Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_10.2228.324ON94394348730.0
Skud_12.1988.324ON94394346120.0
Smik_12.1928.324ON94394345860.0
YLR129W (DIP2)8.324ON94394345380.0
NCAS0C032608.324ON98395938090.0
SAKL0H15532g8.324ON94194737490.0
NDAI0G025808.324ON95896337100.0
Kpol_1036.698.324ON93694036450.0
TDEL0F045008.324ON93894436100.0
KAFR0H022608.324ON93894636010.0
TPHA0C008108.324ON93794035670.0
ZYRO0F10406g8.324ON93894035530.0
TBLA0A039508.324ON93693635500.0
KLTH0G12276g8.324ON93794435430.0
KNAG0G024508.324ON94294735390.0
CAGL0M04279g8.324ON94094034780.0
Kwal_56.239208.324ON93794434770.0
Ecym_42558.324ON93794334490.0
AGL196C8.324ON93593934140.0
KLLA0D16390g8.324ON93694631370.0
Smik_12.2798.435ON8177163443e-32
TDEL0B020108.435ON8056263328e-31
AGR180W8.435ON8066743292e-30
NDAI0E034408.435ON8576153086e-28
Skud_12.2858.435ON8176783077e-28
NCAS0C027108.435ON8155922828e-25
Ecym_41348.435ON8102352783e-24
YLR222C (UTP13)8.435ON8173782747e-24
TBLA0I025708.435ON8482002702e-23
KAFR0H017508.435ON7832372659e-23
ZYRO0A09636g8.435ON8082362622e-22
Ecym_25236.363ON6462782575e-22
TPHA0M020006.363ON6994242575e-22
SAKL0H12760g8.435ON8412372578e-22
KNAG0A025108.435ON8492052551e-21
AGL234W6.363ON6292782531e-21
Kpol_1031.498.435ON7603332532e-21
Kwal_27.115858.435ON8232352542e-21
KLTH0E10120g8.435ON8262352523e-21
Suva_10.3168.435ON8182352505e-21
KLLA0F13244g8.435ON8142352506e-21
TBLA0F042406.363ON7273332487e-21
CAGL0C03608g6.363ON6433572471e-20
CAGL0C00737g8.435ON8162402471e-20
TPHA0L010808.435ON8352382471e-20
KNAG0D002506.363ON6553832424e-20
KNAG0A037008.544ON8172952434e-20
YCR084C (TUP1)6.363ON7132822415e-20
KLLA0F10263g6.363ON6822762415e-20
Kpol_1028.236.363ON7442822415e-20
TDEL0A077806.363ON6572842399e-20
Kwal_23.64296.363ON7503162391e-19
Skud_3.1566.363ON7132822381e-19
Smik_3.1836.363ON7092822372e-19
SAKL0A00660g6.363ON6602872353e-19
AEL246C8.544ON8152942363e-19
NCAS0D047806.363ON6213152334e-19
Suva_3.1216.363ON7002572335e-19
NDAI0C054908.544ON8592292345e-19
KAFR0E031808.544ON8142952336e-19
CAGL0E00561g6.363ON8363402327e-19
KLTH0A07282g6.363ON7252842318e-19
SAKL0F15972g7.534ON4702982271e-18
TPHA0L016908.544ON8322192301e-18
TBLA0H036208.544ON8122992282e-18
ZYRO0D01122g7.534ON4663142233e-18
ZYRO0D17292g6.363ON7182832264e-18
NDAI0K023506.363ON7933702255e-18
NCAS0A055206.363ON6713412255e-18
CAGL0M05335g8.544ON8062972255e-18
ZYRO0A12980g8.544ON8243232247e-18
Smik_2.3388.544ON8003092221e-17
Ecym_70388.544ON8001752212e-17
YBR198C (TAF5)8.544ON7982162202e-17
KLTH0D04466g2.431ON3192012113e-17
Skud_2.3248.544ON8023012174e-17
TDEL0B030208.544ON8312952174e-17
AEL269C7.534ON4552692144e-17
Kpol_487.71.399ON3032852076e-17
SAKL0H09988g8.544ON7492772157e-17
NCAS0F018502.431ON3182312061e-16
Suva_4.4528.544ON8002162131e-16
KLLA0E23453g8.544ON8262372131e-16
Kpol_1024.428.544ON8432162122e-16
NCAS0A151707.534ON4742742092e-16
KLTH0A00880g7.534ON4712452092e-16
Kpol_1013.377.534ON4682742082e-16
KAFR0A005102.431ON3192232032e-16
NCAS0B022008.544ON8222842112e-16
Suva_13.2952.431ON3192242033e-16
Skud_13.2752.431ON3192242033e-16
Smik_13.3052.431ON3192242033e-16
YMR116C (ASC1)2.431ON3192242033e-16
NCAS0A042702.431ON3182312024e-16
ZYRO0E04620g1.399ON3032542014e-16
Kwal_23.53517.534ON4742452064e-16
KLTH0E12606g8.544ON7552152085e-16
Kwal_27.120538.544ON7552162085e-16
NDAI0H027102.431ON3182272015e-16
TPHA0I032407.534ON4772232056e-16
KNAG0E023102.431ON3192251999e-16
TPHA0I018808.544ON10342092061e-15
Suva_14.3421.399ON3032771971e-15
Skud_14.3211.399ON3032771971e-15
TPHA0G023802.431ON3182231972e-15
TDEL0B059701.399ON3032831952e-15
Smik_14.3221.399ON3032771953e-15
YNL006W (LST8)1.399ON3032771953e-15
TDEL0H003707.534ON4652831993e-15
CAGL0H03729g1.399ON3032781925e-15
KAFR0C047406.363ON6651591987e-15
Kpol_297.72.431ON3181561918e-15
SAKL0E03960g2.431ON3201561919e-15
AFR199C2.431ON3342061911e-14
TBLA0B091002.431ON3171601901e-14
KNAG0H016901.399ON3032541891e-14
ADL082C7.231ON5692081951e-14
TBLA0F005206.363ON6631571942e-14
SAKL0D08756g1.399ON3032541863e-14
NDAI0G038303.25ON5102951913e-14
ZYRO0D08206g6.340ON5152901914e-14
KLLA0C08547g6.340ON5152861905e-14
Kpol_1048.598.544ON8502171915e-14
NDAI0I003506.340ON5152901896e-14
KLLA0E07085g3.25ON4523051879e-14
KNAG0I028406.340ON5192851871e-13
Kwal_23.63246.340ON5142901871e-13
KLTH0H12122g1.399ON3032531821e-13
Skud_3.1456.340ON5153341871e-13
Suva_3.1096.340ON5153341871e-13
KAFR0H031401.399ON3032541811e-13
TDEL0A020702.431ON3191521812e-13
CAGL0J03476g6.340ON5173401852e-13
ZYRO0G20152g2.431ON3192231802e-13
YCR072C (RSA4)6.340ON5152831842e-13
Ecym_60982.431ON3181511793e-13
NCAS0D046106.340ON5152831824e-13
TPHA0O007101.399ON3043101774e-13
NCAS0B078401.247ON5892081825e-13
Ecym_12931.399ON3032541775e-13
SAKL0F08404g7.231ON6431821825e-13
KLTH0A06754g6.340ON5142901816e-13
TBLA0F041306.340ON5142901816e-13
Smik_3.1726.340ON5153341816e-13
Smik_11.2981.247ON6622391801e-12
KNAG0J016808.672ON3981531771e-12
NCAS0A139407.322ON12051601811e-12
Kpol_1070.117.231ON6661821801e-12
Suva_9.1547.231ON6381821791e-12
TPHA0G016108.672ON4141441771e-12
KAFR0B003707.534ON4612491771e-12
Skud_9.1237.231ON6391821791e-12
TDEL0A075506.340ON5154421781e-12
ZYRO0D16742g7.231ON6082761782e-12
KAFR0I018807.231ON5911821782e-12
Smik_9.1447.231ON6301821782e-12
SAKL0H06666g8.672ON4412121762e-12
SAKL0A01276g6.340ON5152831772e-12
YIL046W (MET30)7.231ON6401821782e-12
ZYRO0F07282g8.672ON4271601762e-12
KNAG0B027207.322ON12041781792e-12
Suva_14.223.25ON4692081762e-12
AER263C6.340ON5134431762e-12
TPHA0C011507.231ON6871901772e-12
TDEL0A004403.25ON4512951753e-12
TPHA0D045007.322ON12081651783e-12
Kpol_1014.193.25ON4522571753e-12
TDEL0H021307.231ON5842801763e-12
SAKL0A03872g6.239ON8783051773e-12
TPHA0M018306.340ON5154401753e-12
TPHA0P014903.25ON4592941744e-12
KAFR0A033801.247ON6661711754e-12
Skud_14.223.25ON4672081734e-12
AFL118W6.239ON8322921754e-12
KNAG0F018406.239ON9112891755e-12
KAFR0F043506.340ON5153401735e-12
CAGL0I03718g7.322ON12011601755e-12
Skud_4.1097.322ON12011601755e-12
KLLA0D04840g1.399ON3032541695e-12
Smik_4.907.322ON12011601756e-12
NDAI0C026001.399ON3032541696e-12
ZYRO0C03124g3.25ON4452951726e-12
TBLA0F022307.322ON12161841756e-12
KAFR0L013907.322ON12061601756e-12
Suva_4.997.322ON12011601746e-12
KLLA0D07546g8.67ON6473331737e-12
YDL145C (COP1)7.322ON12011601747e-12
Kpol_2001.657.322ON12061881747e-12
NDAI0A020907.322ON12001601747e-12
Ecym_24986.340ON5422841727e-12
NCAS0G036001.399ON3272961697e-12
Skud_11.2711.247ON6462401737e-12
Ecym_24018.672ON4261561708e-12
Ecym_43437.231ON5832811728e-12
TPHA0B011201.247ON7191231729e-12
KLLA0E12277g2.431ON3262171671e-11
CAGL0G04345g1.247ON7111271711e-11
CAGL0L00781g7.231ON6731821711e-11
Kpol_1028.416.340ON5122831692e-11
Smik_14.143.25ON4662081682e-11
Suva_11.2681.247ON6452391702e-11
YNL317W (PFS2)3.25ON4652081682e-11
TBLA0E007607.534ON3842431672e-11
ACR137W8.672ON4252131672e-11
Kwal_23.57697.231ON6272881692e-11
TDEL0F002701.534ON7053241692e-11
Ecym_55015.631ON3271881652e-11
TBLA0A060606.239ON8882731692e-11
CAGL0M04081g3.25ON4552051672e-11
NDAI0B051901.247ON6681741683e-11
KNAG0F038707.534ON4652681663e-11
NCAS0A134307.231ON6082931673e-11
TDEL0C022407.322ON12011591683e-11
TBLA0B043908.585ON3361611643e-11
Ecym_80727.322ON12011601683e-11
KLLA0F21406g1.247ON7051201673e-11
Ecym_28087.534ON4652441664e-11
KLLA0F04884g7.322ON12121831684e-11
Kpol_1031.361.247ON7062311674e-11
KNAG0C014101.247ON6531221674e-11
KNAG0B016101.247ON6742091674e-11
TBLA0D041307.231ON5742781655e-11
NCAS0C044503.25ON4612961645e-11
KNAG0D016907.231ON6542861656e-11
NDAI0A026107.231ON7671821666e-11
KLTH0A04114g7.231ON6582681656e-11
Suva_2.1174.106ON8402261666e-11
Kwal_56.245267.322ON12101601666e-11
SAKL0F10648g7.322ON12031601666e-11
Suva_6.1871.247ON7141251656e-11
KLTH0D11132g8.672ON4371441636e-11
KLTH0H01892g7.322ON12091601666e-11
CAGL0G09845g7.534ON5002541647e-11
KAFR0H024508.672ON4172081637e-11
YKR036C (CAF4)1.247ON6432391647e-11
Kpol_1028.546.325ON9051561657e-11
ZYRO0D03828g1.247ON7261231657e-11
KLTH0E15576g1.247ON7231211657e-11
NCAS0A034704.106ON8162301658e-11
TBLA0C018408.672ON4231531628e-11
Smik_2.1124.106ON8412261649e-11
KNAG0C028904.106ON8302341649e-11
ZYRO0E07392g6.239ON8972891649e-11
KLTH0A06380g6.325ON9151561649e-11
KLTH0H03608g6.239ON8753041641e-10
Kwal_27.126671.247ON7211921631e-10
Ecym_80901.247ON7161161631e-10
Kwal_26.87768.672ON4331441611e-10
AEL314W1.247ON7151171631e-10
ADR077C7.322ON12041601631e-10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_10.222
         (943 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...  1881   0.0  
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...  1781   0.0  
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...  1771   0.0  
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...  1752   0.0  
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...  1471   0.0  
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...  1448   0.0  
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...  1433   0.0  
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...  1408   0.0  
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...  1395   0.0  
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...  1391   0.0  
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...  1378   0.0  
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...  1373   0.0  
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...  1372   0.0  
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...  1369   0.0  
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...  1367   0.0  
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...  1344   0.0  
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...  1343   0.0  
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...  1333   0.0  
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...  1319   0.0  
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...  1212   0.0  
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...   137   3e-32
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...   132   8e-31
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...   131   2e-30
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...   123   6e-28
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...   122   7e-28
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...   113   8e-25
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...   111   3e-24
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...   110   7e-24
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...   108   2e-23
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...   106   9e-23
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...   105   2e-22
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...   103   5e-22
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...   103   5e-22
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...   103   8e-22
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...   102   1e-21
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...   102   1e-21
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...   102   2e-21
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...   102   2e-21
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...   101   3e-21
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...   100   5e-21
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...   100   6e-21
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...   100   7e-21
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...   100   1e-20
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...   100   1e-20
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....   100   1e-20
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    98   4e-20
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    98   4e-20
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    97   5e-20
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    97   5e-20
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    97   5e-20
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    97   9e-20
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    97   1e-19
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    96   1e-19
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    96   2e-19
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    95   3e-19
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    96   3e-19
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     94   4e-19
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    94   5e-19
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             95   5e-19
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    94   6e-19
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    94   7e-19
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    94   8e-19
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    92   1e-18
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    93   1e-18
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    92   2e-18
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    91   3e-18
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    92   4e-18
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    91   5e-18
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    91   5e-18
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    91   5e-18
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    91   7e-18
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    90   1e-17
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    90   2e-17
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    89   2e-17
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    86   3e-17
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    88   4e-17
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    88   4e-17
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    87   4e-17
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    84   6e-17
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    87   7e-17
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    84   1e-16
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    87   1e-16
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    87   1e-16
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    86   2e-16
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    85   2e-16
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    85   2e-16
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    85   2e-16
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    83   2e-16
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    86   2e-16
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    83   3e-16
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    83   3e-16
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    83   3e-16
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    83   3e-16
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    82   4e-16
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    82   4e-16
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    84   4e-16
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    85   5e-16
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    85   5e-16
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    82   5e-16
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    84   6e-16
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    81   9e-16
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    84   1e-15
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    80   1e-15
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    80   1e-15
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    80   2e-15
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    80   2e-15
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    80   3e-15
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    80   3e-15
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    81   3e-15
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    79   5e-15
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    81   7e-15
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    78   8e-15
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    78   9e-15
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    78   1e-14
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    78   1e-14
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    77   1e-14
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    80   1e-14
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    79   2e-14
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    76   3e-14
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      78   3e-14
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    78   4e-14
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    78   5e-14
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    78   5e-14
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       77   6e-14
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    77   9e-14
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    77   1e-13
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    77   1e-13
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    75   1e-13
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    77   1e-13
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    77   1e-13
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    74   1e-13
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    74   2e-13
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    76   2e-13
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    74   2e-13
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    75   2e-13
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    74   3e-13
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     75   4e-13
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    73   4e-13
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    75   5e-13
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    73   5e-13
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    75   5e-13
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    74   6e-13
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    74   6e-13
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    74   6e-13
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    74   1e-12
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    73   1e-12
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    74   1e-12
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    74   1e-12
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    74   1e-12
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    73   1e-12
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    73   1e-12
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    74   1e-12
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    73   1e-12
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    73   2e-12
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    73   2e-12
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    73   2e-12
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    72   2e-12
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    73   2e-12
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    73   2e-12
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    72   2e-12
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    74   2e-12
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    72   2e-12
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    72   2e-12
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    73   2e-12
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    72   3e-12
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    73   3e-12
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    72   3e-12
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    72   3e-12
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    73   3e-12
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    72   3e-12
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    72   4e-12
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    72   4e-12
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    71   4e-12
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    72   4e-12
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    72   5e-12
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    71   5e-12
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    72   5e-12
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    72   5e-12
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    70   5e-12
