEQIVEFAAYREQLSNYLSARMKAIAPN 286

Query: 303 LSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSG 362
           L++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+ 
Sbjct: 287 LTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHAS 346

Query: 363 FISKASAKNKGRISRYLANKCSMASRIDNYSD--EPSNVFGTVLKKQVEQRL 412
            + +A+ KNKG+I+R LA K +++ R D  ++  + S   G   + +VE RL
Sbjct: 347 LVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>Kpol_1010.5 s1010 (13325..14869) [1545 bp, 514 aa] {ON}
           (13325..14869) [1545 nt, 515 aa]
          Length = 514

 Score =  320 bits (821), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 173/414 (41%), Positives = 262/414 (63%), Gaps = 21/414 (5%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIE---LASFAPFKGAA 60
           + Y+L E   GYA+ K          ++ +    I D  +  K+++   +A+F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKAS------DKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAA 54

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
            ALE AN I EG VS  L+ +L+      + K K  TL +S+  L  +I +     + +S
Sbjct: 55  NALEEANSIIEGKVSPQLQKLLE-----EAKKDKKSTLVVSETKLANAINKLGLNFNVVS 109

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           + +  D+ R V+ +   L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIAL
Sbjct: 110 DAVTLDIYRAVKEYLPDLLPGLNDTDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIAL 169

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LD LDK++NT+AMR KEWYGWHFPELAK+V D+ ++A+++L +  ++   +    DL+ +
Sbjct: 170 LDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILAMGVRSKCAD---TDLSEI 226

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           L ++  + +RV   A +SMG +++ETD++N+   A ++   A YR QL +YL  +M  +A
Sbjct: 227 LPEE--VEERVKTAAEVSMGTEITETDLDNIKALADQIVDFAAYREQLSNYLSSRMKAIA 284

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH
Sbjct: 285 PNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYH 344

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSD--EPSNVFGTVLKKQVEQRL 412
           +  + +A+ KNKG+I+R LA K +++ R D  ++  + S   G   + +VE RL
Sbjct: 345 ASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVENRL 398

>SAKL0B05874g Chr2 complement(499332..500873) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12499 Saccharomyces cerevisiae
           YOR310C NOP58 Protein involved in pre-rRNA processing
           18S rRNA synthesis and snoRNA synthesis component of the
           small subunit processome complex which is required for
           processing of pre-18S rRNA
          Length = 513

 Score =  320 bits (821), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 175/414 (42%), Positives = 264/414 (63%), Gaps = 21/414 (5%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIE---LASFAPFKGAA 60
           + Y+L E   GYA+ K   ++    S L      I D  +  K+++   +A+F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKASDKKIYKSSTL------IKDLNSSEKVLKEFKIAAFSKFSSAA 54

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
           +ALE AN I EG VS  L+     NL K +   K  TL +S+  L  +I +     + IS
Sbjct: 55  DALEEANSIIEGKVSTQLE-----NLLKEAKADKKATLVVSETKLANAINKLNLNFNVIS 109

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           + +  D+ R V+ +  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIAL
Sbjct: 110 DAVTLDIYRAVKEYLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIAL 169

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LD LDK++NT+AMR KEWYGWHFPELAK+V D+ ++A+++L +  +++  +    D++ +
Sbjct: 170 LDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGVRSNAAD---TDMSEI 226

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           L ++  I +RV   + +SMG ++++ D++N+   A ++   A YR QL +YL  +M  +A
Sbjct: 227 LPEE--IEERVKSASEVSMGTEITQVDLDNIKCLADQIVDFAAYREQLSNYLSSRMKAIA 284

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNL++L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH
Sbjct: 285 PNLTQLVGELVGARLIAHAGSLISLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYH 344

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSD--EPSNVFGTVLKKQVEQRL 412
           +  + +A+ KNKG+I+R LA K +++ R D  ++  + S   G   + +VE RL
Sbjct: 345 ASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDVGLESRAKVENRL 398

>Suva_8.361 Chr8 complement(637602..637804,637835..639149) [1518 bp,
           505 aa] {ON} YOR310C (REAL)
          Length = 505

 Score =  320 bits (819), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 172/412 (41%), Positives = 263/412 (63%), Gaps = 21/412 (5%)

Query: 6   YLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIE---LASFAPFKGAAEA 62
           Y+L E   GYA+ K          ++ +    I D  +  K+++   +A+F+ F  AA A
Sbjct: 3   YVLTETSAGYALLKAS------DKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAANA 56

Query: 63  LENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCISNE 122
           LE AN I +G VS  L+ +L+        K K  TL +S+  L  +I +     + +S+ 
Sbjct: 57  LEEANSIIDGKVSSQLEKLLE-----EIKKDKKSTLIVSETKLANAINKLGLNFNVVSDA 111

Query: 123 LAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLD 182
           +  D+ R V+ +  +L  G+   DL +  LGL H+  R K+KFS  K D  IIQAIALLD
Sbjct: 112 VTLDIYRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLD 171

Query: 183 QLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAALLN 242
            LDK++NT+AMR KEWYGWHFPELAK+V D+ ++A+++L +  ++  +E    DL+ +L 
Sbjct: 172 DLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASE---TDLSEILP 228

Query: 243 DDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVAPN 302
           ++  I +RV   A +SMG ++++TD++N+   A+++   A YR QL +YL  +M  +APN
Sbjct: 229 EE--IEERVKTAAEVSMGTEITQTDLDNINALAEQIVDFAAYREQLSNYLSARMKAIAPN 286

Query: 303 LSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSG 362
           L++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+ 
Sbjct: 287 LTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHAS 346

Query: 363 FISKASAKNKGRISRYLANKCSMASRIDNYSD--EPSNVFGTVLKKQVEQRL 412
            + +A+ KNKG+I+R LA K +++ R D  ++  + S   G   + +VE RL
Sbjct: 347 LVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>TPHA0G01160 Chr7 (234712..236256) [1545 bp, 514 aa] {ON} Anc_8.787
           YOR310C
          Length = 514

 Score =  319 bits (817), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 173/412 (41%), Positives = 260/412 (63%), Gaps = 21/412 (5%)

Query: 6   YLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIE---LASFAPFKGAAEA 62
           Y+L E   GYA+ K          ++ +    I D     K+++   +A+F+ F  AA A
Sbjct: 3   YVLTETSAGYALLKAS------DKKIYKSTSLIQDLDTSDKVLKEFKIAAFSKFSSAANA 56

Query: 63  LENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCISNE 122
           LE +N I EG VS  L+ +L+        K K  TL +S+  L  SI +     + +S+ 
Sbjct: 57  LEESNAIIEGKVSSQLQKLLE-----DIKKDKKSTLVVSETKLANSINKLGLNFNVVSDA 111

Query: 123 LAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLD 182
           +  D+ R V+ +  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIALLD
Sbjct: 112 VTLDIYRAVKEYLPELLPGLTDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLD 171