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    72   6e-12
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      70   6e-12
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    71   6e-12
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    72   6e-12
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    72   6e-12
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    72   6e-12
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    71   7e-12
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    72   7e-12
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    72   7e-12
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    72   7e-12
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    71   7e-12
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    70   7e-12
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    71   7e-12
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    70   8e-12
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    71   8e-12
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    71   9e-12
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    69   1e-11
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    70   1e-11
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    70   1e-11
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    70   2e-11
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    69   2e-11
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    70   2e-11
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    69   2e-11
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               69   2e-11
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    69   2e-11
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    70   2e-11
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    70   2e-11
Ecym_5501 Chr5 (1021675..1022658) [984 bp, 327 aa] {ON} similar ...    68   2e-11
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    70   2e-11
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    69   2e-11
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    69   3e-11
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    69   3e-11
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    69   3e-11
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    69   3e-11
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    68   3e-11
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    69   3e-11
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    69   3e-11
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    69   4e-11
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    69   4e-11
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    69   4e-11
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    69   4e-11
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    69   4e-11
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    68   5e-11
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      68   5e-11
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    68   6e-11
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     69   6e-11
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    68   6e-11
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    69   6e-11
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    69   6e-11
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    69   6e-11
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    68   6e-11
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    67   6e-11
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    69   6e-11
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    68   7e-11
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    67   7e-11
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    68   7e-11
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    68   7e-11
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    68   7e-11
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    68   7e-11
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     68   8e-11
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    67   8e-11
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    68   9e-11
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    68   9e-11
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    68   9e-11
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    68   9e-11
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    68   1e-10
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    67   1e-10
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    67   1e-10
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    67   1e-10
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    67   1e-10
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    67   1e-10
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    67   1e-10
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    66   1e-10
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    67   1e-10
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    67   1e-10
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    67   1e-10
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    66   2e-10
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    67   2e-10
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    67   2e-10
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    67   2e-10
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    66   3e-10
Skud_2.103 Chr2 (193155..195677) [2523 bp, 840 aa] {ON} YBL008W ...    66   3e-10
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    67   3e-10
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    66   3e-10
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    65   3e-10
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    66   3e-10
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    66   4e-10
Ecym_3619 Chr3 (1183531..1185666) [2136 bp, 711 aa] {ON} similar...    65   4e-10
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    65   4e-10
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      65   5e-10
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    65   5e-10
Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON} (1488...    65   5e-10
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    65   5e-10
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    64   5e-10
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     65   5e-10
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    65   6e-10
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    65   6e-10
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    65   6e-10
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     64   6e-10
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    65   7e-10
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    65   7e-10
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    65   7e-10
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    63   7e-10
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    65   8e-10
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    64   8e-10
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    64   1e-09
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    64   1e-09
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    62   1e-09
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    64   1e-09
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    64   1e-09
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    64   1e-09
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    63   1e-09
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    64   1e-09
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    63   2e-09
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    64   2e-09
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      62   2e-09
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    64   2e-09
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    63   2e-09
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    64   2e-09
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    63   2e-09
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    62   2e-09
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    63   2e-09
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    63   2e-09
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    64   2e-09
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    64   2e-09
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    63   2e-09
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       64   2e-09
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    64   2e-09
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    63   2e-09
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    62   2e-09
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    63   3e-09
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    63   3e-09
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    62   3e-09
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    62   4e-09
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    63   4e-09
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    62   4e-09
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    62   4e-09
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    62   4e-09
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    62   5e-09
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    62   5e-09
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     62   5e-09
ZYRO0G03586g Chr7 (285054..287969) [2916 bp, 971 aa] {ON} simila...    62   5e-09
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    61   5e-09
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    62   5e-09
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    62   5e-09
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    62   5e-09
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    61   6e-09
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    62   6e-09
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    61   6e-09
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    62   6e-09
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    62   7e-09
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    62   8e-09
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    61   9e-09
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    60   9e-09
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    58   9e-09
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    61   1e-08
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    61   1e-08
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    60   1e-08
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    61   1e-08
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    61   1e-08
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    61   2e-08
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    60   2e-08
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    58   2e-08
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    60   2e-08
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    60   2e-08
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    59   3e-08
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    59   3e-08
KLLA0B14410g Chr2 (1264616..1266736) [2121 bp, 706 aa] {ON} simi...    60   3e-08
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    59   3e-08
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    59   3e-08
AER081C Chr5 complement(785301..788372) [3072 bp, 1023 aa] {ON} ...    60   3e-08
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    59   3e-08
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    59   3e-08
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    59   4e-08
TPHA0G02570 Chr7 (531221..532261) [1041 bp, 346 aa] {ON} Anc_2.3...    58   5e-08
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    59   5e-08
TPHA0G02030 Chr7 (417868..418911) [1044 bp, 347 aa] {ON} Anc_2.3...    58   5e-08
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    59   5e-08
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    59   5e-08
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    59   6e-08
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    58   6e-08
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    58   6e-08
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    58   6e-08
TPHA0A03680 Chr1 complement(804355..806004) [1650 bp, 549 aa] {O...    58   6e-08
Kwal_55.21559 s55 complement(889630..890685) [1056 bp, 351 aa] {...    57   7e-08
Suva_8.318 Chr8 (565468..566961) [1494 bp, 497 aa] {ON} YOR269W ...    58   7e-08
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    57   9e-08
Suva_2.435 Chr2 complement(769135..770127) [993 bp, 330 aa] {ON}...    57   9e-08
Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}...    58   9e-08
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    58   9e-08
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    57   1e-07
Smik_2.243 Chr2 (432627..434252) [1626 bp, 541 aa] {ON} YBR103W ...    57   1e-07
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    56   1e-07
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    57   1e-07
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    56   1e-07
KLLA0B02827g Chr2 (254447..257275) [2829 bp, 942 aa] {ON} highly...    58   1e-07
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    57   1e-07
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    56   1e-07
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    57   1e-07
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    57   2e-07
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    57   2e-07
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    57   2e-07
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    57   2e-07
Ecym_3243 Chr3 (460611..463448) [2838 bp, 945 aa] {ON} similar t...    57   2e-07
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    57   2e-07
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    56   2e-07
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    56   2e-07
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    57   2e-07
ZYRO0G02420g Chr7 (184509..186686) [2178 bp, 725 aa] {ON} simila...    57   2e-07
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    56   2e-07
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    57   2e-07
NCAS0A04400 Chr1 (888188..890743) [2556 bp, 851 aa] {ON} Anc_2.4...    57   2e-07
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    56   2e-07
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    56   3e-07
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    56   3e-07
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    56   3e-07
Skud_16.96 Chr16 complement(172716..175757) [3042 bp, 1013 aa] {...    57   3e-07
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    56   3e-07
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    56   3e-07
AFL056C Chr6 complement(329216..332146) [2931 bp, 976 aa] {ON} S...    56   4e-07
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    55   4e-07
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    56   4e-07
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    55   4e-07
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    55   4e-07
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    55   4e-07
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    55   4e-07
NDAI0A07830 Chr1 (1802204..1804156) [1953 bp, 650 aa] {ON} Anc_3...    56   4e-07
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    56   4e-07
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    56   4e-07
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    56   4e-07
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    55   4e-07
SAKL0G15994g Chr7 complement(1374780..1377614) [2835 bp, 944 aa]...    56   5e-07
Kpol_1055.64 s1055 (170524..173340) [2817 bp, 938 aa] {ON} (1705...    56   5e-07
TBLA0B09730 Chr2 (2309400..2310938) [1539 bp, 512 aa] {ON} Anc_2...    55   5e-07
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              55   5e-07
YPL183C Chr16 complement(199495..202536) [3042 bp, 1013 aa] {ON}...    55   6e-07
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    55   6e-07
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    55   6e-07
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    55   6e-07
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     55   7e-07
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    55   7e-07
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    55   7e-07
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    55   8e-07
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    55   8e-07
Suva_7.278 Chr7 complement(482297..483559) [1263 bp, 420 aa] {ON...    54   8e-07
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    54   9e-07
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    55   1e-06
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    55   1e-06
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    55   1e-06
NCAS0H01060 Chr8 complement(197867..200875) [3009 bp, 1002 aa] {...    55   1e-06
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    54   1e-06
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    54   1e-06
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    54   1e-06
Kpol_1002.74 s1002 complement(195739..198756) [3018 bp, 1005 aa]...    55   1e-06
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    54   1e-06
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    54   1e-06
KLTH0D14960g Chr4 complement(1223765..1226584) [2820 bp, 939 aa]...    54   1e-06
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    54   1e-06
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    54   1e-06
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    54   1e-06
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       54   1e-06
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    54   1e-06
Kwal_47.17555 s47 complement(453984..455237) [1254 bp, 417 aa] {...    54   1e-06
Kwal_27.11126 s27 (651113..654103) [2991 bp, 996 aa] {ON} YPL183...    54   2e-06
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    54   2e-06
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    54   2e-06
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    53   2e-06
KNAG0B06260 Chr2 complement(1228060..1230876) [2817 bp, 938 aa] ...    54   2e-06
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    53   2e-06
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    54   2e-06
KAFR0G01710 Chr7 (373483..375048) [1566 bp, 521 aa] {ON} Anc_3.3...    54   2e-06
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    54   2e-06
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    53   2e-06
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    53   2e-06
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    53   2e-06
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    54   2e-06
KAFR0B06670 Chr2 (1390238..1393234) [2997 bp, 998 aa] {ON} Anc_6...    54   2e-06
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    52   2e-06
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    53   2e-06
Suva_16.126 Chr16 complement(209255..212296) [3042 bp, 1013 aa] ...    54   2e-06
KAFR0H00550 Chr8 (97619..98683) [1065 bp, 354 aa] {ON} Anc_5.631...    53   2e-06
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    53   3e-06
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    53   3e-06
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    53   3e-06
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    53   3e-06
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    53   3e-06
CAGL0L06952g Chr12 complement(782790..783833) [1044 bp, 347 aa] ...    52   3e-06
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    53   3e-06
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    53   3e-06
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    53   3e-06
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    53   3e-06
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    53   3e-06
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    53   3e-06
Skud_12.493 Chr12 complement(874622..877441) [2820 bp, 939 aa] {...    53   4e-06
Kwal_33.13515 s33 (259533..260729) [1197 bp, 398 aa] {ON} YNL253...    52   4e-06
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    52   4e-06