Query: 183 QLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAALLN 242
            LDK++NT+AMRVKEWYGWHFPELAK+V D+ ++A+++L +  ++  +E    D++ +L 
Sbjct: 172 DLDKELNTYAMRVKEWYGWHFPELAKIVVDSVAYARIILTMGIRSKASE---TDMSEILP 228

Query: 243 DDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVAPN 302
           ++  I +RV   A +SMG +++  D++N+   A ++   A YR QL +YL  +M  +APN
Sbjct: 229 EE--IEERVKTAAEVSMGTEITPVDLDNIKALADQIVEFAAYREQLSNYLSARMKAIAPN 286

Query: 303 LSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSG 362
           L++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+ 
Sbjct: 287 LTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHAS 346

Query: 363 FISKASAKNKGRISRYLANKCSMASRIDNYSD--EPSNVFGTVLKKQVEQRL 412
            + +A+ KNKG+I+R LA K +++ R D  ++  + S   G   + +VE RL
Sbjct: 347 LVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVENRL 398

>NDAI0E00550 Chr5 (108986..110557) [1572 bp, 523 aa] {ON} Anc_8.787
          Length = 523

 Score =  318 bits (816), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 175/414 (42%), Positives = 262/414 (63%), Gaps = 21/414 (5%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIE---LASFAPFKGAA 60
           + Y+L E   GYA+ K   ++    S L      I D     K+++   +A+F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKASDKKIYKSSSL------IQDLDTSDKVLKEFKIAAFSKFSSAA 54

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
            ALE +N I EG VS  L+ +L+        K K  TL +S+  L  SI +     + +S
Sbjct: 55  NALEESNSIIEGKVSPQLEKLLE-----EIKKDKKSTLIVSETKLANSINKLGLNFNVVS 109

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           + +  D+ R V+ +  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIAL
Sbjct: 110 DAVTLDIYRAVKEYLPELLPGLNDSDLNKMSLGLAHSIGRHKLKFSADKVDVMIIQAIAL 169

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LD LDK++NT+AMR KEWYGWHFPELAK+V D+ ++A+L+L +  ++  +E    D++ +
Sbjct: 170 LDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARLILTMGVRSKASE---TDMSEI 226

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           L ++  I +RV   A +SMG ++++ D++N+   A ++   A YR QL +YL  +M  +A
Sbjct: 227 LPEE--IEERVKTAAEVSMGTEITQIDLDNIKCLADQIVEFAAYREQLSNYLSARMKAIA 284

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH
Sbjct: 285 PNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYH 344

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSD--EPSNVFGTVLKKQVEQRL 412
           +  + +A+ KNKG+I+R LA K +++ R D  ++  + S   G   + +VE RL
Sbjct: 345 ASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVENRL 398

>TPHA0I00650 Chr9 (135050..136672) [1623 bp, 540 aa] {ON} Anc_8.787
           YOR310C
          Length = 540

 Score =  318 bits (816), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 175/417 (41%), Positives = 263/417 (63%), Gaps = 21/417 (5%)

Query: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIE---LASFAPFK 57
           +  + Y+L E   GYA+ K   ++    S L      I D     K+++   +A+F+ F 
Sbjct: 30  LCKMAYVLTETSAGYALLKASDKKIYKSSTL------IQDLDTSDKVLKEFKIAAFSKFS 83

Query: 58  GAAEALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVD 117
            AA ALE +N I EG VS  L+ +L+        K K  TL +S+  L  SI +     +
Sbjct: 84  SAANALEESNAIIEGKVSSQLQKLLE-----DIKKDKKSTLVVSETKLANSINKLGLNFN 138

Query: 118 CISNELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQA 177
            +S+ +  D+ R V+ +  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQA
Sbjct: 139 VVSDAVTLDIYRAVKEYLPELLPGLTDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQA 198

Query: 178 IALLDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDL 237
           IALLD LDK++NT+AMRVKEWYGWHFPELAK+V D+ ++A+++L +  ++  +E    D+
Sbjct: 199 IALLDDLDKELNTYAMRVKEWYGWHFPELAKIVVDSVAYARIILTMGIRSKASET---DM 255

Query: 238 AALLNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMH 297
           + +L ++  I +RV   A +SMG +++  D++N+   A ++   A YR QL +YL  +M 
Sbjct: 256 SEILPEE--IEERVKTAAEVSMGTEITPVDLDNIKALADQIVEFAAYREQLSNYLSARMK 313

Query: 298 TVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGL 357
            +APNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL
Sbjct: 314 AIAPNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGL 373

Query: 358 IYHSGFISKASAKNKGRISRYLANKCSMASRIDNYSD--EPSNVFGTVLKKQVEQRL 412
           +YH+  + +A+ KNKG+I+R LA K +++ R D  ++  + S   G   + +VE RL
Sbjct: 374 LYHASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVESRL 430

>NCAS0B00870 Chr2 complement(133660..135207) [1548 bp, 515 aa] {ON}
           Anc_8.787
          Length = 515

 Score =  318 bits (814), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/416 (42%), Positives = 264/416 (63%), Gaps = 25/416 (6%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIE---LASFAPFKGAA 60
           + Y+L E   GYA+ K   ++    S L      I D     K+++   +A+F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKASDKKIYKSSSL------IQDLDTSDKVLKEFKIAAFSKFNSAA 54

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
            ALE AN I EG VS  L+ +L+        K K  TL +S+  L  +I +     + +S
Sbjct: 55  NALEEANSIIEGKVSPQLEKLLE-----EIKKDKKSTLIVSETKLANAINKLGLNFNVVS 109

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           + +  D+ R V+ +  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIAL
Sbjct: 110 DAVTLDIYRAVKEYLPELLPGLNDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIAL 169

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLF--IKDKASLNEDSLHDLA 238
           LD LDK++NT+AMR KEWYGWHFPELAK+V D+ ++A+++L   I+ KA+   D+  D++
Sbjct: 170 LDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKAA---DT--DMS 224

Query: 239 ALLNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHT 298
            +L ++  I +RV   A +SMG ++++ D+EN+   A ++   A YR QL +YL  +M  
Sbjct: 225 EILPEE--IEERVKTAAEVSMGTEITQLDLENIKCLADQIVEFAAYREQLSNYLSARMKA 282

Query: 299 VAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLI 358
           +APNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+
Sbjct: 283 IAPNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLL 342

Query: 359 YHSGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNV--FGTVLKKQVEQRL 412
           YH+  + +A+ KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 343 YHASLVGQATGKNKGKIARVLAAKAAVSIRYDALAEDRDDAGDIGLESRAKVENRL 398

>KLLA0F08613g Chr6 complement(801623..803158) [1536 bp, 511 aa] {ON}
           similar to uniprot|Q12499 Saccharomyces cerevisiae
           YOR310C NOP58 Protein involved in pre-rRNA processing
           18S rRNA synthesis and snoRNA synthesis component of the
           small subunit processome complex which is required for
           processing of pre-18S rRNA
          Length = 511

 Score =  314 bits (804), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 172/414 (41%), Positives = 260/414 (62%), Gaps = 21/414 (5%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLI---ELASFAPFKGAA 60
           + Y+L E   GYA+ K   ++    S L      I D  +  K++   ++A+F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKASDKKIYKSSSL------IQDLNSSDKVLNQFKIAAFSKFSSAA 54

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
            ALE AN + +G VS  L+ +L+          K  TL +S+  L  +I +     + +S
Sbjct: 55  NALEEANSVIDGKVSSQLEKLLE-----ECKTDKKATLVVSETKLANAINKLGLNFNVVS 109

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           + +  D+ R V+ +  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIAL
Sbjct: 110 DAVTLDIYRAVKEYLPELLPGLNDQDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIAL 169

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LD LDK++NT+AMR KEWYGWHFPELAK+V D+ ++A+++L +  + +  E    D++ +
Sbjct: 170 LDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRVNAAET---DMSEI 226

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           L ++  I +RV   A +SMG +++  D+ N+   A+++   A YR QL +YL  +M  +A
Sbjct: 227 LPEE--IEERVKTAAEVSMGTEITPVDLINIKCLAEQIVEFAAYREQLSNYLSSRMKAIA 284

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH
Sbjct: 285 PNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYH 344

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSD--EPSNVFGTVLKKQVEQRL 412
           +  + +AS KNKG+I+R LA K +++ R D  ++  + S   G   + +VE RL
Sbjct: 345 ASLVGQASGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVESRL 398

>AFR328C Chr6 complement(1032025..1033566) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR310C
           (NOP58)
          Length = 513

 Score =  308 bits (788), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 175/412 (42%), Positives = 267/412 (64%), Gaps = 17/412 (4%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRL-KEVQEQINDFGAFTKLIELASFAPFKGAAEA 62
           + Y+L E   GYA+ K   ++    S L ++++   N    F    ++A+F+ F  AA A
Sbjct: 1   MAYVLTETAAGYALLKASDKKIYKSSSLVQDLKSSENVLKQF----KVAAFSKFASAANA 56

Query: 63  LENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCISNE 122
           LE AN + EG VS  L+ +L     +A S KK+ TL +S+  L  +I +     + + + 
Sbjct: 57  LEEANSVIEGKVSSQLEKLL----AEAKSDKKS-TLVVSETKLANAINKLGLNFNVVCDA 111

Query: 123 LAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLD 182
           +  D+ R V+ +  +L  G+  GDL +  LGL H+  R K+KFS  K D  IIQAIALLD
Sbjct: 112 VTLDIYRAVKEYLPELLPGMTDGDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLD 171

Query: 183 QLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAALLN 242
            LDK++NT+AMR KEWYGWHFPELAK+V D+ +FA+++L +  +++  E    D++ +L 
Sbjct: 172 DLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAET---DMSEILP 228

Query: 243 DDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVAPN 302
           ++  I +RV   A +SMG ++++ D++N+   A+++   A YR QL +YL  +M  +APN
Sbjct: 229 EE--IEERVKSAAEVSMGTEITQVDLDNIKSLAEQIVEFAAYREQLSNYLSSRMKAIAPN 286

Query: 303 LSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSG 362
           L++L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+ 
Sbjct: 287 LTQLVGELVGARLIAHAGSLVSLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHAS 346

Query: 363 FISKASAKNKGRISRYLANKCSMASRIDNYSD--EPSNVFGTVLKKQVEQRL 412
            + +A+ KNKG+I+R LA K +++ R D  ++  + S   G   + +VE RL
Sbjct: 347 LVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVESRL 398

>Kwal_34.15894 s34 (102368..103906) [1539 bp, 512 aa] {ON} YOR310C
           (NOP58) - 57 kDa nucleolar protein [contig 272] FULL
          Length = 512

 Score =  307 bits (787), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 178/411 (43%), Positives = 262/411 (63%), Gaps = 15/411 (3%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAAEAL 63
           + Y+L E   GYA+ K   ++    S L  +Q+ +N      K  ++A+F+ F  AAEAL
Sbjct: 1   MAYVLTETSAGYALLKASDKKIYKSSSL--IQD-LNSSDKVLKQFKIAAFSKFGSAAEAL 57

Query: 64  ENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCISNEL 123
           E AN I EG VS  L+ +L       S   K  TL +S+  L  +I +     + +S+ +
Sbjct: 58  EEANAIVEGKVSNQLQKLLS-----ESKADKKATLVVSETKLANAINKLGLNFNVVSDAV 112

Query: 124 AQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQ 183
             D+ R V+ +  +L  G+   DL +  LGL H+  R K+KFS  K D  IIQAIALLD 
Sbjct: 113 TLDIFRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDD 172

Query: 184 LDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAALLND 243
           LDK++NT+AMR KEWYGWHFPELAK+V D+ +FA+++L +  +++  E    DL+ +L +
Sbjct: 173 LDKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAET---DLSEILPE 229

Query: 244 DSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVAPNL 303
           +  I +RV   A ISMG +++  D++N+   A ++   A YR QL +YL  +M  +APNL
Sbjct: 230 E--IEERVKSAAEISMGTEITSVDLDNIKSLATQITEFAAYREQLSNYLSARMKAIAPNL 287

Query: 304 SELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGF 363
           ++L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  
Sbjct: 288 TQLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASL 347

Query: 364 ISKASAKNKGRISRYLANKCSMASRIDNYSD--EPSNVFGTVLKKQVEQRL 412
           + +A+ KNKG+I+R LA K +++ R D  ++  + S   G   + +VE RL
Sbjct: 348 VGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRSKVESRL 398

>Ecym_1489 Chr1 complement(1006523..1008067) [1545 bp, 514 aa] {ON}
           similar to Ashbya gossypii AFR328C
          Length = 514

 Score =  306 bits (785), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 176/414 (42%), Positives = 263/414 (63%), Gaps = 21/414 (5%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGA---FTKLIELASFAPFKGAA 60
           + Y+L E   GYA+ K          ++ +    IND  +     K  ++A+F+ F  AA
Sbjct: 1   MAYVLTETAAGYALLKAS------DKKIYKSATLINDLKSSESVLKQFKIAAFSKFSSAA 54

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
            ALE AN + EG VS  L+ +LD    +A + KK  TL +S+  LG +I +     + + 
Sbjct: 55  NALEEANAVIEGKVSSQLQKLLD----EAKTDKKA-TLVVSETKLGNAINKLGLNFNVVC 109

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           + +  D+ R V+ +  +L  GL   DL +  LGL H+  R K+KFS  K D  IIQAIAL
Sbjct: 110 DAVTLDIYRAVKEYLPELLPGLSGDDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIAL 169