Kpol_1032.65 s1032 complement(150052..151095) [1044 bp, 347 aa] ...    52   4e-06
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    53   4e-06
TPHA0B02080 Chr2 (477775..480600) [2826 bp, 941 aa] {ON} Anc_4.2...    53   4e-06
NDAI0K01410 Chr11 (321553..324486) [2934 bp, 977 aa] {ON} Anc_2....    53   4e-06
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    52   4e-06
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    52   4e-06
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    52   5e-06
KLTH0D04950g Chr4 complement(449060..451402) [2343 bp, 780 aa] {...    52   5e-06
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    52   6e-06
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    52   6e-06
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    52   6e-06
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    52   6e-06
SAKL0G01760g Chr7 (147664..148656) [993 bp, 330 aa] {ON} highly ...    51   6e-06
ADR264C Chr4 complement(1158216..1159256) [1041 bp, 346 aa] {ON}...    51   6e-06
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    51   6e-06
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      52   6e-06
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...    52   7e-06
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    51   7e-06
SAKL0D02068g Chr4 (167213..168823) [1611 bp, 536 aa] {ON} simila...    52   7e-06
Smik_6.388 Chr6 (622104..625145) [3042 bp, 1013 aa] {ON} YPL183C...    52   7e-06
TDEL0E00950 Chr5 (197384..200206) [2823 bp, 940 aa] {ON} Anc_4.2...    52   7e-06
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    51   7e-06
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    51   8e-06
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    52   8e-06
ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic ho...    52   8e-06
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    51   1e-05
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    51   1e-05
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    51   1e-05
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    51   1e-05
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    51   1e-05
TPHA0I01690 Chr9 (377629..378651) [1023 bp, 340 aa] {ON} Anc_8.5...    50   1e-05
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    51   1e-05
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    51   1e-05
ZYRO0C15994g Chr3 (1255015..1256529) [1515 bp, 504 aa] {ON} simi...    51   1e-05
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    51   1e-05
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    51   1e-05
Smik_15.451 Chr15 (775983..777467) [1485 bp, 494 aa] {ON} YOR269...    51   1e-05
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    51   1e-05
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    51   1e-05
Kwal_23.4118 s23 (579251..582070) [2820 bp, 939 aa] {ON} YLR409C...    51   1e-05
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    50   1e-05
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    50   1e-05
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    50   1e-05
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    50   1e-05
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    50   1e-05
ZYRO0B12980g Chr2 complement(1045283..1048102) [2820 bp, 939 aa]...    51   2e-05
TDEL0A04970 Chr1 complement(877816..878817) [1002 bp, 333 aa] {O...    50   2e-05
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    51   2e-05
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    50   2e-05
YLR409C Chr12 complement(934414..937233) [2820 bp, 939 aa] {ON} ...    51   2e-05
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    50   2e-05
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    50   2e-05
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    50   2e-05
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    50   2e-05
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    50   2e-05
KAFR0A05800 Chr1 (1177423..1180245) [2823 bp, 940 aa] {ON} Anc_4...    50   2e-05
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    50   2e-05
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    50   2e-05
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    50   2e-05
NCAS0J01650 Chr10 complement(294247..297069) [2823 bp, 940 aa] {...    50   2e-05
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    50   2e-05
SAKL0A05412g Chr1 complement(489032..492025) [2994 bp, 997 aa] {...    50   2e-05
SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {...    50   2e-05
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    49   2e-05
Suva_10.525 Chr10 complement(900164..902983) [2820 bp, 939 aa] {...    50   2e-05
CAGL0M09845g Chr13 (975007..977817) [2811 bp, 936 aa] {ON} highl...    50   2e-05
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    50   2e-05
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    50   2e-05
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...    50   3e-05
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    49   3e-05
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    50   3e-05
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    50   3e-05
TPHA0J02160 Chr10 (484299..487313) [3015 bp, 1004 aa] {ON} Anc_6...    50   3e-05
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    49   3e-05
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    50   3e-05
KNAG0M00450 Chr13 complement(65548..68523) [2976 bp, 991 aa] {ON...    50   3e-05
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    50   3e-05
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    49   3e-05
Kpol_1033.58 s1033 (147020..149881) [2862 bp, 953 aa] {ON} (1470...    50   3e-05
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    50   4e-05
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    49   4e-05
TBLA0C02090 Chr3 complement(495831..498683) [2853 bp, 950 aa] {O...    50   4e-05
KLTH0H15752g Chr8 complement(1359449..1360501) [1053 bp, 350 aa]...    49   4e-05
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    49   4e-05
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    49   4e-05
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    49   4e-05
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    49   4e-05
KNAG0G03310 Chr7 complement(709092..710552) [1461 bp, 486 aa] {O...    49   4e-05
Skud_7.283 Chr7 complement(493716..494972) [1257 bp, 418 aa] {ON...    49   5e-05
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    49   5e-05
Kpol_526.37 s526 complement(88726..89769) [1044 bp, 347 aa] {ON}...    49   5e-05
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     49   5e-05
AFL009C Chr6 complement(420007..421248) [1242 bp, 413 aa] {ON} S...    49   5e-05
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    49   5e-05
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...    49   5e-05
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    49   5e-05
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    49   5e-05
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    49   6e-05
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    49   6e-05
ZYRO0F09284g Chr6 (754433..755767) [1335 bp, 444 aa] {ON} simila...    49   6e-05
Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {...    48   6e-05
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    49   6e-05
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    49   6e-05
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    49   6e-05
Kwal_34.15818 s34 (74248..75297) [1050 bp, 349 aa] {ON} YMR146C ...    48   7e-05
Ecym_2356 Chr2 complement(697428..698819) [1392 bp, 463 aa] {ON}...    49   7e-05
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    48   7e-05
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    48   7e-05
ZYRO0A08184g Chr1 (655686..656726) [1041 bp, 346 aa] {ON} highly...    48   7e-05
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    49   7e-05
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    48   8e-05
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    48   8e-05
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    48   8e-05
NCAS0D01130 Chr4 (208915..209958) [1044 bp, 347 aa] {ON} Anc_2.3...    48   8e-05
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    48   8e-05
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    48   9e-05
Kwal_26.8953 s26 (1017811..1019187) [1377 bp, 458 aa] {ON} YOR26...    48   9e-05
SAKL0H21846g Chr8 (1905888..1908134) [2247 bp, 748 aa] {ON} simi...    48   9e-05
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    48   9e-05
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    48   9e-05
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    48   9e-05
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    48   1e-04
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    48   1e-04
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    48   1e-04
KNAG0A03450 Chr1 (439716..440648) [933 bp, 310 aa] {ON} Anc_8.58...    47   1e-04
NCAS0B00430 Chr2 (57814..59280) [1467 bp, 488 aa] {ON} Anc_8.717...    48   1e-04
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    48   1e-04
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    48   1e-04
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    48   1e-04
KLLA0A08866g Chr1 (776960..778231) [1272 bp, 423 aa] {ON} simila...    48   1e-04
YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON} ...    47   1e-04
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    48   1e-04
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    48   1e-04
KAFR0B05030 Chr2 (1040952..1041998) [1047 bp, 348 aa] {ON} Anc_2...    47   1e-04
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    47   1e-04
YGL004C Chr7 complement(490703..491956) [1254 bp, 417 aa] {ON}  ...    47   1e-04
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    47   1e-04
SAKL0B07458g Chr2 (642864..644393) [1530 bp, 509 aa] {ON} simila...    48   1e-04
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    48   1e-04
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    48   1e-04
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    47   1e-04
Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {...    47   1e-04
TDEL0F01740 Chr6 complement(322088..325102) [3015 bp, 1004 aa] {...    48   1e-04
KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {...    47   1e-04
ADR176W Chr4 (1012411..1013796) [1386 bp, 461 aa] {ON} Syntenic ...    47   1e-04
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    47   1e-04
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    47   2e-04
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    47   2e-04
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    48   2e-04
KLLA0F07403g Chr6 (697593..698636) [1044 bp, 347 aa] {ON} simila...    47   2e-04
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    47   2e-04
TPHA0A04810 Chr1 complement(1090373..1092751) [2379 bp, 792 aa] ...    47   2e-04
KNAG0G02790 Chr7 (617832..619247) [1416 bp, 471 aa] {ON} Anc_8.7...    47   2e-04
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    47   2e-04
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    47   2e-04
NDAI0F04030 Chr6 complement(958364..959839) [1476 bp, 491 aa] {O...    47   2e-04
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    47   2e-04
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    47   2e-04
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...    47   2e-04
KNAG0E02020 Chr5 (416909..417949) [1041 bp, 346 aa] {ON} Anc_2.3...    46   2e-04
TBLA0B08980 Chr2 complement(2125687..2129208) [3522 bp, 1173 aa]...    47   2e-04
Ecym_5334 Chr5 (679515..682574) [3060 bp, 1019 aa] {ON} similar ...    47   2e-04
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    47   2e-04
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    47   3e-04
SAKL0E05368g Chr5 complement(444630..445679) [1050 bp, 349 aa] {...    46   3e-04
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    47   3e-04
KAFR0A05270 Chr1 complement(1043260..1044975) [1716 bp, 571 aa] ...    47   3e-04
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....    46   3e-04
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    46   3e-04
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    46   3e-04
KLTH0H05038g Chr8 complement(449230..452217) [2988 bp, 995 aa] {...    47   3e-04
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    46   3e-04
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    46   3e-04
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    46   4e-04
Ecym_7402 Chr7 complement(827224..829044) [1821 bp, 606 aa] {ON}...    46   4e-04
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    46   4e-04
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    46   4e-04
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    46   4e-04
TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.4...    45   4e-04
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    46   4e-04
KNAG0A01610 Chr1 complement(84663..85270,85389..86376) [1596 bp,...    46   5e-04
YER066W Chr5 (290242..290799) [558 bp, 185 aa] {ON}  RRT13Putati...    44   5e-04
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    46   5e-04
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    45   5e-04
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    45   5e-04
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    46   5e-04
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    45   5e-04
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    45   6e-04
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    45   6e-04
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    45   6e-04
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    45   6e-04
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    45   6e-04
NDAI0H00820 Chr8 (185870..186940) [1071 bp, 356 aa] {ON} Anc_5.6...    45   6e-04
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    45   7e-04
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    45   7e-04
SAKL0H05566g Chr8 complement(500251..501663) [1413 bp, 470 aa] {...    45   7e-04
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    45   7e-04
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    45   7e-04
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    45   7e-04
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    45   8e-04
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    45   8e-04
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    45   8e-04
YOR269W Chr15 (826385..827869) [1485 bp, 494 aa] {ON}  PAC1Prote...    45   8e-04
KAFR0A06490 Chr1 complement(1314794..1316098) [1305 bp, 434 aa] ...    45   8e-04
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    45   8e-04
Smik_7.286 Chr7 complement(482658..483911) [1254 bp, 417 aa] {ON...    45   9e-04
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    45   9e-04
AFR715C Chr6 complement(1753288..1755438) [2151 bp, 716 aa] {ON}...    45   9e-04
ACL116W Chr3 (140589..143003) [2415 bp, 804 aa] {ON} Syntenic ho...    45   9e-04
NDAI0H03030 Chr8 complement(733181..734233) [1053 bp, 350 aa] {O...    44   0.001
NCAS0A07160 Chr1 complement(1419393..1420385) [993 bp, 330 aa] {...    44   0.001
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    45   0.001
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    45   0.001
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    45   0.001
TBLA0H02380 Chr8 (568334..570721) [2388 bp, 795 aa] {ON} Anc_5.1...    45   0.001
TDEL0B00800 Chr2 (152025..153452) [1428 bp, 475 aa] {ON} Anc_8.8...    45   0.001
TDEL0G03100 Chr7 (582165..583205) [1041 bp, 346 aa] {ON} Anc_2.3...    44   0.001
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    44   0.001
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    44   0.001
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    44   0.001
Ecym_6423 Chr6 (822758..824329) [1572 bp, 523 aa] {ON} similar t...    44   0.001
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    44   0.001
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    44   0.001
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    44   0.001
KLTH0C04378g Chr3 (381355..382860) [1506 bp, 501 aa] {ON} simila...    44   0.001
CAGL0C01441g Chr3 complement(156930..159947) [3018 bp, 1005 aa] ...    45   0.001
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    44   0.001
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    44   0.001
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    44   0.001
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    44   0.001
TBLA0B09190 Chr2 (2171629..2172669) [1041 bp, 346 aa] {ON} Anc_2...    44   0.001
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    44   0.001
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    44   0.002
Skud_15.434 Chr15 (765132..766616) [1485 bp, 494 aa] {ON} YOR269...    44   0.002
KLTH0D12188g Chr4 (990209..991582) [1374 bp, 457 aa] {ON} simila...    44   0.002
Kpol_387.7 s387 (15235..16893) [1659 bp, 552 aa] {ON} (15235..16...    44   0.002
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    44   0.002
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    44   0.002
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    44   0.002
AER035W Chr5 (699524..702544) [3021 bp, 1006 aa] {ON} Syntenic h...    44   0.002
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    44   0.002
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    44   0.002
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    44   0.002
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    44   0.002
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    44   0.002
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    44   0.002
Smik_4.585 Chr4 complement(1040861..1043125) [2265 bp, 754 aa] {...    44   0.002
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    44   0.002
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    44   0.002
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    44   0.002
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    44   0.002
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    44   0.002
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     44   0.002
NDAI0E00950 Chr5 complement(192199..193734) [1536 bp, 511 aa] {O...    44   0.002
Smik_7.50 Chr7 complement(84865..86058) [1194 bp, 397 aa] {ON} Y...    43   0.002
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    44   0.002
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    44   0.003
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    44   0.003
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    43   0.003
ZYRO0F11374g Chr6 complement(934451..935983) [1533 bp, 510 aa] {...    43   0.003
ZYRO0G10494g Chr7 complement(846835..848133) [1299 bp, 432 aa] {...    43   0.003
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    43   0.003
Ecym_5599 Chr5 complement(1220881..1221930) [1050 bp, 349 aa] {O...    43   0.003
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    43   0.003
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    44   0.003
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    44   0.003
KAFR0D01700 Chr4 complement(339178..340785) [1608 bp, 535 aa] {O...    43   0.003
Suva_13.280 Chr13 complement(451520..454051) [2532 bp, 843 aa] {...    43   0.003
KLTH0F02948g Chr6 (254134..255333) [1200 bp, 399 aa] {ON} weakly...    43   0.003
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    43   0.003
TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.1...    43   0.003
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    43   0.003
AGR367C Chr7 complement(1408852..1411167) [2316 bp, 771 aa] {ON}...    43   0.004
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    43   0.004
ZYRO0F16104g Chr6 complement(1322975..1324183) [1209 bp, 402 aa]...    43   0.004
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    43   0.004
Ecym_6167 Chr6 complement(309181..310437) [1257 bp, 418 aa] {ON}...    43   0.004
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    43   0.004
Skud_2.302 Chr2 (549799..550803) [1005 bp, 334 aa] {ON} YBR175W ...    42   0.004
TPHA0K01570 Chr11 (329273..330553) [1281 bp, 426 aa] {ON} Anc_4....    43   0.004
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    42   0.004
SAKL0H22418g Chr8 complement(1951429..1952724) [1296 bp, 431 aa]...    43   0.004
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    43   0.004
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    42   0.004
SAKL0H22330g Chr8 complement(1943859..1945094) [1236 bp, 411 aa]...    42   0.004
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    43   0.004
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    43   0.004
Kwal_47.17572 s47 complement(461322..462626) [1305 bp, 434 aa] {...    42   0.005
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    42   0.005
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    42   0.005
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    42   0.005
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    42   0.005
Kwal_YGOB_27.12717 s27 (1347453..1348746,1348819..1349414) [1890...    42   0.005
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    42   0.005
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    42   0.005
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    42   0.005
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    42   0.006
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    42   0.006
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    42   0.006
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    42   0.006
TBLA0B07430 Chr2 complement(1767976..1768574,1768681..1770475) [...    42   0.006
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    42   0.006
ZYRO0G13596g Chr7 complement(1084499..1085908) [1410 bp, 469 aa]...    42   0.006
CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {...    42   0.006
TDEL0C05940 Chr3 complement(1070975..1072264) [1290 bp, 429 aa] ...    42   0.007
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    42   0.007
AFL006C Chr6 complement(425925..427226) [1302 bp, 433 aa] {ON} S...    42   0.007
KNAG0J02560 Chr10 (482741..484294) [1554 bp, 517 aa] {ON} Anc_3....    42   0.007
Suva_13.43 Chr13 (68221..68556,68574..69404) [1167 bp, 388 aa] {...    42   0.007
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    42   0.007
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    42   0.007
KLLA0F21076g Chr6 (1966373..1969036) [2664 bp, 887 aa] {ON} weak...    42   0.008
Kpol_361.3 s361 complement(3792..5675) [1884 bp, 627 aa] {ON} co...    42   0.008
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    42   0.008
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    42   0.008
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    42   0.009
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    42   0.009
KLLA0D13222g Chr4 complement(1132067..1134277) [2211 bp, 736 aa]...    42   0.009
NDAI0J01840 Chr10 (459174..460466) [1293 bp, 430 aa] {ON} Anc_4....    42   0.009
TPHA0G00720 Chr7 complement(136125..137672) [1548 bp, 515 aa] {O...    42   0.009
Skud_4.592 Chr4 complement(1050634..1052892) [2259 bp, 752 aa] {...    42   0.009
KLLA0C09262g Chr3 (805512..807188) [1677 bp, 558 aa] {ON} highly...    42   0.009
ZYRO0G03168g Chr7 (241103..242923) [1821 bp, 606 aa] {ON} simila...    42   0.009
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    42   0.010
SAKL0F03432g Chr6 complement(274302..276029) [1728 bp, 575 aa] {...    42   0.010
SAKL0C03344g Chr3 (315639..317087) [1449 bp, 482 aa] {ON} weakly...    42   0.010
Skud_5.232 Chr5 complement(369506..370603) [1098 bp, 365 aa] {ON...    41   0.010
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...    41   0.010
Kpol_467.21 s467 (46346..48160) [1815 bp, 604 aa] {ON} (46346..4...    42   0.010
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    41   0.010
TBLA0A05690 Chr1 (1412275..1413546) [1272 bp, 423 aa] {ON} Anc_1...    41   0.011
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    42   0.011
KLTH0F14344g Chr6 (1177844..1179556) [1713 bp, 570 aa] {ON} high...    41   0.011
YGL213C Chr7 complement(90054..91247) [1194 bp, 397 aa] {ON}  SK...    41   0.011
NCAS0A06510 Chr1 (1283824..1285056) [1233 bp, 410 aa] {ON} Anc_4...    41   0.012
Suva_5.228 Chr5 complement(347755..348852) [1098 bp, 365 aa] {ON...    41   0.012
KAFR0D03060 Chr4 (604145..606625) [2481 bp, 826 aa] {ON} Anc_2.4...    41   0.012
Kwal_27.12586 s27 (1290276..1291805) [1530 bp, 509 aa] {ON} YBR1...    41   0.012
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    41   0.012
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    41   0.013
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    40   0.013
KLLA0B12804g Chr2 (1117475..1120033) [2559 bp, 852 aa] {ON} simi...    41   0.013
ADR108C Chr4 complement(899198..900097) [900 bp, 299 aa] {ON} NO...    40   0.014
KLLA0D08371g Chr4 (710885..712411) [1527 bp, 508 aa] {ON} simila...    41   0.014
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    41   0.015
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    41   0.016
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    41   0.016
SAKL0C10098g Chr3 complement(909553..912489) [2937 bp, 978 aa] {...    41   0.016
KNAG0B00900 Chr2 (164610..165698) [1089 bp, 362 aa] {ON} Anc_3.4...    40   0.017
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    40   0.017
YDR324C Chr4 complement(1114433..1116763) [2331 bp, 776 aa] {ON}...    41   0.017
NDAI0D03490 Chr4 (820778..822079) [1302 bp, 433 aa] {ON} Anc_4.1...    40   0.017
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    41   0.017
CAGL0J07854g Chr10 complement(767587..768885) [1299 bp, 432 aa] ...    40   0.018
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               41   0.018
ABL141C Chr2 complement(131670..133226) [1557 bp, 518 aa] {ON} S...    41   0.018
Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON...    40   0.018
Suva_2.495 Chr2 complement(871929..874187) [2259 bp, 752 aa] {ON...    41   0.019
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    40   0.019
ZYRO0C09724g Chr3 (738113..739588) [1476 bp, 491 aa] {ON} simila...    40   0.020
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    40   0.020
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    40   0.020
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    40   0.020
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    41   0.021
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    40   0.021
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    40   0.021
SAKL0F01804g Chr6 complement(151476..152714,152788..152790) [124...    40   0.021
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    41   0.021
NCAS0F02050 Chr6 complement(409352..413923) [4572 bp, 1523 aa] {...    41   0.021
TBLA0C05340 Chr3 complement(1293851..1295560) [1710 bp, 569 aa] ...    40   0.021
Skud_7.55 Chr7 complement(95372..96565) [1194 bp, 397 aa] {ON} Y...    40   0.021
TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.1...    40   0.022
Ecym_4433 Chr4 complement(893223..894923) [1701 bp, 566 aa] {ON}...    40   0.023
KAFR0D04430 Chr4 (874649..876928) [2280 bp, 759 aa] {ON} Anc_5.3...    40   0.023
KLLA0A08800g Chr1 (770989..772308) [1320 bp, 439 aa] {ON} simila...    40   0.024
KAFR0C03870 Chr3 (783131..784120) [990 bp, 329 aa] {ON} Anc_2.65...    40   0.024
Ecym_4649 Chr4 (1264219..1265784) [1566 bp, 521 aa] {ON} similar...    40   0.024
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    40   0.024
KLTH0E06930g Chr5 (637945..639609) [1665 bp, 554 aa] {ON} simila...    40   0.025
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    40   0.026
KLLA0A01650g Chr1 complement(146030..147235) [1206 bp, 401 aa] {...    40   0.026
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    40   0.026
CAGL0M01430g Chr13 (164428..166683) [2256 bp, 751 aa] {ON} highl...    40   0.026
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    40   0.026
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    40   0.026
KLTH0E15158g Chr5 (1346780..1348309) [1530 bp, 509 aa] {ON} simi...    40   0.027
SAKL0H24530g Chr8 complement(2127253..2128998) [1746 bp, 581 aa]...    40   0.027
TBLA0B08930 Chr2 complement(2117704..2119536) [1833 bp, 610 aa] ...    40   0.027
Ecym_8393 Chr8 complement(805739..807394) [1656 bp, 551 aa] {ON}...    40   0.027
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    40   0.028
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    40   0.029
TBLA0A03210 Chr1 complement(762289..764535) [2247 bp, 748 aa] {O...    40   0.029
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    40   0.029
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    40   0.029
TPHA0M00700 Chr13 complement(132140..135313) [3174 bp, 1057 aa] ...    40   0.030
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    40   0.031
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    40   0.031
Kwal_55.21144 s55 (703153..704865) [1713 bp, 570 aa] {ON} YPR137...    40   0.031
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    40   0.032
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    40   0.035
Kpol_1025.38 s1025 (90229..90465,90467..91492) [1263 bp, 420 aa]...    40   0.035
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    40   0.036
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    40   0.036
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    40   0.037
KNAG0K00850 Chr11 complement(159329..162832) [3504 bp, 1167 aa] ...    40   0.038
Smik_16.383 Chr16 (679641..681362) [1722 bp, 573 aa] {ON} YPR137...    40   0.039
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    39   0.039
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    40   0.039
Skud_1.64 Chr1 (130376..131662) [1287 bp, 428 aa] {ON} YAR003W (...    39   0.040
KNAG0A06340 Chr1 (967160..970114) [2955 bp, 984 aa] {ON} Anc_2.4...    40   0.041
YML102W Chr13 (68294..69700) [1407 bp, 468 aa] {ON}  CAC2Subunit...    39   0.042
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    40   0.042
TPHA0N01800 Chr14 complement(386979..387968) [990 bp, 329 aa] {O...    39   0.043
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    39   0.044
ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} simila...    40   0.044
TBLA0D01190 Chr4 complement(301525..302820) [1296 bp, 431 aa] {O...    39   0.045
Kwal_26.8604 s26 complement(859891..862494) [2604 bp, 867 aa] {O...    40   0.045
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    39   0.046
KLTH0E08184g Chr5 complement(751459..752772) [1314 bp, 437 aa] {...    39   0.048
CAGL0J06512g Chr10 complement(622640..624277) [1638 bp, 545 aa] ...    39   0.051
Smik_14.148 Chr14 complement(275170..276837) [1668 bp, 555 aa] {...    39   0.052
NCAS0F00640 Chr6 complement(123774..124396,124484..125543) [1683...    39   0.052
SAKL0G08492g Chr7 (725684..727894) [2211 bp, 736 aa] {ON} simila...    39   0.053
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    39   0.053
TBLA0A09070 Chr1 complement(2236928..2238094) [1167 bp, 388 aa] ...    39   0.053
CAGL0G00704g Chr7 (65805..67127) [1323 bp, 440 aa] {ON} similar ...    39   0.054
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    39   0.054
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...    39   0.055
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    39   0.055
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    39   0.055
AAR102C Chr1 complement(526057..527832) [1776 bp, 591 aa] {ON} S...    39   0.057
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    39   0.059
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    39   0.060
KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} simila...    39   0.062
TPHA0D04170 Chr4 (894124..895845) [1722 bp, 573 aa] {ON} Anc_3.4...    39   0.063
KLLA0C06633g Chr3 (580349..582244) [1896 bp, 631 aa] {ON} simila...    39   0.065
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    39   0.067
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    39   0.068
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    39   0.068
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    39   0.068
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    39   0.069
YPR137W Chr16 (802359..804080) [1722 bp, 573 aa] {ON}  RRP9Prote...    39   0.069
Smik_1.70 Chr1 (138173..139459) [1287 bp, 428 aa] {ON} YAR003W (...    39   0.070
KAFR0F04190 Chr6 (822926..824110) [1185 bp, 394 aa] {ON} Anc_3.5...    39   0.070
Kpol_1036.22 s1036 (54759..57860) [3102 bp, 1033 aa] {ON} (54759...    39   0.071
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    39   0.072
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    39   0.072
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    39   0.072
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      39   0.072
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    39   0.073
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    39   0.075
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...    39   0.076
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    39   0.077
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    39   0.078
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    39   0.080
NCAS0F02940 Chr6 complement(582657..584924) [2268 bp, 755 aa] {O...    39   0.082
Suva_7.48 Chr7 complement(86451..87644) [1194 bp, 397 aa] {ON} Y...    39   0.082
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    39   0.082
KAFR0C01310 Chr3 (268850..271888) [3039 bp, 1012 aa] {ON} Anc_3....    39   0.083
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    38   0.085
KNAG0I01650 Chr9 (324016..325590) [1575 bp, 524 aa] {ON} Anc_1.3...    39   0.085
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    39   0.086
Kwal_27.10385 s27 (317980..319590) [1611 bp, 536 aa] {ON} YML102...    39   0.087
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    39   0.087
YAR003W Chr1 (155005..156285) [1281 bp, 426 aa] {ON}  SWD1Subuni...    38   0.087
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    38   0.088
TDEL0F03590 Chr6 (659038..660756) [1719 bp, 572 aa] {ON} Anc_3.4...    39   0.090
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    39   0.091
ZYRO0G20988g Chr7 complement(1723533..1726193) [2661 bp, 886 aa]...    39   0.091
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    39   0.091
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    38   0.093
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    39   0.094
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    39   0.10 
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    38   0.10 
Kpol_1050.100 s1050 (228171..229895) [1725 bp, 574 aa] {ON} (228...    38   0.10 
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...    38   0.10 
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    38   0.11 
ZYRO0B04444g Chr2 complement(363742..365469) [1728 bp, 575 aa] {...    38   0.11 
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    38   0.11 
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    38   0.11 
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    38   0.11 
Suva_1.74 Chr1 (131924..133210) [1287 bp, 428 aa] {ON} YAR003W (...    38   0.12 
Ecym_1039 Chr1 (72890..75073) [2184 bp, 727 aa] {ON} similar to ...    38   0.12 
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    38   0.12 
KLTH0G15620g Chr7 complement(1363249..1366056) [2808 bp, 935 aa]...    38   0.12 
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    38   0.12 
AER280C Chr5 complement(1148956..1150488) [1533 bp, 510 aa] {ON}...    38   0.12 
YKL121W Chr11 (214142..216700) [2559 bp, 852 aa] {ON}  DGR2Prote...    38   0.12 
Skud_14.152 Chr14 complement(286929..288704) [1776 bp, 591 aa] {...    38   0.13 
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    38   0.13 
NDAI0A04540 Chr1 complement(1023305..1025011) [1707 bp, 568 aa] ...    38   0.13 
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    38   0.13 
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    38   0.13 
ABL043W Chr2 (314670..316490) [1821 bp, 606 aa] {ON} Syntenic ho...    38   0.13 
TDEL0A01140 Chr1 complement(192604..194151) [1548 bp, 515 aa] {O...    38   0.13 
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    38   0.13 
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    38   0.13 
Skud_13.39 Chr13 (67722..69146) [1425 bp, 474 aa] {ON} YML102W (...    38   0.14 
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    37   0.14 
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    38   0.14 
Kpol_1050.56 s1050 (126134..127528,127531..127563,127565..128245...    38   0.15 
TDEL0D05940 Chr4 (1076418..1077710) [1293 bp, 430 aa] {ON} Anc_3...    37   0.15 
Kwal_26.8628 s26 (871377..872645) [1269 bp, 422 aa] {ON} YOR212W...    37   0.15 
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    37   0.15 
TPHA0G03110 Chr7 (661602..663428) [1827 bp, 608 aa] {ON} Anc_2.4...    38   0.15 
CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa] ...    38   0.16 
TPHA0A05850 Chr1 (1327076..1328374) [1299 bp, 432 aa] {ON} Anc_3...    37   0.16 
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    38   0.16 
NCAS0A00740 Chr1 (143564..144946) [1383 bp, 460 aa] {ON} Anc_1.1...    37   0.16 
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    38   0.16 
Skud_16.427 Chr16 (761681..763402) [1722 bp, 573 aa] {ON} YPR137...    38   0.16 
TPHA0D02150 Chr4 complement(441410..443737) [2328 bp, 775 aa] {O...    38   0.17 
Smik_13.32 Chr13 (64435..65841) [1407 bp, 468 aa] {ON} YML102W (...    37   0.17 
KLLA0E11177g Chr5 (983669..985150) [1482 bp, 493 aa] {ON} simila...    37   0.18 
Kwal_55.20233 s55 (311887..314130) [2244 bp, 747 aa] {ON} YDR324...    37   0.18 
TDEL0C02130 Chr3 (366855..368435) [1581 bp, 526 aa] {ON} Anc_7.3...    37   0.19 
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    37   0.20 
CAGL0J10340g Chr10 complement(1010761..1011777) [1017 bp, 338 aa...    37   0.20 
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    37   0.21 
Kpol_1044.27 s1044 complement(63632..65197) [1566 bp, 521 aa] {O...    37   0.21 
SAKL0C01188g Chr3 (104624..106948) [2325 bp, 774 aa] {ON} simila...    37   0.21 
TDEL0E02620 Chr5 (508356..510593) [2238 bp, 745 aa] {ON} Anc_5.3...    37   0.21 
NCAS0A11750 Chr1 (2335605..2337320) [1716 bp, 571 aa] {ON} Anc_3...    37   0.21 
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    37   0.22 
Ecym_1202 Chr1 complement(408312..409565,409631..409633) [1257 b...    37   0.24 
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    37   0.24 
Kpol_2002.54 s2002 complement(118705..125166) [6462 bp, 2153 aa]...    37   0.24 
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    37   0.24 
KAFR0G01170 Chr7 (265249..267603) [2355 bp, 784 aa] {ON} Anc_5.1...    37   0.25 
KLTH0H11286g Chr8 complement(965578..967500) [1923 bp, 640 aa] {...    37   0.25 
KLTH0B07040g Chr2 (567756..569276) [1521 bp, 506 aa] {ON} simila...    37   0.26 
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    37   0.26 
YHR186C Chr8 complement(475999..480672) [4674 bp, 1557 aa] {ON} ...    37   0.26 
CAGL0I07073g Chr9 complement(681102..682283) [1182 bp, 393 aa] {...    37   0.26 
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    37   0.27 
Kpol_2002.33 s2002 (67641..69998) [2358 bp, 785 aa] {ON} (67641....    37   0.27 
Kpol_1041.35 s1041 complement(87507..89612) [2106 bp, 701 aa] {O...    37   0.27 
YNL182C Chr14 complement(295960..297627) [1668 bp, 555 aa] {ON} ...    37   0.27 
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    37   0.28 
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    37   0.28 
Suva_14.159 Chr14 complement(292113..293789) [1677 bp, 558 aa] {...    37   0.29 
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    37   0.29 
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    37   0.29 
ZYRO0B15268g Chr2 complement(1243795..1244396,1244475..1245684) ...    37   0.29 
KAFR0C02420 Chr3 (471045..472484) [1440 bp, 479 aa] {ON} Anc_1.3...    37   0.30 
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    37   0.31 
Skud_16.142 Chr16 complement(261333..262718) [1386 bp, 461 aa] {...    37   0.31 
KLLA0B11077g Chr2 complement(970761..972464) [1704 bp, 567 aa] {...    37   0.32 
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    37   0.32 
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    36   0.32 
KNAG0A07760 Chr1 complement(1232666..1234366) [1701 bp, 566 aa] ...    37   0.33 
Suva_16.464 Chr16 (804728..806449) [1722 bp, 573 aa] {ON} YPR137...    37   0.33 
Suva_11.210 Chr11 (387997..388986) [990 bp, 329 aa] {ON} YKL018W...    36   0.34 
SAKL0E12892g Chr5 (1062422..1064002) [1581 bp, 526 aa] {ON} simi...    37   0.35 
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    37   0.35 
NCAS0A07270 Chr1 complement(1442956..1445355) [2400 bp, 799 aa] ...    37   0.36 
Suva_11.103 Chr11 (200612..203182) [2571 bp, 856 aa] {ON} YKL121...    37   0.37 
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    36   0.37 
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    36   0.38 