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LD LDK++NT+AMR KEWYGWHFPELAK+V D+ +FA+++L +  +++  +    DL+ +
Sbjct: 170 LDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAD---TDLSEV 226

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           L ++  + +RV   A +SMG +++  D++N+   A+++   A YR QL  YL  +M  +A
Sbjct: 227 LPEE--VEERVKAAAEVSMGTEITPIDLDNIKCLAEQIVEFAAYREQLSSYLSSRMKAIA 284

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNL+ L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH
Sbjct: 285 PNLTNLVGELVGARLIAHAGSLISLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYH 344

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSD--EPSNVFGTVLKKQVEQRL 412
           +  + +A+ KNKG+I+R LA K +++ R D  ++  + S  FG   + +VE RL
Sbjct: 345 ASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGEFGLESRAKVENRL 398

>CAGL0I09790g Chr9 complement(935016..936557) [1542 bp, 513 aa] {ON}
           highly similar to uniprot|Q12499 Saccharomyces
           cerevisiae YOR310c
          Length = 513

 Score =  303 bits (777), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 176/414 (42%), Positives = 262/414 (63%), Gaps = 21/414 (5%)

Query: 4   IEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIE---LASFAPFKGAA 60
           + Y+L E   GYA+ K   ++    S L      I D  +  K+++   +A+F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKASDKKIYKSSSL------IMDLDSSEKVLKEFKIAAFSKFNSAA 54

Query: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120
            ALE A+ I EG VS  L+ +LD        K+K  TL +S+  L  +I +     + +S
Sbjct: 55  NALEEASAIIEGKVSPQLEKLLD-----EIKKEKKATLIVSETKLANAINKLGLNFNVVS 109

Query: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180
           + +  D+ R V+ +   L  G+   DL +  LGL H+  R K+KFS  K D  IIQAIAL
Sbjct: 110 DAVTLDIYRAVKEYLPDLLPGMSDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIAL 169

Query: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240
           LD LDK+VNT++MR KEWYGWHFPELAK+V D+ ++A+L+L +  ++   E    D++ +
Sbjct: 170 LDDLDKEVNTYSMRCKEWYGWHFPELAKIVTDSVAYARLILTMGVRSKAAET---DMSEI 226

Query: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300
           L ++  I +RV   A +SMG ++++ D+ N+   A ++   A YR QL +YL  +M  +A
Sbjct: 227 LPEE--IEERVKAAAEVSMGTEITDVDLINIRALADQIVEFAAYREQLSNYLSSRMKAIA 284

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360
           PNL++L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH
Sbjct: 285 PNLTQLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYH 344

Query: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSD--EPSNVFGTVLKKQVEQRL 412
           +  + +AS +NKG+I+R LA K ++A R D  ++  + S   G  ++ +VE RL
Sbjct: 345 ASLVGQASGRNKGKIARVLAAKAAVALRYDALAEDRDDSGDIGLEVRAKVENRL 398

>KNAG0B01140 Chr2 complement(210529..212007) [1479 bp, 492 aa] {ON}
           Anc_3.429 YGR091W
          Length = 492

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 102/211 (48%), Gaps = 8/211 (3%)

Query: 186 KDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDL---AALLN 242
           +D+      +   Y   F EL  L+P+  ++A +V  ++     N + L  +     LL 
Sbjct: 132 RDIENLHTFMIMQYRKKFLELDSLLPNPVNYADVVFVLETMQDRNSNELATIFESELLLK 191

Query: 243 DDSGIAQRVIDNARISMGQDLSETDMENVCIFAQR--VASLADYRRQLYDYLCEKMHTVA 300
            +  +   +  + + S+ QD++   +  + +F  R  +  L+D+R ++   +  K+H +A
Sbjct: 192 KEQTLVLTL--SIKTSLRQDVTLEKLIQIRLFRARAMIRQLSDHRERIVKLVESKIHIIA 249

Query: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLIY 359
           PNL+ L+G    + L+ HAGS+  LS   +  +  +G ++ L   L T      + G IY
Sbjct: 250 PNLTALVGAETCSYLVGHAGSVVALSLIPSCNLSSIGKKRHLSHELHTNISGVRQEGAIY 309

Query: 360 HSGFISKASAKNKGRISRYLANKCSMASRID 390
           H   + +    ++ ++ R +  K S+A+R+D
Sbjct: 310 HCALVREQPVTHRKQMLRMVCAKVSLAARVD 340

>TPHA0D03930 Chr4 (823320..824735) [1416 bp, 471 aa] {ON} Anc_3.429
           YGR091W
          Length = 471

 Score = 73.2 bits (178), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 113/234 (48%), Gaps = 17/234 (7%)

Query: 171 DNHIIQAIALLDQLDKDV-----NTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKD 225
           +N I++  ++L++  K +     N FA  +K  Y   FPEL  L+ +   F +++  +++
Sbjct: 90  ENGIVEVASILNKYSKIIQEESSNVFAY-IKILYKPRFPELETLLTNPIDFIEVLKLLEE 148

Query: 226 KASLNEDSLHD-LAALLNDDSGIAQR----VIDNARISMGQDL--SETDMENVCIFAQRV 278
             ++ E S  D +A LL ++S I+      VI + +         +E     +    + +
Sbjct: 149 --NITEISNDDYIATLLENESNISSEKRLVVIMSIKTCFNSSFIFTEDARGKLSSVLELL 206

Query: 279 ASLADYRRQLYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGA 338
             L + + +   YL  K+ T+APNLS LIG  I + LISH GS+  LSK  +  +  +G 
Sbjct: 207 NILMNSKTEAVQYLSSKIGTIAPNLSTLIGTSIASLLISHTGSILELSKVPSCNLASIGK 266

Query: 339 EKALFRA--LKTKGNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID 390
           +K    A  + +     + G IY+S  I         ++ R L  K S+A+R+D
Sbjct: 267 KKYSSSAQHITSVSGVRQEGYIYNSELIQNMPISTHKQLLRMLCAKVSLAARVD 320

>TDEL0F03110 Chr6 (568933..570237) [1305 bp, 434 aa] {ON} Anc_3.429
           YGR091W
          Length = 434

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 104/224 (46%), Gaps = 9/224 (4%)

Query: 195 VKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAALLNDDSGIAQRVIDN 254
            K  Y   F EL  LVPD   + +++  I++    + +     A L  +   +   ++ +
Sbjct: 92  TKILYRQRFAELESLVPDPVKYVEVISIIEEDEQASSERFERDAKLSKEQILV---LMMS 148

Query: 255 ARISMGQDLSETDMENVCIFAQRVASLA--DYRRQLYDYLCEKMHTVAPNLSELIGEVIG 312
            + S+ Q+   TD E   +   R   LA    R ++  Y+ +++  +APNL  LIG  I 
Sbjct: 149 MKTSIRQERQITDGERAVLLRARSYMLAIVSVRDKVNGYVVQRVSHIAPNLCALIGPEIT 208

Query: 313 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLIYHSGFISKASAKN 371
           + L+SH G +  LS+  +  +  +G  K L   L T      + G IY S  +     + 
Sbjct: 209 SLLLSHFGGILELSQAPSCNLASIGKNKHLTHELHTSLTGVRQEGYIYRSQLVQDQPPQY 268

Query: 372 KGRISRYLANKCSMASRID---NYSDEPSNVFGTVLKKQVEQRL 412
             ++ R +  K S+A+R+D   N S E  ++ G   ++++ +++
Sbjct: 269 HKQMLRMVCAKISLAARVDAGINSSQESDSLLGDKWRREIMEKV 312

>TBLA0C02320 Chr3 complement(549057..550592) [1536 bp, 511 aa] {ON}
           Anc_3.429 YGR091W
          Length = 511

 Score = 69.3 bits (168), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 101/214 (47%), Gaps = 7/214 (3%)

Query: 184 LDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAALLND 243
           +++D+      VK  Y   FPEL  L+ +   F  ++  ++   + N++    L   L  
Sbjct: 133 INEDIKLLHSYVKANYQKRFPELESLITNPIQFIDVIRLLESLNNPNKNEESQLEIRLEK 192

Query: 244 DSGIAQR----VIDNARISMGQD--LSETDMENVCIFAQRVASLADYRRQLYDYLCEKMH 297
           ++ + +     +I + + S  ++   S T   N+   +  ++ L  ++ ++  ++ +K+ 
Sbjct: 193 ETTLQKEQILVIIMSVKTSFNKEYQFSNTLRNNLIKASNLISQLWQFKEEINSFVTKKIS 252

Query: 298 TVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYG 356
            +APNL  LIG  I + L++++G L NL    +  +  +G  K L   L +      + G
Sbjct: 253 DIAPNLCALIGPYITSLLVAYSGGLANLCSVPSCNLASIGKNKHLSHELHSNLSGVRQNG 312

Query: 357 LIYHSGFISKASAKNKGRISRYLANKCSMASRID 390
            +Y+S  I    A    ++ R L  K ++ASR+D
Sbjct: 313 YLYNSELIQSQPANLHKQLLRILCAKVALASRVD 346

>Kwal_23.3995 s23 complement(517426..518850) [1425 bp, 474 aa] {ON}
           YGR091W (PRP31) - pre-mRNA splicing protein [contig 255]
           FULL
          Length = 474

 Score = 68.9 bits (167), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 96/215 (44%), Gaps = 2/215 (0%)

Query: 199 YGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAALLNDDSGIAQRVIDNARIS 258
           Y   FPEL  L+     +A++V  + + + +NE +L  L  +++ +  +   +  +    
Sbjct: 111 YERRFPELQSLMTSPKGYAQVVKHL-ETSDINEGNLRGLEDIISKEHFLVLSMAMHTGFK 169

Query: 259 MGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVAPNLSELIGEVIGARLISH 318
               L+  D   V   A  +  L D R ++  Y+   +  VAPNL  L+G  I A LI+ 
Sbjct: 170 QDVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPNLCILVGSQIAASLIAV 229

Query: 319 AGSLTNLSKQAASTVQILGAEKALFRALKTKGN-TPKYGLIYHSGFISKASAKNKGRISR 377
           AG L+ LS+  +  +  +G  K       T  +   + G IY S  +S      + +  R
Sbjct: 230 AGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQSDLVSGQPVSFQKQALR 289

Query: 378 YLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRL 412
            +  K S+ +R D     PS   G   K+QV ++L
Sbjct: 290 MVCAKVSLCARADRSKSCPSGTLGAKWKEQVLEKL 324

>ADR032W Chr4 (763161..764480) [1320 bp, 439 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR091W (PRP31)
          Length = 439

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 97/203 (47%), Gaps = 26/203 (12%)

Query: 203 FPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAALLNDDSGIAQRVIDNARISMGQD 262
           FPELA+LVP   ++ +++  ++  A L+E    + A L+      A R  D AR      
Sbjct: 93  FPELAELVPSQRTYVRVLRALETGAPLDELLTREQAMLVAMTRPQAPRA-DPAR------ 145

Query: 263 LSETDMENVCIFAQRVASLADYRRQLYD-------YLCEKMHTVAPNLSELIGEVIGARL 315
                      + + +A  AD   QL+        ++  + H +AP ++ L+G V+ A L
Sbjct: 146 -----------WPRELAPHADRHEQLHTAVDAIDAHIVRQAHRLAPTVTALVGPVVAAAL 194

Query: 316 ISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKY-GLIYHSGFISKASAKNKGR 374
           +SHAGS+  L++  A  +  +GA +    A +T  +  +  G ++ +  + +     + +
Sbjct: 195 LSHAGSVRELAQVPACNLAAIGAPRHAAHARRTDASGVRLRGHVWDTPLVQEQPPALQRQ 254

Query: 375 ISRYLANKCSMASRIDNYSDEPS 397
             R L  + ++A+R+D  + +P+
Sbjct: 255 ALRMLCARLALAARVDASAPDPA 277

>ZYRO0C12386g Chr3 (978158..979492) [1335 bp, 444 aa] {ON} similar
           to uniprot|P49704 Saccharomyces cerevisiae YGR091W PRP31
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 444

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 101/226 (44%), Gaps = 13/226 (5%)

Query: 170 NDNHIIQAIALLDQL----DKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKD 225
           ND  + Q + +L+ L      ++      +K  YG  F EL  LVP    FA ++  I+ 
Sbjct: 73  NDEDLAQTLTILNSLTYIAQNEITVLHNLLKLIYGVKFGELESLVPQPQQFADVIRIIET 132

Query: 226 KASLNEDSLHDLAALLNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYR 285
               NE +    A L    S     V++ +  S  Q     D + V      + +++  R
Sbjct: 133 ----NEGNFETDAQL----SKEQVLVLNMSMKSSFQAHVNVDKDKVLQLRDLLMTVSRIR 184

Query: 286 RQLYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRA 345
            ++  ++  K   VAPNL  LIG  + + L+SH+G +  LS+  +  +  +G  K L   
Sbjct: 185 NEINSFILSKASLVAPNLCLLIGPEVTSLLLSHSGGVLELSQVPSCNLASIGKNKHLSHE 244

Query: 346 LKTK-GNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID 390
           L T      + G IY S  + +   + + ++ R +  K ++A+R+D
Sbjct: 245 LHTNLTGVRQEGYIYRSSLVQEQPLEFRKQMLRMVCAKVALAARVD 290

>KAFR0K01530 Chr11 (319205..320725) [1521 bp, 506 aa] {ON} Anc_3.429
           YGR091W
          Length = 506

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 106/224 (47%), Gaps = 14/224 (6%)