Skud_11.211 Chr11 (384964..385953) [990 bp, 329 aa] {ON} YKL018W...    36   0.38 
KLTH0D10054g Chr4 complement(835206..837818) [2613 bp, 870 aa] {...    37   0.39 
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    36   0.39 
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    37   0.39 
NDAI0G05990 Chr7 complement(1480864..1482261) [1398 bp, 465 aa] ...    36   0.39 
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    36   0.41 
ZYRO0D10516g Chr4 (883922..886171) [2250 bp, 749 aa] {ON} simila...    36   0.42 
Ecym_2240 Chr2 (470406..473900) [3495 bp, 1164 aa] {ON} similar ...    37   0.42 
YKL018W Chr11 (404102..405091) [990 bp, 329 aa] {ON}  SWD2Subuni...    36   0.43 
NCAS0G01830 Chr7 complement(326874..328520) [1647 bp, 548 aa] {O...    36   0.43 
Smik_5.221 Chr5 complement(332843..334507) [1665 bp, 554 aa] {ON...    36   0.44 
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    36   0.45 
Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to A...    36   0.46 
Kwal_23.5962 s23 complement(1391198..1392856) [1659 bp, 552 aa] ...    36   0.49 
TBLA0J01290 Chr10 (294789..296456) [1668 bp, 555 aa] {ON} Anc_7....    36   0.49 
Smik_11.237 Chr11 (391046..392035) [990 bp, 329 aa] {ON} YKL018W...    36   0.50 
Kwal_47.17093 s47 complement(245346..246860) [1515 bp, 504 aa] {...    36   0.50 
Kpol_1055.2 s1055 complement(663..2915) [2253 bp, 750 aa] {ON} c...    36   0.50 
TDEL0A02260 Chr1 (409508..412027) [2520 bp, 839 aa] {ON} Anc_2.4...    36   0.51 
NDAI0I02940 Chr9 (693605..694816) [1212 bp, 403 aa] {ON} Anc_3.5...    36   0.51 
Ecym_2695 Chr2 complement(1343162..1344724) [1563 bp, 520 aa] {O...    36   0.52 
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    36   0.52 
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    36   0.52 
Smik_8.275 Chr8 complement(450898..455568) [4671 bp, 1556 aa] {O...    36   0.53 
TBLA0B04670 Chr2 (1088358..1089392) [1035 bp, 344 aa] {ON} Anc_6...    36   0.53 
KLLA0E18063g Chr5 (1608371..1609351) [981 bp, 326 aa] {ON} highl...    35   0.54 
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    36   0.55 
Ecym_6170 Chr6 complement(316353..317675) [1323 bp, 440 aa] {ON}...    36   0.56 
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    36   0.56 
TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa]...    36   0.56 
Skud_4.99 Chr4 (170540..172108) [1569 bp, 522 aa] {ON} YDL156W (...    36   0.57 
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    36   0.57 
CAGL0B03289g Chr2 (319012..321624) [2613 bp, 870 aa] {ON} simila...    36   0.58 
CAGL0F01837g Chr6 (181178..182980) [1803 bp, 600 aa] {ON} simila...    36   0.58 
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    36   0.59 
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    36   0.60 
Suva_5.195 Chr5 complement(298871..300550) [1680 bp, 559 aa] {ON...    36   0.60 
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...    35   0.60 
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    36   0.61 
Kwal_23.4327 s23 (670568..675208) [4641 bp, 1546 aa] {ON} YHR186...    36   0.62 
KAFR0A03660 Chr1 (748252..750816) [2565 bp, 854 aa] {ON} Anc_1.3...    36   0.62 
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    36   0.62 
NCAS0B01020 Chr2 complement(161030..162634) [1605 bp, 534 aa] {O...    36   0.63 
NCAS0E00530 Chr5 (89654..90853) [1200 bp, 399 aa] {ON} Anc_3.526...    35   0.64 
KNAG0C05420 Chr3 (1059879..1062236) [2358 bp, 785 aa] {ON} Anc_5...    36   0.66 
Ecym_8020 Chr8 (52179..53834) [1656 bp, 551 aa] {ON} similar to ...    35   0.67 
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    35   0.67 
KNAG0B00550 Chr2 complement(90327..91658) [1332 bp, 443 aa] {ON}...    35   0.67 
NCAS0H03270 Chr8 (628484..630904) [2421 bp, 806 aa] {ON} Anc_2.6...    36   0.69 
SAKL0D07238g Chr4 complement(594187..596784) [2598 bp, 865 aa] {...    36   0.69 
KNAG0C00410 Chr3 (69301..71367) [2067 bp, 688 aa] {ON} Anc_1.34 ...    35   0.71 
YBR281C Chr2 complement(764970..767606) [2637 bp, 878 aa] {ON}  ...    36   0.71 
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    35   0.71 
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    35   0.72 
Suva_15.389 Chr15 complement(680068..684735) [4668 bp, 1555 aa] ...    36   0.74 
TPHA0A05040 Chr1 (1137120..1138359,1138450..1139051) [1842 bp, 6...    35   0.75 
NDAI0I01360 Chr9 complement(331085..332122) [1038 bp, 345 aa] {O...    35   0.76 
CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly...    35   0.78 
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    35   0.78 
Kpol_513.12 s513 complement(32164..36762) [4599 bp, 1532 aa] {ON...    35   0.79 
NDAI0A05790 Chr1 (1315884..1317374) [1491 bp, 496 aa] {ON}             35   0.79 
ACL099W Chr3 (165316..166389) [1074 bp, 357 aa] {ON} Syntenic ho...    35   0.79 
TDEL0G00730 Chr7 (147888..152492) [4605 bp, 1534 aa] {ON} Anc_5....    35   0.80 
KAFR0L01120 Chr12 complement(211027..212679) [1653 bp, 550 aa] {...    35   0.80 
NDAI0D02490 Chr4 (575553..577499) [1947 bp, 648 aa] {ON} Anc_5.104     35   0.82 
NDAI0C04390 Chr3 complement(993861..996212) [2352 bp, 783 aa] {O...    35   0.83 
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    35   0.84 
Skud_8.252 Chr8 complement(444916..449586) [4671 bp, 1556 aa] {O...    35   0.84 
KNAG0E02400 Chr5 (477698..480430) [2733 bp, 910 aa] {ON} Anc_2.4...    35   0.87 
KLLA0F26653g Chr6 (2461876..2464251) [2376 bp, 791 aa] {ON} simi...    35   0.87 
TPHA0O01610 Chr15 (319614..321224) [1611 bp, 536 aa] {ON} Anc_2....    35   0.88 
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...    35   0.88 
Kpol_534.25 s534 complement(58326..59444) [1119 bp, 372 aa] {ON}...    35   0.88 
ZYRO0E08602g Chr5 (687971..689242) [1272 bp, 423 aa] {ON} simila...    35   0.90 
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    35   0.90 
KLLA0A09471g Chr1 complement(827264..831784) [4521 bp, 1506 aa] ...    35   0.92 
TPHA0N01070 Chr14 complement(224464..225525) [1062 bp, 353 aa] {...    35   0.93 
SAKL0F11154g Chr6 (870446..871981) [1536 bp, 511 aa] {ON} simila...    35   0.94 
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    35   0.94 
NDAI0B04880 Chr2 complement(1193217..1195928) [2712 bp, 903 aa] ...    35   0.95 
KNAG0F02280 Chr6 complement(432897..433967) [1071 bp, 356 aa] {O...    35   0.95 
TBLA0I03300 Chr9 (802032..803279) [1248 bp, 415 aa] {ON} Anc_3.5...    35   0.95 
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    35   0.96 
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    35   0.98 
KNAG0D00440 Chr4 (64241..65488) [1248 bp, 415 aa] {ON} Anc_6.333...    35   1.0  
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    35   1.0  
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    35   1.0  
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    35   1.1  
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    35   1.1  
CAGL0I03542g Chr9 (299881..301485) [1605 bp, 534 aa] {ON} simila...    35   1.1  
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    35   1.1  
NDAI0A03090 Chr1 (692473..694143) [1671 bp, 556 aa] {ON} Anc_7.2...    35   1.1  
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    35   1.1  
Suva_3.173 Chr3 (262525..262587,262614..264791) [2241 bp, 746 aa...    35   1.1  
Ecym_2075 Chr2 (127773..129054,129182..129780) [1881 bp, 626 aa]...    35   1.1  
ZYRO0G09372g Chr7 (747001..749052) [2052 bp, 683 aa] {ON} simila...    35   1.2  
TDEL0F03030 Chr6 (545760..552173) [6414 bp, 2137 aa] {ON} Anc_1....    35   1.2  
Suva_4.89 Chr4 (162699..164267) [1569 bp, 522 aa] {ON} YDL156W (...    35   1.2  
KLLA0E18877g Chr5 complement(1676876..1680310) [3435 bp, 1144 aa...    35   1.2  
TBLA0A10190 Chr1 complement(2515833..2518256) [2424 bp, 807 aa] ...    35   1.2  
Kpol_1050.22 s1050 (54876..56171) [1296 bp, 431 aa] {ON} (54876....    35   1.2  
NDAI0A01990 Chr1 (442919..444508) [1590 bp, 529 aa] {ON} Anc_7.3...    35   1.3  
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    35   1.3  
KAFR0H02680 Chr8 (507660..510239) [2580 bp, 859 aa] {ON} Anc_8.6...    35   1.3  
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    35   1.3  
NCAS0B05410 Chr2 (1008672..1012064) [3393 bp, 1130 aa] {ON} Anc_...    35   1.4  
NCAS0D03490 Chr4 (650325..651362) [1038 bp, 345 aa] {ON} Anc_6.159     34   1.4  
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    35   1.4  
CAGL0L04950g Chr12 complement(564488..566905) [2418 bp, 805 aa] ...    35   1.4  
Skud_11.108 Chr11 (200902..203460) [2559 bp, 852 aa] {ON} YKL121...    35   1.4  
ACR194C Chr3 complement(690186..691727) [1542 bp, 513 aa] {ON} S...    34   1.5  
Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W...    34   1.5  
SAKL0F11022g Chr6 (863614..864504) [891 bp, 296 aa] {ON} highly ...    34   1.5  
NDAI0D00630 Chr4 (139065..139967) [903 bp, 300 aa] {ON} Anc_7.33...    34   1.5  
Kpol_1072.46 s1072 (103226..105850) [2625 bp, 874 aa] {ON} (1032...    35   1.6  
AER439W Chr5 (1476148..1476150,1476201..1477442) [1245 bp, 414 a...    34   1.6  
ADL135C Chr4 complement(454163..454761,454819..456085) [1866 bp,...    34   1.6  
KLLA0C01177g Chr3 (89978..92131) [2154 bp, 717 aa] {ON} similar ...    34   1.6  
TDEL0D05080 Chr4 (924017..927007) [2991 bp, 996 aa] {ON} Anc_3.1...    34   1.7  
Ecym_3389 Chr3 (736712..737695) [984 bp, 327 aa] {ON} similar to...    34   1.7  
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    35   1.7  
TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] ...    34   1.7  
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    34   1.7  
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    34   1.8  
CAGL0B00748g Chr2 (65727..68165) [2439 bp, 812 aa] {ON} similar ...    34   1.8  
TBLA0G03390 Chr7 complement(900177..902099) [1923 bp, 640 aa] {O...    34   1.8  
NCAS0D00540 Chr4 complement(85322..86953) [1632 bp, 543 aa] {ON}...    34   1.9  
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    34   1.9  
KAFR0A04420 Chr1 complement(881701..882768) [1068 bp, 355 aa] {O...    34   1.9  
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    34   1.9  
KLTH0B08800g Chr2 complement(712793..717340) [4548 bp, 1515 aa] ...    34   1.9  
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    34   2.0  
NCAS0B08910 Chr2 complement(1709752..1712469) [2718 bp, 905 aa] ...    34   2.0  
YGL100W Chr7 (313234..314283) [1050 bp, 349 aa] {ON}  SEH1Compon...    34   2.0  
TPHA0J01070 Chr10 complement(249880..251535) [1656 bp, 551 aa] {...    34   2.1  
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    34   2.1  
ABR101C Chr2 complement(567358..569841) [2484 bp, 827 aa] {ON} S...    34   2.1  
Smik_14.82 Chr14 (149174..150442) [1269 bp, 422 aa] {ON} YNL253W...    34   2.1  
KLTH0H11000g Chr8 complement(943669..946260) [2592 bp, 863 aa] {...    34   2.2  
ZYRO0G21736g Chr7 (1788792..1789856) [1065 bp, 354 aa] {ON} high...    33   2.2  
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    34   2.2  
Kwal_14.1235 s14 complement(247700..249523) [1824 bp, 607 aa] {O...    34   2.2  
TBLA0H01080 Chr8 complement(240857..242461) [1605 bp, 534 aa] {O...    34   2.2  
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    34   2.2  
KNAG0A07390 Chr1 complement(1156310..1157542) [1233 bp, 410 aa] ...    33   2.3  
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    33   2.4  
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    34   2.4  
Suva_23.1 Chr23 (204..2054) [1851 bp, 617 aa] {ON} YCR067C (REAL)      34   2.4  
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    34   2.4  
SAKL0B11836g Chr2 complement(1020766..1023195) [2430 bp, 809 aa]...    34   2.5  
TDEL0H01690 Chr8 (289748..291382) [1635 bp, 544 aa] {ON} Anc_7.2...    33   2.6  
TDEL0C06690 Chr3 complement(1221419..1223716) [2298 bp, 765 aa] ...    34   2.6  
TBLA0B01860 Chr2 complement(424732..427818) [3087 bp, 1028 aa] {...    34   2.6  
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    34   2.6  
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    33   2.6  
KLTH0G01650g Chr7 complement(121279..122466,122554..122556) [119...    33   2.7  
KLLA0F06754g Chr6 complement(650475..651509) [1035 bp, 344 aa] {...    33   2.7  
KLLA0F08811g Chr6 complement(819834..821744) [1911 bp, 636 aa] {...    33   2.7  
Smik_3.37 Chr3 (53956..56256) [2301 bp, 766 aa] {ON} YCL039W (REAL)    34   2.7  
TPHA0F00760 Chr6 (173015..174415) [1401 bp, 466 aa] {ON} Anc_4.1...    33   2.7  
SAKL0H07832g Chr8 (669398..671995) [2598 bp, 865 aa] {ON} simila...    34   2.7  
NCAS0E03500 Chr5 complement(694491..696143) [1653 bp, 550 aa] {O...    33   2.7  
Skud_5.201 Chr5 complement(318460..320142) [1683 bp, 560 aa] {ON...    33   2.8  
Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W (...    33   2.8  
Kpol_1061.35 s1061 (98864..100180) [1317 bp, 438 aa] {ON} (98864...    33   2.8  
YER082C Chr5 complement(324272..325936) [1665 bp, 554 aa] {ON}  ...    33   2.9  
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    33   2.9  
Kpol_1008.20 s1008 (39393..41141) [1749 bp, 582 aa] {ON} (39393....    33   2.9  
Kwal_33.14971 s33 (896070..898526) [2457 bp, 818 aa] {ON} YMR049...    33   2.9  
TDEL0D01740 Chr4 (346288..348957) [2670 bp, 889 aa] {ON} Anc_1.3...    33   2.9  
TBLA0E03460 Chr5 (859536..863192) [3657 bp, 1218 aa] {ON} Anc_3....    33   2.9  
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    33   2.9  
KLTH0B04136g Chr2 complement(335902..338352) [2451 bp, 816 aa] {...    33   3.0  
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...    33   3.0  
TBLA0B02480 Chr2 complement(569751..571400) [1650 bp, 549 aa] {O...    33   3.0  
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    33   3.1  
TDEL0B03950 Chr2 complement(709272..710306) [1035 bp, 344 aa] {O...    33   3.2  
Suva_13.218 Chr13 complement(352704..355115) [2412 bp, 803 aa] {...    33   3.3  
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    33   3.4  
Smik_13.276 Chr13 complement(435512..437359) [1848 bp, 615 aa] {...    33   3.4  
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    33   3.4  
KAFR0B00940 Chr2 (172801..174357) [1557 bp, 518 aa] {ON} Anc_7.3...    33   3.5  
Suva_3.105 Chr3 complement(150015..153692) [3678 bp, 1225 aa] {O...    33   3.6  
YCL039W Chr3 (52645..54882) [2238 bp, 745 aa] {ON}  GID7Protein ...    33   3.6  
SAKL0D09504g Chr4 (792974..794599) [1626 bp, 541 aa] {ON} highly...    33   3.6  
CAGL0J03344g Chr10 complement(324829..326460) [1632 bp, 543 aa] ...    33   3.7  
TBLA0B04000 Chr2 complement(913726..915084) [1359 bp, 452 aa] {O...    33   3.7  
TBLA0B04120 Chr2 (941318..943987) [2670 bp, 889 aa] {ON} Anc_8.6...    33   3.8  
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    33   3.9  
Suva_7.166 Chr7 (307962..309014) [1053 bp, 350 aa] {ON} YGL100W ...    33   4.0  
Skud_7.174 Chr7 (317467..318516) [1050 bp, 349 aa] {ON} YGL100W ...    33   4.0  
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    33   4.1  
KLLA0C16533g Chr3 complement(1448866..1450404) [1539 bp, 512 aa]...    33   4.1  
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    33   4.2  
SAKL0F09504g Chr6 complement(728890..730611) [1722 bp, 573 aa] {...    33   4.2  
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    33   4.2  
CAGL0D04884g Chr4 (475678..477369) [1692 bp, 563 aa] {ON} highly...    33   4.2  
Kpol_262.1 s262 (224..2131) [1908 bp, 635 aa] {ON} (224..2131) [...    33   4.4  
NDAI0F03380 Chr6 (813767..815455) [1689 bp, 562 aa] {ON} Anc_2.7...    33   4.5  
ZYRO0F00616g Chr6 (54556..56964) [2409 bp, 802 aa] {ON} similar ...    33   4.6  
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    33   4.6  
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    33   4.6  
ADL316C Chr4 complement(141605..145861) [4257 bp, 1418 aa] {ON} ...    33   4.7  
Skud_15.66 Chr15 complement(114566..117898) [3333 bp, 1110 aa] {...    33   4.9  
KAFR0C04445 Chr3 (882595..884274) [1680 bp, 559 aa] {ON}               33   4.9  
TBLA0D03080 Chr4 (741949..748887) [6939 bp, 2312 aa] {ON} Anc_1....    33   5.2  
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    33   5.2  
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...    33   5.2  
KAFR0B04210 Chr2 (874621..875803,875906..876507) [1785 bp, 594 a...    33   5.2  
Ecym_5584 Chr5 complement(1199282..1200238) [957 bp, 318 aa] {ON...    32   5.4  
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    32   5.4  
ADL054W Chr4 (586898..588772) [1875 bp, 624 aa] {ON} Syntenic ho...    33   5.5  
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...    32   5.5  
Ecym_1499 Chr1 complement(1025285..1027051) [1767 bp, 588 aa] {O...    33   5.5  
Suva_16.171 Chr16 complement(299070..300455) [1386 bp, 461 aa] {...    32   5.5  
TDEL0B07060 Chr2 complement(1243893..1246289) [2397 bp, 798 aa] ...    33   5.5  
KNAG0I02870 Chr9 (558973..562131) [3159 bp, 1052 aa] {ON} Anc_6....    33   5.6  
TPHA0G01890 Chr7 (392062..394737) [2676 bp, 891 aa] {ON} Anc_8.6...    33   5.6  
Skud_13.205 Chr13 complement(349265..351682) [2418 bp, 805 aa] {...    33   5.6  
NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON} ...    32   5.7  
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    33   5.9  
TBLA0B08220 Chr2 complement(1962086..1963405) [1320 bp, 439 aa] ...    32   5.9  
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    32   5.9  
TDEL0B07520 Chr2 complement(1320439..1321422) [984 bp, 327 aa] {...    32   6.0  
Smik_15.69 Chr15 complement(118407..121760) [3354 bp, 1117 aa] {...    33   6.1  
NDAI0E00410 Chr5 (72769..74559) [1791 bp, 596 aa] {ON} Anc_8.817...    32   6.2  
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    33   6.2  
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...    32   6.2  
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    32   6.2  
TBLA0A07380 Chr1 complement(1829567..1832275) [2709 bp, 902 aa] ...    32   6.5  
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    33   6.6  
KLTH0H12870g Chr8 (1098531..1100117) [1587 bp, 528 aa] {ON} simi...    32   6.7  
TDEL0F03510 Chr6 complement(647165..648505) [1341 bp, 446 aa] {O...    32   6.7  
KLLA0F16038g Chr6 complement(1487475..1490063) [2589 bp, 862 aa]...    32   6.7  
KAFR0D00320 Chr4 (46078..48531) [2454 bp, 817 aa] {ON} Anc_1.34 ...    32   6.7  
CAGL0J03564g Chr10 (340647..343736) [3090 bp, 1029 aa] {ON} simi...    32   6.9  
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    32   7.1  
Kpol_309.6 s309 complement(10739..12673) [1935 bp, 644 aa] {ON} ...    32   7.1  
KAFR0D01020 Chr4 (210874..212490) [1617 bp, 538 aa] {ON} Anc_8.4...    32   7.1  
NCAS0B07540 Chr2 complement(1422115..1424745) [2631 bp, 876 aa] ...    32   7.2  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    32   7.2  
YCR067C Chr3 complement(233125..236322) [3198 bp, 1065 aa] {ON} ...    32   7.2  
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    32   7.3  
Smik_6.325 Chr6 complement(511278..513968) [2691 bp, 896 aa] {ON...    32   7.3  
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    32   7.3  
SAKL0A05962g Chr1 complement(543144..544184) [1041 bp, 346 aa] {...    32   7.6  
KAFR0D03800 Chr4 complement(735667..736953) [1287 bp, 428 aa] {O...    32   7.7  
TBLA0A02500 Chr1 complement(599925..601844) [1920 bp, 639 aa] {O...    32   7.7  
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    32   7.7  
TPHA0I01180 Chr9 (274330..276999) [2670 bp, 889 aa] {ON} Anc_1.3...    32   7.8  
KLLA0B07667g Chr2 (667863..673862) [6000 bp, 1999 aa] {ON} some ...    32   8.1  
KLLA0C18491g Chr3 (1632791..1636387) [3597 bp, 1198 aa] {ON} sim...    32   8.2  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    32   8.3  
CAGL0M02805g Chr13 (317204..319822) [2619 bp, 872 aa] {ON} simil...    32   8.4  
KNAG0B02670 Chr2 (517131..518042) [912 bp, 303 aa] {ON} Anc_7.33...    32   8.4  
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    32   8.7  
NDAI0C00230 Chr3 (35404..36426) [1023 bp, 340 aa] {ON} Anc_2.657...    32   9.1  
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    32   9.1  
KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {O...    32   9.1  
ZYRO0D00748g Chr4 (56274..57251) [978 bp, 325 aa] {ON} highly si...    32   9.2  
TBLA0D04920 Chr4 complement(1202907..1204853) [1947 bp, 648 aa] ...    32   9.3  
Skud_3.141 Chr3 complement(217949..220924) [2976 bp, 991 aa] {ON...    32   9.3  
ADR331C Chr4 complement(1285562..1290250) [4689 bp, 1562 aa] {ON...    32   9.4  
Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W...    32   9.4  
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    32   9.5  
AGL154W Chr7 (407459..408943) [1485 bp, 494 aa] {ON} Syntenic ho...    32   9.7  
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    32   9.7  

>Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1881 bits (4873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 917/943 (97%), Positives = 917/943 (97%)

Query: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60
           MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV
Sbjct: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60

Query: 61  TTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGH 120
           TTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGH
Sbjct: 61  TTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGH 120

Query: 121 KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVST 180
           KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVST
Sbjct: 121 KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVST 180

Query: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGE 240
           SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGE
Sbjct: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGE 240

Query: 241 KLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIAXXXXXXX 300
           KLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIA       
Sbjct: 241 KLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIARGLKKRE 300

Query: 301 XXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNN 360
                   TDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNN
Sbjct: 301 KRLREKGLTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNN 360

Query: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVK 420
           TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVK
Sbjct: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVK 420

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           THKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS 540
           LTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS 540

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           WALAISTDGSFVVSSSHDHSIRIWEETEDQVF           QYEDTLLTSLEEGNGDD
Sbjct: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 721 AFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRKK 780
           AFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRKK
Sbjct: 721 AFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRKK 780

Query: 781 LGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAVM 840
           LGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAVM
Sbjct: 781 LGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAVM 840

Query: 841 QNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLGF 900
           QNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLGF
Sbjct: 841 QNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLGF 900

Query: 901 NVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFERVI 943
           NVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFERVI
Sbjct: 901 NVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFERVI 943

>Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1781 bits (4612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 849/943 (90%), Positives = 895/943 (94%)

Query: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60
           MVKSYQRFEQ+A FGVIASNANCVW+P SSRTN GSGPGQLITSALENVNIWDIKTGDL+
Sbjct: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60

Query: 61  TTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGH 120
            TLSDGLPPGASDA+GSKPAECTYLEVH+DT+LLAVGYADGVIKVWDL+SKTVLLNFNGH
Sbjct: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 121 KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVST 180
           KAAITL+QFDSTGTRLISGS+DSNIIVWDLVGEVGLYKLRSHKD ITG WCQGEDWL+ST
Sbjct: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180

Query: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGE 240
           SKDG+IK+WDLKTQQCIETHIAHTGECW L+VKDDLLITT TDSQVKIWKLNMEN+KMGE
Sbjct: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240

Query: 241 KLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIAXXXXXXX 300
           KLTE+G+FEKQSKQRGLK+EFITNASDGVSFFYIQNADKTIET+RIRKEEEIA       
Sbjct: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIARGLKKRE 300

Query: 301 XXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNN 360
                   TDEEI++SIK SYSSL+LHPFQT+RS YK+KSASWTTVTSSKLELV+TTSNN
Sbjct: 301 KRLREKGLTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360

Query: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVK 420
           TIEYYSIPYEKR+ TSPAPLKTHTIELQGQRTDVRSID+SDDNKLLATASNGSLKIWNVK
Sbjct: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           THKCIRTFECGYAL+CKFLPGGLLVILGTR+GELQLFDLASSSLLDT+EDAHDAAIWSLD
Sbjct: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS 540
           LTSDGKRLVTGSADKTVKFWDFQVE TLVPGTKDK +PMLKLNHDTTLELNDDILSVRIS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           WALAI+++GSFVVSSSHDHSIRIWEETEDQVF           QYEDTLL SLEEGN DD
Sbjct: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLASLEEGNADD 720

Query: 721 AFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRKK 780
           AFKGDA GE+VEDEASGVHKQTLESLKAGE+LMEALD+GIA+IEGME YNKDM+LWQRKK
Sbjct: 721 AFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRKK 780

Query: 781 LGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAVM 840
           LGEAPMKPQGNSVLIAV KTPEQYI+DTLSRIR SQLEDALMVMPFSYVLKFLKF D VM
Sbjct: 781 LGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTVM 840

Query: 841 QNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLGF 900
           QNKTLLH+HLPL+C+NLFFIIKFNHKEL+SQKNEELKLQINRVKTELRNALKSTEDDLGF
Sbjct: 841 QNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLGF 900

Query: 901 NVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFERVI 943
           NVQGLKFI+QQWNL+HNYEFVDEYDQQEKEN+SARKRVFE VI
Sbjct: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETVI 943

>Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1771 bits (4586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 846/943 (89%), Positives = 898/943 (95%)

Query: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60
           MVKSYQRFEQ+A+FGVIASNANCVW+PASSRT +GSGPGQLITSALENVN+WDIKTGDL+
Sbjct: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60

Query: 61  TTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGH 120
           +TLSDGLPPGASDA+G+KPAECTYLEVHQDT+LLAVGYADGVIKVWDL+SKTVLLNFNGH
Sbjct: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 121 KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVST 180
           KAAITL+QFD TGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKD+ITGFWCQGEDWL+ST
Sbjct: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180

Query: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGE 240
           SKDG+IK+WDLKTQQCIETHIAHTGECWGL+VKDDLLITT TDSQVK+WKLN+EN+K+G 
Sbjct: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240

Query: 241 KLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIAXXXXXXX 300
           KLTEMG FEKQSKQRGLKIEFITN SDG SFFYIQNADKTIE +RIRKEEEIA       
Sbjct: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTIEIFRIRKEEEIARGLKKRE 300

Query: 301 XXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNN 360
                   TDEEI+KSIKDSYSSLILHPFQTVRSLYKIKSASWTT+TSSKLELV+TTSNN
Sbjct: 301 KRLREKGLTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360

Query: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVK 420
           TIEYYSIPYEKR+PTSPAPLKTHTIELQGQRTD+RSID+SDDN+LLATASNGSLKIWNVK
Sbjct: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           THKCIRTFECGYALTCKFLPGGLLVILGTR+GELQLFDLASSSLLDTIEDAHDAAIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS 540
           LTSDGKRLVTGSADKTVKFWDFQVE TLVPGTKDKF+P+LKLNHDTTLELNDDILS+RIS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           WALAISTDGSFVVSSSHDHSIRIWEETEDQVF           QYEDTLLTSLEEGNGDD
Sbjct: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 721 AFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRKK 780
           AFKGDATGE+V+DE SGVHKQTLESLKAGE+LMEALDLGIAEIEG+E Y++DMKLWQRKK
Sbjct: 721 AFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRKK 780

Query: 781 LGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAVM 840
           LGEAP+KPQGNSVLIAV KTPEQYIMDTL RIR+SQLEDALMVMPFSYVLKFLKF D++M
Sbjct: 781 LGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSIM 840

Query: 841 QNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLGF 900
           QNK+LLH+HLPLICKNLFFIIKFNHKEL+SQKNEELK Q++RVKTELRNALKSTEDDLGF
Sbjct: 841 QNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLGF 900

Query: 901 NVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFERVI 943
           NVQGLKFI+QQWNL+HNYEFVDEYDQQEKE+  ARKR FE V+
Sbjct: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETVV 943

>YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}
           DIP2Nucleolar protein, specifically associated with the
           U3 snoRNA, part of the large ribonucleoprotein complex
           known as the small subunit (SSU) processome, required
           for 18S rRNA biogenesis, part of the active pre-rRNA
           processing complex
          Length = 943

 Score = 1752 bits (4538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 839/943 (88%), Positives = 891/943 (94%)

Query: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60
           MVKSYQRFEQAAAFGVIASNANCVWIPASS  +NGSGPGQLITSALE+VNIWDIKTGDLV
Sbjct: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSGNSNGSGPGQLITSALEDVNIWDIKTGDLV 60

Query: 61  TTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGH 120
           + LSDGLPPGASDA+G+KPAECTYLE H+DT+LLAVGYADGVIKVWDL+SKTVLLNFNGH
Sbjct: 61  SKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 121 KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVST 180
           KAAITL+QFD TGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKD+ITGFWCQGEDWL+ST
Sbjct: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180

Query: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGE 240
           SKDG+IK+WDLKT QCIETHIAHTGECWGLAVKDDLLITT TDSQVKIWKL++EN+KMG 
Sbjct: 181 SKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKLDIENDKMGG 240

Query: 241 KLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIAXXXXXXX 300
           KLTEMGIFEKQSKQRGLKIEFITN+SD  SFFYIQNADKTIET+RIRKEEEIA       
Sbjct: 241 KLTEMGIFEKQSKQRGLKIEFITNSSDKTSFFYIQNADKTIETFRIRKEEEIARGLKKRE 300

Query: 301 XXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNN 360
                   T+EEI+KSIK+SYSS ILHPFQT+RSLYKIKSASWTTV+SSKLELV+TTS+N
Sbjct: 301 KRLKEKGLTEEEIAKSIKESYSSFILHPFQTIRSLYKIKSASWTTVSSSKLELVLTTSSN 360

Query: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVK 420
           TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSID+SDDNKLLATASNGSLKIWN+K
Sbjct: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNIK 420

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           THKCIRTFECGYALTCKFLPGGLLVILGTR+GELQLFDLASSSLLDTIEDAHDAAIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS 540
           LTSDGKRLVTGSADKTVKFWDF+VE +LVPGTK+KF+P+LKL+HDTTLEL DDIL VR+S
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVS 540

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIM+VKFLP+SHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           WALA++TDG FVVSSSHDHSIRIWEETEDQVF           QYEDTLLTSLEEGNGDD
Sbjct: 661 WALAVATDGGFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 721 AFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRKK 780
           AFK DA+GE VEDEASGVHKQTLESLKAGE+LMEALDLGIAEIEG+E YN+DMKLWQRKK
Sbjct: 721 AFKADASGEGVEDEASGVHKQTLESLKAGERLMEALDLGIAEIEGLEAYNRDMKLWQRKK 780

Query: 781 LGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAVM 840
           LGEAP+KPQGN+VLIAV KTPEQYIMDTL RIR SQLEDALMVMPFSYVLKFLKF D VM
Sbjct: 781 LGEAPIKPQGNAVLIAVNKTPEQYIMDTLLRIRMSQLEDALMVMPFSYVLKFLKFIDTVM 840

Query: 841 QNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLGF 900
           QNKTLLH+HLPLICKNLFFIIKFNHKEL+SQKNEELKLQINRVKTELR+ALKSTEDDLGF
Sbjct: 841 QNKTLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKLQINRVKTELRSALKSTEDDLGF 900

Query: 901 NVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFERVI 943
           NVQGLKF++QQWNL+HNYEFVDEYDQQEKE+ SARKRVF  VI
Sbjct: 901 NVQGLKFVKQQWNLRHNYEFVDEYDQQEKESNSARKRVFGTVI 943

>NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {ON}
           Anc_8.324
          Length = 983

 Score = 1471 bits (3809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 701/959 (73%), Positives = 825/959 (86%), Gaps = 19/959 (1%)

Query: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60
           MVKSYQRFEQA+ FGVI+SN+NCVW+P++S  +  S PGQ+IT ALENVNIWD+KTG+L 
Sbjct: 28  MVKSYQRFEQASVFGVISSNSNCVWLPSTS--SKKSHPGQIITGALENVNIWDLKTGELA 85

Query: 61  TTLSDGL--PPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFN 118
           + L+DGL  PPG+ DAK SKPAE T+L+ H++TNLLAVGY DGV+KVWDL SKTVL N N
Sbjct: 86  SFLNDGLVPPPGSVDAKSSKPAETTFLQHHKETNLLAVGYNDGVVKVWDLYSKTVLCNLN 145

Query: 119 GHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWC------- 171
           GH +AIT ++FD++GTRLISGS+DSNIIVWDLV EVGLYKLRSHKDAITG WC       
Sbjct: 146 GHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTNNN 205

Query: 172 QGE---DWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKI 228
           Q E   DWL+STSKDGLIKIWDLK QQC+ETHIAHTGECW LAV++DL+ITTS+DSQVK 
Sbjct: 206 QEENELDWLISTSKDGLIKIWDLKIQQCVETHIAHTGECWSLAVRNDLVITTSSDSQVKF 265

Query: 229 WKLNMENEKM--GEKLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRI 286
           W+L+++++ +  G KL E GI+EKQSKQRGL +EFI ++ DGV FF IQNAD+T+E +R+
Sbjct: 266 WQLSLQDDTVPNGSKLIEKGIYEKQSKQRGLNVEFI-DSIDGVGFFLIQNADRTVEIFRL 324

Query: 287 RKEEEIAXXXXXXXXXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTV 346
           RKEEEI+               T +EI KS++DS+ S+++HPFQ +RS+YK+K+A+WT  
Sbjct: 325 RKEEEISKALKKREKRLTEKGMTPDEIKKSLEDSFVSMMMHPFQIIRSIYKVKAATWTIA 384

Query: 347 TSSKLELVVTTSNNTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLL 406
           TS+KLEL VTT+NNTIEYYSIPYEKR+PT P   K + +ELQGQRTD+RSID+SDDNKLL
Sbjct: 385 TSTKLELTVTTANNTIEYYSIPYEKREPTQPIANKLYNVELQGQRTDIRSIDISDDNKLL 444

Query: 407 ATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLD 466
           ATASNGSLKIWN+KT  CIRTFECGYALTCKFLPGG+LVI+GTR+GELQLFDLASS+ + 
Sbjct: 445 ATASNGSLKIWNLKTKLCIRTFECGYALTCKFLPGGMLVIIGTRAGELQLFDLASSTQIA 504

Query: 467 TIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDT 526
            IE+AHDAAIWSLDLTSDGKRL+TGSADK+VKFW+FQ+E+ LVPGT DKFVP L L+HDT
Sbjct: 505 NIEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDT 564

Query: 527 TLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
           TLEL+DDILSVR+SP+D++LA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDISFDSK
Sbjct: 565 TLELSDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSK 624

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEK 646
           MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM+VKF+PESHNFFSCSKD ++KYWDG+K
Sbjct: 625 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDK 684

Query: 647 FECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYE 706
           FECIQKL AHQSEVWALAI+ D SFVVSSSHDHSIRIWEETED+VF           QYE
Sbjct: 685 FECIQKLAAHQSEVWALAIANDASFVVSSSHDHSIRIWEETEDEVFLEEERDKEMEEQYE 744

Query: 707 DTLLTSLEEGNGDDAFKGDATGE-NVE-DEASGVHKQTLESLKAGEKLMEALDLGIAEIE 764
           DTLL SLEEGNGDDAFKGD  G  NVE DEA+ VHKQT+ESLKAGE+LMEA DLG+AEIE
Sbjct: 745 DTLLASLEEGNGDDAFKGDTKGATNVEFDEATDVHKQTMESLKAGERLMEAFDLGMAEIE 804

Query: 765 GMEMYNKDMKLWQRKKLGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVM 824
             E Y+K++KLWQRKK GE P+KPQGN++LIA+KKTPE+YIMDTL RI+ SQLEDAL+V+
Sbjct: 805 SFEEYDKNLKLWQRKKTGEPPIKPQGNAILIAIKKTPEEYIMDTLIRIKPSQLEDALLVL 864

Query: 825 PFSYVLKFLKFTDAVMQNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVK 884
           PFSYVLKFLKF + V+ NK +L+NHL LICKNLFFI+K NHKEL+SQKNE LKLQI +VK
Sbjct: 865 PFSYVLKFLKFINIVIGNKKMLNNHLALICKNLFFIVKSNHKELVSQKNEVLKLQITKVK 924

Query: 885 TELRNALKSTEDDLGFNVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFERVI 943
            ELRNALK+ EDDLGFN+QG+KFI+QQWNL+HN EFVDEYDQ+  E+  A+KR F  ++
Sbjct: 925 NELRNALKANEDDLGFNIQGMKFIKQQWNLRHNLEFVDEYDQKSHEDKMAKKRTFGTLV 983

>SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 941

 Score = 1448 bits (3749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 683/947 (72%), Positives = 812/947 (85%), Gaps = 10/947 (1%)

Query: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60
           MVKSYQRFEQ +AFGVI+SN NCVWI + +R   GS  GQ++T ALENVN WDIKTG+L 
Sbjct: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASRNR---GSA-GQILTGALENVNCWDIKTGELS 56

Query: 61  TTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGH 120
             L+DGLPPGA DAK +K AE TYL+ H +TNLLAVGYADGVIK+WDL+SKTVL+NFNGH
Sbjct: 57  KILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGH 116

Query: 121 KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVST 180
           K+AIT+++FD TGTRLISGSKDS+II+WDLVGEVGLYKLRSHKD+ITG WC+ EDWL+ST
Sbjct: 117 KSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLIST 176