Query: 178 IALLDQLDKDVNTFAMRVKEW----YGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDS 233
           +  L+Q+  ++ T    + E+    Y   F EL  L+     ++ ++  ++      E S
Sbjct: 107 LPYLNQISLNLRTETANLHEYLKLSYSARFSELESLIATATQYSNVIYVLETSEKDTEGS 166

Query: 234 LHDLAALLNDDSGIAQRVIDNARISMGQDLSET-----DMENVCIFAQR-VASLADYRRQ 287
           L      L   + +++  I    +SM    +E+     +++   + A+  + +L + R  
Sbjct: 167 L---VTSLEQVAQLSKEQILVLMMSMKTSFNESTPLPLEIKQRLLRAREMIITLDELRHT 223

Query: 288 LYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALK 347
           +  Y+  K++ +APNL  L+G  I A L+SHAG +  LS+     +  +G +K L   L 
Sbjct: 224 IASYISSKVYHIAPNLCALLGSEITALLVSHAGDILQLSQVPNCNLASIGKKKHLSHELH 283

Query: 348 TKGN-TPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID 390
           T  +   + G IY+S  + +    ++ ++ R L  K ++A+R+D
Sbjct: 284 TTASGVRQEGYIYNSELVQETPVGSRKQMLRMLCAKVALAARVD 327

>NDAI0G01290 Chr7 complement(284145..285635) [1491 bp, 496 aa] {ON}
           Anc_3.429 YGR091W
          Length = 496

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 85/196 (43%), Gaps = 4/196 (2%)

Query: 199 YGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDL---AALLNDDSGIAQRVIDNA 255
           Y   F EL  +      +A++V   +    L+   L++L    A L  +  I   +   +
Sbjct: 131 YSKKFNELDTITSSQLQYARIVKIFESHQDLSSGELNNLFENEAKLTKEQIIVLNISMKS 190

Query: 256 RISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVAPNLSELIGEVIGARL 315
              +   L     + +      + +L+  +  +  Y+   +  +APNL  LIG  I A L
Sbjct: 191 SFDISFKLDHQKQKEILKSTDMITTLSALQELITHYITSNISHIAPNLCALIGSQIAALL 250

Query: 316 ISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLIYHSGFISKASAKNKGR 374
           ISHAGS+ +LS+  +  +  +G  K     L T      + G IY    I    ++N  +
Sbjct: 251 ISHAGSILDLSQIPSCNLASIGKSKHQSHELHTSLSGVRQEGYIYDCDLIQDQPSENHKQ 310

Query: 375 ISRYLANKCSMASRID 390
           + R +  K S+A+R+D
Sbjct: 311 MLRMVCAKASLAARVD 326

>YGR091W Chr7 (666341..667825) [1485 bp, 494 aa] {ON}  PRP31Splicing
           factor, component of the U4/U6-U5 snRNP complex
          Length = 494

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 93/200 (46%), Gaps = 10/200 (5%)

Query: 199 YGWHFPELAKLVPDNYSFAKLVLFIKDKA-SLNEDSLHDLAALLNDDSGIAQRVIDNARI 257
           Y   FPEL+ L+P    ++K++  ++++  S NE    +L   L + + + +  I    +
Sbjct: 120 YSRRFPELSSLIPSPLQYSKVISILENENYSKNESD--ELFFHLENKAKLTREQILVLTM 177

Query: 258 SMGQDLSETDMENVCIFAQRVAS------LADYRRQLYDYLCEKMHTVAPNLSELIGEVI 311
           SM       +  ++    Q + +      L   +  +  Y+  K+  +APN+  L+G  I
Sbjct: 178 SMKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEI 237

Query: 312 GARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFISKASAK 370
            A+LI+HAG +   S+  +  +  +G  K L   L T +    + G ++ S  I K    
Sbjct: 238 AAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPVS 297

Query: 371 NKGRISRYLANKCSMASRID 390
              ++ R L  K S+A+R+D
Sbjct: 298 VHKQMLRMLCAKVSLAARVD 317

>Kpol_1018.138 s1018 complement(368322..369803) [1482 bp, 493 aa]
           {ON} complement(368322..369803) [1482 nt, 494 aa]
          Length = 493

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/245 (23%), Positives = 112/245 (45%), Gaps = 21/245 (8%)

Query: 184 LDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAA---- 239
           + ++++ F    K  Y + F EL  L P    FAK +  I+   ++++ S HDL +    
Sbjct: 124 IQEEISCFYEYSKHIYKFKFFELETLAPTAVQFAKTIQLIE---TMDDFSQHDLLSSKLE 180

Query: 240 ---LLNDDSGIAQRVIDNARISMGQDLS-ETDME-NVCIFAQRVASLADYRRQLYDYLCE 294
              LL  +  +   +I   + S+ ++ S E  M+ ++  F   +      ++++  ++  
Sbjct: 181 TEILLTKEQVLV--LIIAMKTSLNKEYSFEGSMKTSLKQFTDIIIQHDLLKKEITTFIES 238

Query: 295 KMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTP 353
            + T+APNL  L+G  I + LI HAG +  LS+  +  +  +G  K      +T      
Sbjct: 239 NIITIAPNLCALVGSEITSLLIGHAGGILELSQIPSCNLASVGKNKYFSHERQTNLSGVR 298

Query: 354 KYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID------NYSDEPSNVFGTVLKKQ 407
           + G IY+S  I         ++ R L  K S+A+R+D        S EP+   G   +++
Sbjct: 299 QEGYIYNSELIQSQPVDYHKQLLRMLCAKISLAARVDTSVKISTSSTEPAAFLGQKWREE 358

Query: 408 VEQRL 412
           +  ++
Sbjct: 359 IVTKI 363

>Skud_7.390 Chr7 (650643..652130) [1488 bp, 495 aa] {ON} YGR091W
           (REAL)
          Length = 495

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 94/200 (47%), Gaps = 10/200 (5%)

Query: 199 YGWHFPELAKLVPDNYSFAKLVLFIK-DKASLNEDSLHDLAALLNDDSGIAQRVIDNARI 257
           YG  FPEL+ L+P +  ++K+   ++ +  S NE     L+ LL +++ + +  +    +
Sbjct: 121 YGKRFPELSSLIPSSLQYSKVASILESEHWSKNESD--KLSPLLENEANLTKEQVLVLTM 178

Query: 258 SMGQDLSETDMENVCIFAQ------RVASLADYRRQLYDYLCEKMHTVAPNLSELIGEVI 311
           SM    +  +  ++    Q       + +L   +  +  Y+  K+  +APN+  L+G  +
Sbjct: 179 SMKTSFNNKEPLDIGTRKQISEATAMLKNLWVLQEDVGRYVASKISVIAPNMCLLVGPEV 238

Query: 312 GARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFISKASAK 370
            A+L+++AG +   S+  +  +  +G  K L   L T      + G I+ +  I      
Sbjct: 239 AAQLLAYAGGVLEFSRIPSCNIASIGKNKHLSHELHTLASGVRQEGYIFSTDLIQNFPLA 298

Query: 371 NKGRISRYLANKCSMASRID 390
              ++ R +  K ++A+R+D
Sbjct: 299 IHKQMLRMICAKVTLAARVD 318

>NCAS0E01160 Chr5 complement(219669..221108) [1440 bp, 479 aa] {ON}
           Anc_3.429 YGR091W
          Length = 479

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/218 (21%), Positives = 97/218 (44%), Gaps = 10/218 (4%)

Query: 180 LLDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAA 239
           L  Q+ ++++      K  Y   F EL  +    Y +AK+   I+  +   +D    L  
Sbjct: 118 LSHQIRREIDILYQYSKNIYSTRFTELDTIAATPYQYAKVTSLIEGTS---DDKAGQLPI 174

Query: 240 LLNDDSGIAQRVIDNARISMGQDLS-----ETDMENVCIFA-QRVASLADYRRQLYDYLC 293
            +  ++ +++  +   R+SM          E  ++++ + A   +  L D +  +  Y+ 
Sbjct: 175 NIEIEAKLSKEQVLVLRMSMQTSFLKNKPLEKKVKHLLLEACSMIIQLTDLQNVILQYIS 234

Query: 294 EKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNT 352
             +  +APNL  L+G  + + LI+H G +  L++  +  +  +G  + L   L T     
Sbjct: 235 SNVSDIAPNLCVLVGPEVASLLIAHTGGILQLAEIPSCNLASIGKNRHLSHELHTTLSGV 294

Query: 353 PKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID 390
            + G IY S  +     +N  ++ R +  K ++A+R+D
Sbjct: 295 RQEGYIYSSELVQNQPIQNHKQMLRMVCAKVALAARVD 332

>Ecym_4449 Chr4 complement(919492..920880) [1389 bp, 462 aa] {ON}
           similar to Ashbya gossypii ADR032W
          Length = 462

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 93/208 (44%), Gaps = 14/208 (6%)

Query: 199 YGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAALLNDDSGIAQRVIDNARIS 258
           Y   FPEL  +V +   +  +V  ++ +  + E     L  LLN +    Q ++ +  + 
Sbjct: 101 YNKRFPELPNVVSEQEKYVSVVKELEARPDVPE-----LGKLLNKE----QMLLVSMTMQ 151

Query: 259 MG-QDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVAPNLSELIGEVIGARLIS 317
            G     + D   +     +   L   +  +  Y+ +KMHT+APN+  L+G+ + A L++
Sbjct: 152 TGFHKEYKVDSPVIAELIDQYEVLHALKSDITTYISKKMHTIAPNVCALVGQEVAAALLT 211

Query: 318 HAGSLTNLSKQAASTVQILGAEKAL--FRALKTKGNTPKYGLIYHSGFISKASAKNKGRI 375
           + G +  LS+  +  +  +G  K L   + L T G   K G I+    +       + + 
Sbjct: 212 YTGGMKELSEIPSCNLASIGKTKHLSHVQQLDTSGVRQK-GYIFDCELVQSQPEALQKQA 270

Query: 376 SRYLANKCSMASRIDNYSDEPSNVFGTV 403
            R +  K ++ASR+D Y     N  G++
Sbjct: 271 LRMICAKLALASRVD-YLHHQENTHGSL 297

>Smik_6.177 Chr6 (289760..291208) [1449 bp, 482 aa] {ON} YGR091W
           (REAL)
          Length = 482

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 41/199 (20%), Positives = 90/199 (45%), Gaps = 8/199 (4%)

Query: 199 YGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAALLNDDSGIAQRVIDNARIS 258
           Y   FPEL+ L+P    ++K+++ ++ +    +  +  L   L + + +++  +    +S
Sbjct: 120 YKERFPELSTLIPSPLQYSKVIILLEGE-DWQKSEIDKLFPQLENIAHLSKEQVLVLTMS 178

Query: 259 MGQDLSETDMENVCIFAQRVAS------LADYRRQLYDYLCEKMHTVAPNLSELIGEVIG 312
           M       +  N     Q + +      L   +  L  Y+  K+  +APN+  L+G  + 
Sbjct: 179 MRTSFKSKEPLNFQTRTQILETNTILENLWQIQADLEQYIASKISLIAPNMCFLVGSEVT 238

Query: 313 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFISKASAKN 371
           A+L+++AG +   S+  +  +  +G  K L   L T +    + G ++ +  I       
Sbjct: 239 AQLLAYAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFTTDLIQSFPVAI 298

Query: 372 KGRISRYLANKCSMASRID 390
             ++ R L  K ++A+R+D
Sbjct: 299 HKQMLRMLCAKVTLAARVD 317

>Suva_7.374 Chr7 (641967..643508) [1542 bp, 513 aa] {ON} YGR091W
           (REAL)
          Length = 513

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/199 (21%), Positives = 95/199 (47%), Gaps = 8/199 (4%)

Query: 199 YGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAALLNDDSGIAQRVIDNARIS 258
           Y   FPEL+ L+P    ++K+V  ++++     +S   L+  L + + + +  +    +S
Sbjct: 139 YKERFPELSSLIPSPLQYSKVVTILENENWSGNES-DKLSIHLENKANLTKEQLLVLTMS 197

Query: 259 MGQDLSET-----DMENVCIFA-QRVASLADYRRQLYDYLCEKMHTVAPNLSELIGEVIG 312
           +    +       D + +   A   + +L + ++ +  Y+  K+  +APN+  L+G  + 
Sbjct: 198 LKTSFNNQKPLVGDTKKLVFEAGSMLNNLWELQKDVGQYITSKISLIAPNMCFLVGSEVT 257

Query: 313 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFISKASAKN 371
           A+L++HAG +   S+  +  +  +G  K L   L T +    + G ++++  I       
Sbjct: 258 AQLLAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFNTELIQDFPIAI 317

Query: 372 KGRISRYLANKCSMASRID 390
             ++ R L  K ++A+R+D
Sbjct: 318 HRQMLRILCAKVTLAARVD 336

>SAKL0F06050g Chr6 (454404..455825) [1422 bp, 473 aa] {ON} similar
           to uniprot|P49704 Saccharomyces cerevisiae YGR091W PRP31
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 473

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/223 (21%), Positives = 101/223 (45%), Gaps = 13/223 (5%)

Query: 195 VKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAALLNDDSGIAQRVIDN 254
           +K  Y   F EL  LV    S++KL+ F++   + +   L  L  +L+ +    Q +I +
Sbjct: 113 IKSLYSKKFSELDSLVNPPRSYSKLIKFLETSDARD---LSTLEGILSKE----QILIVS 165

Query: 255 ARISMG--QDLSETDMENVCIFA--QRVASLADYRRQLYDYLCEKMHTVAPNLSELIGEV 310
             +  G  +DL+    E   +      +  L D + ++  ++  ++  +APN+  ++G  
Sbjct: 166 MSMKTGFKRDLALPSDEKTYLLTAIDMLIQLYDLQDEITSFIASQVINIAPNVCAIVGPQ 225

Query: 311 IGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLIYHSGFISKASA 369
           + ++++S AG L  LS+  +  +  +G ++ +   + T      + G +Y    I     
Sbjct: 226 VASKILSAAGGLLELSQVPSCNLASIGKDRYMSHEINTDMSGVRQRGYVYSCSLIQDQPP 285

Query: 370 KNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRL 412
               +  R +  K S+A+R+D  S+   N  G     ++ ++L
Sbjct: 286 HVHKQALRMVCAKVSLAARVD-ISNNKDNSLGVKWANEISEKL 327

>KLTH0F12034g Chr6 complement(1015072..1016646) [1575 bp, 524 aa]
           {ON} weakly similar to uniprot|P49704 Saccharomyces
           cerevisiae YGR091W PRP31 Splicing factor component of
           the U4/U6-U5 snRNP complex
          Length = 524

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 99/230 (43%), Gaps = 2/230 (0%)

Query: 184 LDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAALLND 243
           + ++V+     +   Y   FPEL  L+    S+AK+V  ++ K    +  L +L   ++ 
Sbjct: 139 IQQEVSLLRKLIASIYDQKFPELESLIASANSYAKVVRLLETKGG-GKLELQELQDTISR 197

Query: 244 DSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVAPNL 303
           +  +   +  +       +L+  D E +      +  L D +  +  Y+   +  VAPNL
Sbjct: 198 EQLLVLSMAMHTGFRQETNLAPKDSELLMDSINVLLELCDLQDSIAQYVASLISQVAPNL 257

Query: 304 SELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALK-TKGNTPKYGLIYHSG 362
             L+G    A LI+ AG L  LS+  +  +  +G  K +   L   +    + G IYHS 
Sbjct: 258 CALVGPATSAALIAAAGGLLELSEMPSCNLASIGNSKRISSELDFHESGVRQRGHIYHSS 317

Query: 363 FISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRL 412
            +S      + +  R +  K S+  R+D   + P    G   ++ V +RL
Sbjct: 318 LVSGQPVTIQKQALRMVCAKVSLCVRVDVSKNSPGGELGLKWRQDVLKRL 367

>KLLA0D14883g Chr4 (1254381..1255784) [1404 bp, 467 aa] {ON} weakly
           similar to uniprot|P49704 Saccharomyces cerevisiae
           YGR091W PRP31 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 467

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 100/220 (45%), Gaps = 12/220 (5%)

Query: 173 HIIQAIALLDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLV-LFIKDKASLNE 231
           ++I+   L+   D +++     + + Y   FP L  +VP+   +  +V +  +D  ++  
Sbjct: 88  NVIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQQDIPNVQL 147

Query: 232 DSLHDLAALLNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDY 291
           D +      L     +     + ARI       + D+ +  I    +  L + R  +  Y
Sbjct: 148 DQVLSKEETLVVSMSLKTDFKEGARI-------DKDLLSKAIHWFDI--LYNLRDNVSHY 198

Query: 292 LCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALF-RALKTKG 350
           +  ++  VAPNL  L+G    A+L++H GS+  LS   +  +  +G +K L  ++L   G
Sbjct: 199 VETRIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTLHGKSLDISG 258

Query: 351 NTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID 390
              K G ++++  +     + + +  R ++ K ++A+R D
Sbjct: 259 VRQK-GYLFYTDVVQTQPPEFQKQALRMVSAKVALAARAD 297

>CAGL0G03025g Chr7 (280230..281669) [1440 bp, 479 aa] {ON} similar
           to uniprot|P49704 Saccharomyces cerevisiae YGR091w PRP31
           pre-mRNA splicing protein
          Length = 479

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 62/124 (50%), Gaps = 4/124 (3%)

Query: 292 LCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGN 351
           +  ++  +APNL  L+G    + L+SH G L  LSK  +  +  +G +      +    N
Sbjct: 229 IANRIGEIAPNLCALLGTNTASLLVSHTGGLLQLSKIPSCNIANIGKKNTKDHNILNFSN 288

Query: 352 TPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRIDN--YSDEPSNVFGTVLKKQVE 409
               G I+ +  +     +N  ++ R L++K S+A+R+D    + + +N  G   + ++E
Sbjct: 289 PG--GYIFQNELVQNQPIENHKQMMRMLSSKVSLAARVDAGLKTGDKNNKLGKQWRVEIE 346

Query: 410 QRLE 413
           ++++
Sbjct: 347 EKIK 350

>KNAG0G01800 Chr7 (396618..401048) [4431 bp, 1476 aa] {ON} Anc_8.228
           YER164W
          Length = 1476

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 41/90 (45%), Gaps = 13/90 (14%)

Query: 194 RVKEWYGWHFPELAKLVPDNYSFAK-LVLFIK--DKASLNE-----DSLHDLAALLNDDS 245
           R+KE Y    PEL K VP  +   +  V FIK  D++ L+      DSL     L   D+
Sbjct: 189 RIKEQYNEQKPELNKQVPSLHDCKQYYVFFIKWADQSHLHNSWESYDSLSQTRGLKRLDN 248

Query: 246 GIAQRVIDNARISM-----GQDLSETDMEN 270
              Q +I   +  +     G+DL   DMEN
Sbjct: 249 YCKQFIIQEQQFRLDPYITGEDLELMDMEN 278

>Kpol_1058.41 s1058 complement(116385..117569) [1185 bp, 394 aa]
           {ON} complement(116385..117569) [1185 nt, 395 aa]
          Length = 394

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 88  KASSKKKNITLAISDKNLGPSIKEQFPYVDCISNELAQDLI 128
           K S++  NI+LA S  ++ PS+K+Q  Y+  +SN L+Q  +
Sbjct: 152 KNSNQGSNISLASSITDIQPSVKQQQ-YISTMSNNLSQPFV 191

>YNL172W Chr14 (310636..315882) [5247 bp, 1748 aa] {ON}  APC1Largest
           subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; component of the platform domain of the
           APC/C, based on structural analysis
          Length = 1748

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 69  ISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPY 115
           +SEG   E  KA L     K +S  KNI+  ++ +N  PS+++ FPY
Sbjct: 478 VSEGQNKEEYKACLYDPFVKITSPSKNISEELTKQNSLPSLQKLFPY 524

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,993,727
Number of extensions: 1842031
Number of successful extensions: 5860
Number of sequences better than 10.0: 71
Number of HSP's gapped: 5982
Number of HSP's successfully gapped: 71
Length of query: 505
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 391
Effective length of database: 40,409,475
Effective search space: 15800104725
Effective search space used: 15800104725
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)