Query: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGE 240
           SKDGLIKIWDLKTQQC+ETH+AHT ECWGLA+ +DL+ITTST+SQ+KIW L+++ + MG 
Sbjct: 177 SKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKD-MGS 235

Query: 241 KLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIAXXXXXXX 300
           KL E GI+EKQSKQRG+ +EFIT  SDGV+FFYIQNADKT+E +R+R +EEI+       
Sbjct: 236 KLIEKGIYEKQSKQRGVSVEFIT-TSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKRE 294

Query: 301 XXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNN 360
                    DE+I ++IKDSY S+I+HPFQT+RS +KIK+A+W   T+SKLE+V+TTSNN
Sbjct: 295 KRLRDKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNN 354

Query: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVK 420
           T+EYYSIPY+KR+PT PAP K +TIELQG RTDVRSID+SDDNKLLATASNG+LKIWN+K
Sbjct: 355 TVEYYSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIK 414

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           TH CIRTFECGYALTCKFLPGG LV++G R G+LQLFDLASS+LL+  EDAH AAIWSLD
Sbjct: 415 THACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLD 474

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS 540
           LTSDGKRLVTGSADKTVKFWDF+V++ L+PGT DKFVP LK+ HDTTLELNDDIL+V+IS
Sbjct: 475 LTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS 534

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
            D+++LA+SLLDNTVKVFFL+SMKF+LSLYGHKLPVLSIDISFDSK++ITSSADKNIKIW
Sbjct: 535 SDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIW 594

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIMSVKF+PESHNFFSCSKD +VKYWDG+KFEC+QKL AHQSEV
Sbjct: 595 GLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEV 654

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           WALAIS D  FVVS+SHDHSIR+WEETED+VF           QYE+TLL SLE G+GDD
Sbjct: 655 WALAISNDARFVVSTSHDHSIRVWEETEDEVFLEEEREKEMDEQYENTLLHSLEAGSGDD 714

Query: 721 AFKGDATGEN----VEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLW 776
            F+ D  G      + D+A+ VHKQT+ESLKAGE+++EALDLGIA IE  E Y K++K W
Sbjct: 715 NFQRDIEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDW 774

Query: 777 QRKKLGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFT 836
           Q+KK GE P KPQ N++L+A+KK PEQYIM+TL +IR SQLEDAL+V+PFSYVL FLKF 
Sbjct: 775 QKKKSGEPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFI 834

Query: 837 DAVMQNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTED 896
           D V+++K + +NHL LICK LFFIIK N++EL++QKNEELKLQINRVK ELR ALK   D
Sbjct: 835 DVVIKDKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNAD 894

Query: 897 DLGFNVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFERVI 943
           DLGFNVQGLKFIRQQWNL+HN EFVD+YDQ+++E  + +KR+FE ++
Sbjct: 895 DLGFNVQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETLV 941

>NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {ON}
           Anc_8.324 YLR129W
          Length = 958

 Score = 1433 bits (3710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 695/963 (72%), Positives = 807/963 (83%), Gaps = 25/963 (2%)

Query: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60
           MVKSYQRFEQ + FGVI SN+NC+W+P+ S  N  + PGQ+ITSALEN+NIWDIKTG+L 
Sbjct: 1   MVKSYQRFEQESVFGVINSNSNCIWLPSDS--NPSTSPGQIITSALENINIWDIKTGELS 58

Query: 61  TTLSDGL--PPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFN 118
           + L D L  PPG+ DAK +KPAE TYL+ H+DTNLLAVGY DGVIKVWDL SKTVL N N
Sbjct: 59  SHLIDSLIPPPGSIDAKSTKPAETTYLQHHKDTNLLAVGYNDGVIKVWDLYSKTVLCNLN 118

Query: 119 GHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQ-----G 173
           GH +AIT+++FDSTGTRLISGS+DSNIIVWDLV EVGLYKLRSHKDAITG WC      G
Sbjct: 119 GHSSAITVLKFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEMQNNG 178

Query: 174 ED------WLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVK 227
           ED      WL+STSKDGLIKIWDLK QQCIETHIAHTGECW +AV++DLLITTS+DSQ+K
Sbjct: 179 EDDENELDWLISTSKDGLIKIWDLKIQQCIETHIAHTGECWSVAVRNDLLITTSSDSQIK 238

Query: 228 IWKLNMENEKMGE--KLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYR 285
           IW+LN++N+  G+  KL E GI+EKQSKQRGL IEFI  A D   FFYIQNADKT+E +R
Sbjct: 239 IWELNLDNDDDGKNKKLIEKGIYEKQSKQRGLSIEFIDTA-DETGFFYIQNADKTVEIFR 297

Query: 286 IRKEEEIAXXXXXXXXXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTT 345
           +RK++EI                T E+I ++IKDSY SLI+HPFQ VRS+YKIK+ +WT 
Sbjct: 298 LRKQDEINKAIKKRTKRLTEKGMTPEDIEQNIKDSYISLIMHPFQIVRSIYKIKAVTWTI 357

Query: 346 VTSSKLELVVTTSNNTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKL 405
            T SKLEL +TTSNNTIEYYS PYEKR+PT P P K HTIELQGQRTD+RSID+SDDNKL
Sbjct: 358 ATPSKLELCLTTSNNTIEYYSTPYEKREPTQPTPNKLHTIELQGQRTDIRSIDISDDNKL 417

Query: 406 LATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLL 465
           LATASNG LKIWN+KT  CIRTFECGY+LTCKFLPGG LVI+GTR GELQLFDLASS+LL
Sbjct: 418 LATASNGLLKIWNIKTKSCIRTFECGYSLTCKFLPGGTLVIVGTRGGELQLFDLASSTLL 477

Query: 466 DTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHD 525
           +TIEDAHDAAIWSLDLTSDGKRLVTGSADK+VKFWDFQ+E+ LV GT DK++P LKL HD
Sbjct: 478 ETIEDAHDAAIWSLDLTSDGKRLVTGSADKSVKFWDFQLEQELVAGTVDKYLPKLKLFHD 537

Query: 526 TTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDS 585
           TTLELNDDILSV+ISP+D++LA+SLLDNTVKVFF+D+MKF+LSLYGHKLPVLSIDISFDS
Sbjct: 538 TTLELNDDILSVKISPEDKFLAVSLLDNTVKVFFMDTMKFFLSLYGHKLPVLSIDISFDS 597

Query: 586 KMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGE 645
           K+IITSSADKNIKIWGLDFGDCHKSLFAHQDSIM+VKF+PESHNFFSCSKD ++KYWDG+
Sbjct: 598 KLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGLIKYWDGD 657

Query: 646 KFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQY 705
           KFECIQKL  HQSEVW++AI+ D SF+VSSSHDHSIRIWEETED+VF            Y
Sbjct: 658 KFECIQKLAGHQSEVWSIAIANDASFIVSSSHDHSIRIWEETEDEVFLEEEREKELEELY 717

Query: 706 EDTLLTSLEEGNGDDAFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEG 765
           EDTLLTSLEE NGDDAFK D  GE+ +DEA+ VHKQT+ESLKA E+LMEA DLG+ EIE 
Sbjct: 718 EDTLLTSLEEDNGDDAFKKDG-GED-KDEATDVHKQTMESLKASERLMEAFDLGMKEIEA 775

Query: 766 MEMYNKDMKLWQRKKLGE-----APMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDA 820
           ME Y +++K WQRK          P+KPQGN++L+A+KKTPE+YIMDTL RI+ SQLEDA
Sbjct: 776 MEEYERELKNWQRKDSNNKATQTVPIKPQGNAILLAIKKTPEEYIMDTLVRIKPSQLEDA 835

Query: 821 LMVMPFSYVLKFLKFTDAVMQNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQI 880
           L+V+PFSY++KFLKF D V+ +K +L+NHLPLIC+ LFFI+K NHKEL+SQKNEELK QI
Sbjct: 836 LLVLPFSYIIKFLKFIDIVINSKKILNNHLPLICRILFFIVKSNHKELVSQKNEELKSQI 895

Query: 881 NRVKTELRNALKSTEDDLGFNVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFE 940
            RVK  LRNALK+ EDDLGFN+QGLKFI+QQW LKHNYE+VD+ DQ+ +E   A+KR F 
Sbjct: 896 TRVKDNLRNALKNNEDDLGFNIQGLKFIKQQWKLKHNYEYVDDQDQKAQEAKFAKKRTFG 955

Query: 941 RVI 943
            +I
Sbjct: 956 TII 958

>Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON}
           (189457..192267) [2811 nt, 937 aa]
          Length = 936

 Score = 1408 bits (3645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 663/940 (70%), Positives = 799/940 (85%), Gaps = 9/940 (0%)

Query: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60
           MVKSYQRFEQA+ FGVI++NANCVW+   S+ +N   PG +ITSALEN+NIWDIKTG+L+
Sbjct: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNS--PGSVITSALENINIWDIKTGELI 58

Query: 61  TTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGH 120
           + LSDGLP G+ D K SKPAE +YL  H +TNLLA GY DG IKVWDL+SK+VLL FNGH
Sbjct: 59  SVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGH 118

Query: 121 KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVST 180
           K+AIT+M+FD TGTRLISGS+DSNIIVWDLV EVGLYKLRSHKDAI+G WC+GEDWLVST
Sbjct: 119 KSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVST 178

Query: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGE 240
           SKDGLIKIWDLK QQCIETHIAHTGECW + V +DLLIT+  D+Q+K+W L+   E  G 
Sbjct: 179 SKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKE-AGS 237

Query: 241 KLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIAXXXXXXX 300
           KL E G+++KQSKQRGL I+F + A +G +FFYIQNADKT E +RIR+EEEI+       
Sbjct: 238 KLIEKGVYDKQSKQRGLDIKF-SVAPNGTAFFYIQNADKTTEVFRIRREEEISKALKKRE 296

Query: 301 XXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNN 360
                   TDEEI ++IK+SYSS+I+HPFQ ++S YKIKS S+TTV+++KLE VVTTS+N
Sbjct: 297 KRLKEKGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSN 356

Query: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVK 420
           +IEYYSIPYEKRDPTSPAP + +TIEL G RTD+RS+D+SDD+KLLATASNG LK+WN+K
Sbjct: 357 SIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLK 416

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           T  CIR F+CGYALTCKFLPGG LVI+GTR G LQLFDLASS+LL+  EDAH+ AIWSLD
Sbjct: 417 TKACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLD 476

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS 540
           +TSDG+RLVTGSADKT+KFW+FQVE+ LVPGT DK++P++KL HDTT+E+N+D+LSVRIS
Sbjct: 477 ITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRIS 536

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           P+D++LAISLLDNTVKVF+LDSMKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIKIW
Sbjct: 537 PEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIM+VKFLPESHNFFS SKD +VKYWDG+KFECIQKL AHQSEV
Sbjct: 597 GLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEV 656

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           W++AI++DG+ V+S+SHDHS+R+WEET+DQVF           QYEDTLL SLEEG+GDD
Sbjct: 657 WSIAITSDGTSVISASHDHSLRVWEETDDQVFLEEEREKELEEQYEDTLLASLEEGSGDD 716

Query: 721 AFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRKK 780
           AFKGDA  E VEDE++ V  QT+ESLKAGE+LMEALDLG++EIE  E Y  DMK W++KK
Sbjct: 717 AFKGDA--EKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKK 774

Query: 781 -LGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAV 839
             GE P+KPQGN++LIA+KK P +YIM+TL +I+ SQLEDAL+V+PFSYVLK LKF D V
Sbjct: 775 SSGEPPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIV 834

Query: 840 MQNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLG 899
           M++K +  N+L LICKNLFF+I+ NHKELISQ+NE LK QI  VK  LR++L+   DDLG
Sbjct: 835 MKDKKMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLG 894

Query: 900 FNVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVF 939
           FN+QGLKFI+QQWNLKHN++F D++D+  KE +S +KR+F
Sbjct: 895 FNIQGLKFIKQQWNLKHNFDFTDDFDK--KEESSGKKRIF 932

>TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.324
           YLR129W
          Length = 938

 Score = 1395 bits (3610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 652/944 (69%), Positives = 794/944 (84%), Gaps = 7/944 (0%)

Query: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60
           MVKSYQRFEQ+A+FGVI+SN+NCV+IP ++R     G GQ++T  LE VN+WD+KTGDLV
Sbjct: 1   MVKSYQRFEQSASFGVISSNSNCVYIPPANR----KGLGQVLTGGLEKVNLWDLKTGDLV 56

Query: 61  TTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGH 120
           + LSDGLPPG+ DAK +KPAE TYLE H +TNLLAVGYA+GVIKVWDL+SKTVLL  NGH
Sbjct: 57  SCLSDGLPPGSIDAKSTKPAETTYLEYHAETNLLAVGYAEGVIKVWDLMSKTVLLTLNGH 116

Query: 121 KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVST 180
           K+A+T+++FD TGTRLISGS+DSNII+WDL+GEVGLYKLRSHK AI+G W + ++WL+ST
Sbjct: 117 KSAVTILKFDITGTRLISGSQDSNIIMWDLIGEVGLYKLRSHKGAISGLWLEKDEWLIST 176

Query: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGE 240
           S+DGLIK+WDLKTQQC+ETHIAHTGECW L V +DL IT S DSQVKIW LN E+E  G 
Sbjct: 177 SRDGLIKVWDLKTQQCVETHIAHTGECWSLGVHEDLAITASADSQVKIWHLNFESE-AGS 235

Query: 241 KLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIAXXXXXXX 300
           KL E GI+EKQS QRG  IEF+T  +D  +FFYIQNADK+IE +RIRKEEEI        
Sbjct: 236 KLIEKGIYEKQSNQRGSSIEFVTT-TDETTFFYIQNADKSIEIFRIRKEEEILKATRKRE 294

Query: 301 XXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNN 360
                   +DEEI ++I+D Y S+I+HPFQ +RS +K+K+A+W   T+SKL+LVVTT++N
Sbjct: 295 KRLKEKGLSDEEIKQNIQDGYISMIMHPFQILRSNFKVKAAAWGQATASKLDLVVTTASN 354

Query: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVK 420
           T+EYY+IPYEKR+P  PAP + H++ELQG RTDVR++D+S+D+ LLATASNG+LK+WN+K
Sbjct: 355 TVEYYTIPYEKREPKLPAPNRLHSVELQGHRTDVRAMDISNDSSLLATASNGTLKVWNLK 414

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           T  C+RTF+CGYAL C+FLPGG L+++GTR+G+LQLFDLASS++LD  E AHDAAIWSLD
Sbjct: 415 TRMCLRTFDCGYALCCRFLPGGFLIVVGTRNGDLQLFDLASSTMLDNKEGAHDAAIWSLD 474

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS 540
           +TSDGK+LVTGSADK+VKFW FQVEK L+ GT DKF P++KL+HDTTLELNDD+LSVRIS
Sbjct: 475 ITSDGKKLVTGSADKSVKFWKFQVEKDLIAGTVDKFAPVMKLSHDTTLELNDDVLSVRIS 534

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           P+D+Y AISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK+IITSSADKNIKIW
Sbjct: 535 PEDKYFAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKVIITSSADKNIKIW 594

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKD +VKYWDG+KFECIQKL  HQSEV
Sbjct: 595 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDGLVKYWDGDKFECIQKLAGHQSEV 654

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           WALAIS +G +VVS+SHD SIRIWEETEDQVF           Q E  LL+SLEEG+GD 
Sbjct: 655 WALAISNNGKYVVSASHDRSIRIWEETEDQVFLEEEREKELEEQNETALLSSLEEGSGDA 714

Query: 721 AFKGDATGENV-EDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRK 779
           AF+ D  G+   +DEA+ V KQT+ESLKAGE+LMEALDLGI EIE  E Y K++K W + 
Sbjct: 715 AFRKDVGGDEADQDEAADVRKQTIESLKAGERLMEALDLGIPEIENREHYEKELKAWNKH 774

Query: 780 KLGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAV 839
           K    P+KP GN++L A+ KTPE+YI++TL+RI+ SQLEDAL+V+PFSYVLKF +F DA 
Sbjct: 775 KGDAKPVKPPGNAILTAISKTPEEYILETLARIKPSQLEDALLVLPFSYVLKFFRFIDAA 834

Query: 840 MQNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLG 899
           + +  +L ++LPLICKNLFFI+K NH+EL+SQKNEELKL+I +VK  LR ALKS EDDLG
Sbjct: 835 LLDNRILQHNLPLICKNLFFIVKSNHRELVSQKNEELKLRIAKVKDLLRGALKSNEDDLG 894

Query: 900 FNVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFERVI 943
           FN++GLKFIR+QW+L+H  EFVD+Y Q+E+E+ +A+KRVFE ++
Sbjct: 895 FNIEGLKFIRRQWDLRHKLEFVDDYSQREQEDKTAKKRVFETIV 938

>KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {ON}
           Anc_8.324 YLR129W
          Length = 938

 Score = 1391 bits (3601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 671/946 (70%), Positives = 793/946 (83%), Gaps = 11/946 (1%)

Query: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60
           MVKSYQRFEQ + FGVI+SN+N VWIP      NG+GPG +ITSALEN+NIWDIKTG+LV
Sbjct: 1   MVKSYQRFEQTSVFGVISSNSNSVWIP------NGNGPGNIITSALENINIWDIKTGELV 54

Query: 61  TTLSDGLPP-GASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNG 119
             L+DGLPP G+ D+K SKPA  TY + H+DTNLLA GY+DGVIKVWDL+SKT+LL FNG
Sbjct: 55  NQLTDGLPPPGSIDSKLSKPASVTYFKYHEDTNLLAAGYSDGVIKVWDLISKTILLTFNG 114

Query: 120 HKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQG-EDWLV 178
           HK+AIT++ FDSTGTRLISGS DS+IIVWDLV EVGLYKLRSHKD ITG WC   E+WL+
Sbjct: 115 HKSAITILTFDSTGTRLISGSNDSDIIVWDLVSEVGLYKLRSHKDNITGIWCSDDENWLI 174

Query: 179 STSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKM 238
           STSKDGLIK+WDLK QQC+ETHIAHTGECW L + +DL++TTS +SQVK WKL++EN+  
Sbjct: 175 STSKDGLIKVWDLKIQQCVETHIAHTGECWSLGIHNDLVVTTSAESQVKFWKLDLENQPN 234

Query: 239 GEKLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIAXXXXX 298
           G KL E GIFEKQSKQRGL +EFIT+  D VSFF+IQNADKT+E +RIRK++EI      
Sbjct: 235 GSKLVEKGIFEKQSKQRGLSVEFITSKGDDVSFFHIQNADKTVEIFRIRKKDEIEKALKK 294

Query: 299 XXXXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTS 358
                     TD+EI++++ +++ S ++HPFQTVRS YKIKS  WT  TSSKLELVVTTS
Sbjct: 295 REKRLKEKGMTDDEIAQNVDEAFVSFLMHPFQTVRSTYKIKSVCWTHATSSKLELVVTTS 354

Query: 359 NNTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWN 418
           +NTIEYYS+ Y KR P  P+  K HTIEL GQRTD+RSI +SDDNKLLATASNG LKIWN
Sbjct: 355 SNTIEYYSVTYAKRIPQPPS--KIHTIELHGQRTDIRSIAISDDNKLLATASNGLLKIWN 412

Query: 419 VKTHKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWS 478
           +KTHKCIRTFECGYAL CKFLPGGLLVI+GTR+GELQLFDLASS+ L+ IEDAHDAAIWS
Sbjct: 413 LKTHKCIRTFECGYALCCKFLPGGLLVIVGTRNGELQLFDLASSTQLENIEDAHDAAIWS 472

Query: 479 LDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVR 538
           LD+TSDGKRL+TGSADKTVKFWDF++++  V GT+D ++P+LKL HDTTLE+ +DIL VR
Sbjct: 473 LDITSDGKRLITGSADKTVKFWDFKLDQQKVEGTRDSYIPVLKLFHDTTLEIGEDILCVR 532

Query: 539 ISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIK 598
           +SPDD++LA+SLLD TVK+FFLDSMKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIK
Sbjct: 533 LSPDDKFLAVSLLDYTVKIFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIK 592

Query: 599 IWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQS 658
           IWGLDFGDCHKSLFAH DSIM+VKFL  SHNFFSCSKD  +KYWDG+KFECIQKL AHQ+
Sbjct: 593 IWGLDFGDCHKSLFAHADSIMNVKFLNNSHNFFSCSKDGTIKYWDGDKFECIQKLVAHQN 652

Query: 659 EVWALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNG 718
           EVW++AI+ D SFVVSSSHDHS+RIWEETEDQVF           QYE+TLL SLEEG G
Sbjct: 653 EVWSIAIADDSSFVVSSSHDHSLRIWEETEDQVFLEEEREREMEEQYENTLLNSLEEGTG 712

Query: 719 DDAFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQR 778
           D AFK D  G   EDEA+ VHKQT ESLKAGE+LMEALDLGI EIE  E Y KD++LW++
Sbjct: 713 DSAFKSDTKGSEDEDEATDVHKQTAESLKAGERLMEALDLGIEEIEKNETYLKDLELWKK 772

Query: 779 KKL-GEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTD 837
           KK+ G+AP+KPQGN++L A+ KTPEQYI++TL +I+ SQLEDA++V PFSYVLKFLKF D
Sbjct: 773 KKIGGDAPIKPQGNAILTAINKTPEQYILETLIKIKPSQLEDAILVFPFSYVLKFLKFID 832

Query: 838 AVMQNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDD 897
            V+ +  +L+NHL LICKNLFF+IK NHKELISQKNE+LKLQ++RVK  LR AL+  EDD
Sbjct: 833 IVLNDPKVLNNHLTLICKNLFFVIKSNHKELISQKNEDLKLQVDRVKDRLRGALRKNEDD 892

Query: 898 LGFNVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFERVI 943
           LG+N+QGLKFI+QQWNL HN+EF DE DQ  +E+ S +KRVF  ++
Sbjct: 893 LGYNIQGLKFIKQQWNLTHNFEFNDELDQNVQESKSGKKRVFGTIV 938

>TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {ON}
           Anc_8.324 YLR129W
          Length = 937

 Score = 1378 bits (3567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/940 (68%), Positives = 789/940 (83%), Gaps = 8/940 (0%)

Query: 1   MVKSYQRFEQAAAFGVIASNANCVWIPAS-SRTNNGSGPGQLITSALENVNIWDIKTGDL 59
           MVKSYQRFEQ + FGVI +NANCVW+P+S SR +N    GQ++T ALEN+N+WDIKTG+L
Sbjct: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSN---VGQVLTGALENINLWDIKTGEL 57

Query: 60  VTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNG 119
           ++ LSDGLPPG+ D K SKPAE TYLE H +TNLLA GYADGVIK+WDL+SKTVLL+F+G
Sbjct: 58  LSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSG 117

Query: 120 HKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVS 179
           HK+ +T+++FDSTGTRL+SGS+DS+II+WDLV EVG++KLRSHKDAITG WC+GEDWLVS
Sbjct: 118 HKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVS 177

Query: 180 TSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMG 239
           T+KDGLIK+WDLKTQQC+ETHIA TGECW L V  DL++TT TDSQ+KIW L+   E  G
Sbjct: 178 TAKDGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKEN-G 236

Query: 240 EKLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIAXXXXXX 299
            K+ E G +EKQSKQRGL + F T A D  +F YIQN+DKT+E +RIRK++EI+      
Sbjct: 237 SKIVEKGTYEKQSKQRGLSVNFKTTA-DETTFLYIQNSDKTVEIFRIRKQDEISRALKKR 295

Query: 300 XXXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSN 359
                    TDE+I +   D+Y SL+L PFQ ++S YKIK+ SWT   +SK+ELVVTTS+
Sbjct: 296 EKRMKEKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSS 355

Query: 360 NTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNV 419
           NTIEYYSIPYEKR P +P+P K +TIE +G RTD+RSID+SDDNKLLA+ASNG LKIWN+
Sbjct: 356 NTIEYYSIPYEKRLPKNPSPSKLYTIEQKGHRTDIRSIDISDDNKLLASASNGLLKIWNL 415

Query: 420 KTHKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSL 479
           KT  CIRTF+CGYALTCKFLP G L ++GTR G++QLFDL +S+L+++I+ AH+AAIWSL
Sbjct: 416 KTKSCIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSL 475

Query: 480 DLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRI 539
           D+T DGKRLVTGSADK++KFW+F +E+ LVPGT DKFVP++KL HDTTLELNDDILSV+I
Sbjct: 476 DITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKI 535

Query: 540 SPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKI 599
           SP+D+YLA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIKI
Sbjct: 536 SPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKI 595

Query: 600 WGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSE 659
           WGLDFGDCHKSLFAHQDSIM+V FLPESHNFFS SKD +VKYWDG+KFEC+QKL AHQSE
Sbjct: 596 WGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSE 655

Query: 660 VWALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGD 719
           VWALAI++DGS VVSSSHDHS+R+W+ET+DQVF           QYEDTLLTSLEEG+GD
Sbjct: 656 VWALAITSDGSTVVSSSHDHSMRVWKETDDQVFLEEEREKELEEQYEDTLLTSLEEGSGD 715

Query: 720 DAFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRK 779
            AFK D   E+  DE++ V  QT+ESLK+GE+LMEAL+LG +EIE +E YNKD K W++K
Sbjct: 716 SAFKADI--EDGMDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKK 773

Query: 780 KLGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAV 839
           K GE P+KPQGN++L+A+ + P+QYIMDTL +I+ SQLEDAL+V+PFSYVL+FLKF D V
Sbjct: 774 KAGEPPVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIV 833

Query: 840 MQNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLG 899
           M +  +L N L LICKNLF I+K NHKELISQ+N+ LK QI  VK +LR +L++  DDLG
Sbjct: 834 MDDPEILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLG 893

Query: 900 FNVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVF 939
           FN+QGLKFI+QQWNLKHNYEF+DE DQ+++E  +++KR+F
Sbjct: 894 FNIQGLKFIKQQWNLKHNYEFIDEEDQKKQEEKNSKKRIF 933

>ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 938

 Score = 1373 bits (3553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 653/940 (69%), Positives = 791/940 (84%), Gaps = 5/940 (0%)

Query: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60
           MVKSYQRFEQ++ FGV++S  N +WIPA ++  NG  PGQ+IT ALENVNIWDIKTG+LV
Sbjct: 1   MVKSYQRFEQSSVFGVVSSGDNSIWIPAENKRTNG--PGQIITGALENVNIWDIKTGELV 58

Query: 61  TTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGH 120
           + LSDGLPPGA DA+ +KPAE TY++ + DT+LLAVGYADGVIK+WD+ SKTVLL+FNGH
Sbjct: 59  SHLSDGLPPGAIDARTTKPAEVTYMQYYSDTSLLAVGYADGVIKIWDMFSKTVLLSFNGH 118

Query: 121 KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVST 180
           ++A+T + FDSTGTRLISGS+DSNIIVWDLV EVGLYKLRSHKD+ITG     E+WL+S 
Sbjct: 119 RSAVTQLLFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDSITGLSLPDENWLMSV 178

Query: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGE 240
           SKDGLIK+WDLK QQC+ETHIAH GECW L V +D+++TTS+DSQ+KIW L+++ +  G 
Sbjct: 179 SKDGLIKLWDLKIQQCVETHIAHPGECWALGVDEDVVVTTSSDSQIKIWHLDLDAD-AGV 237

Query: 241 KLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIAXXXXXXX 300
           K+TE GIFEKQSKQRG+ + FIT  SDG  FFY+QNADKT+E  R+RKEEEI+       
Sbjct: 238 KVTEKGIFEKQSKQRGVAVSFIT-VSDGTKFFYVQNADKTLEIIRLRKEEEISRALKKRE 296

Query: 301 XXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNN 360
                   TDEEI ++ K+SY S+I+H FQ +RS +KI++ASW   TSSKLEL VTTS N
Sbjct: 297 KRFKEKGMTDEEIQQNFKESYISIIMHSFQVLRSAFKIRAASWAVTTSSKLELTVTTSGN 356

Query: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVK 420
           TIEYYSIPYEKR+P  P P++ H+IELQG RTDVR+ID+SDD KLLATASNG LKIWN++
Sbjct: 357 TIEYYSIPYEKREPKHPTPIRVHSIELQGHRTDVRAIDISDDGKLLATASNGLLKIWNIR 416

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           T  C+RTFECGYALTCKFLPGG+LVI+GTRSG+LQLFDLASS++L+  E+AHDAAIWSLD
Sbjct: 417 TKTCLRTFECGYALTCKFLPGGVLVIVGTRSGQLQLFDLASSTILENNEEAHDAAIWSLD 476

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS 540
           +TSDG+RLVTGSADKTVKFW+F VE+  VPGT DK +P + L+HDTTLE++DDILSV+IS
Sbjct: 477 ITSDGRRLVTGSADKTVKFWNFIVEEKKVPGTTDKLIPTMSLHHDTTLEMSDDILSVKIS 536

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           P+++ LA+SLLDNTVKVF+L++MKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIKIW
Sbjct: 537 PENKLLAVSLLDNTVKVFYLETMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIM+VKFLPESHNFFSCSKDA VKYWDG+KFE IQKL  HQSEV
Sbjct: 597 GLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDATVKYWDGDKFETIQKLAGHQSEV 656

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           WALA++  G+ V+S SHD SIR+WEET+DQVF           Q E+ LLTSLEEG+GD 
Sbjct: 657 WALAVARSGTCVISVSHDSSIRVWEETDDQVFLEEERERELEEQNEEGLLTSLEEGSGDS 716

Query: 721 AFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRKK 780
           AFK     ++  D+A  VHKQT+ESLKAGE+LMEA+DLGI EIE  E+Y K+++LW++KK
Sbjct: 717 AFK-QDEKDDDHDDAVDVHKQTVESLKAGERLMEAIDLGIPEIEAWEIYEKELQLWKKKK 775

Query: 781 LGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAVM 840
            G  P +PQ N++L+A+ K PE+YIMDTL RI+ SQLEDAL+ +PFSYVLKFLKF D V+
Sbjct: 776 QGVEPERPQDNAILLAINKRPEEYIMDTLVRIKPSQLEDALLTLPFSYVLKFLKFLDTVL 835

Query: 841 QNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLGF 900
           Q+K LLHNHL LICKNLFFI++ NH+EL+SQKNEELK +I RVK ELR ALK+ EDDLGF
Sbjct: 836 QDKKLLHNHLSLICKNLFFIVQSNHRELVSQKNEELKQRITRVKNELREALKNNEDDLGF 895

Query: 901 NVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFE 940
           N++GLKFI+QQWNLKHNYEFVDE+DQ+++   +A+KRVFE
Sbjct: 896 NIEGLKFIKQQWNLKHNYEFVDEFDQRKQAEKTAKKRVFE 935

>TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.324
           YLR129W
          Length = 936

 Score = 1372 bits (3550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 653/936 (69%), Positives = 779/936 (83%), Gaps = 5/936 (0%)

Query: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60
           MVKSYQRFEQ++ FGVI+SN+NCVW+P SS+ +     G++IT ALEN+++WD+KT +L 
Sbjct: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPSSKKS--KSLGKVITGALENISVWDLKTSELE 58

Query: 61  TTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGH 120
             LSDGLPPG+ D K SKPAE +YL+ H +T L+A GYADGVIK+WDLVSKTVLL+FNGH
Sbjct: 59  YVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGH 118

Query: 121 KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVST 180
           K+ IT+++FD TGT+LISGS+DSNIIVWDLV EVGLYKLRSHK  ITG WC  ++WL+ST
Sbjct: 119 KSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLIST 178

Query: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGE 240
           SKDGLIK+WDLKTQQCIETHIAHTGECW L +  D ++T+S DSQ+KIW++++E E  G 
Sbjct: 179 SKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEP-GS 237

Query: 241 KLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIAXXXXXXX 300
           KL E G FEKQSKQRGL IEF T  SDGV FFY+QNADKT+E +R+RK+ EIA       
Sbjct: 238 KLIEKGAFEKQSKQRGLSIEF-TTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRRE 296

Query: 301 XXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNN 360
                   T+E+I  +I +SY S ++HPFQ VRS+YKIKS +WT   S+KLE+VVTT++N
Sbjct: 297 KRLTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSN 356

Query: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVK 420
           TIEYYS+PYEKRDPTSP P+K HTIELQG RTDVRSID+SDDN LLATASNG LKIWN+ 
Sbjct: 357 TIEYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLN 416

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           T  CIRTFECGYALTCKFLPGGLLV++GTR G LQLFDLASS LL TIE AH+ AIWSLD
Sbjct: 417 TKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLD 476

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS 540
           +T+DGKRLVTGSADK++KFWDFQV++ L+ GT DK+VP + + HD+TLEL DDILS++IS
Sbjct: 477 VTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS 536

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
            DD++LAISLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS D+K+IITSSADKNIKIW
Sbjct: 537 GDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIW 596

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIM VKFLP SHNFFS SKD  VKYWDG+KFECIQKL AHQSEV
Sbjct: 597 GLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEV 656

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           WALA+S +G  VVS SHDHSIRIWEET+DQVF           QYEDTLL SLEEGN DD
Sbjct: 657 WALAVSDNGERVVSVSHDHSIRIWEETDDQVFLEEEREKELEEQYEDTLLASLEEGNADD 716

Query: 721 AFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRKK 780
            FKGD   +  +DEA+ V KQT+ESLKAGE+LM+ALDLGI EIE ME Y  +M  +++K+
Sbjct: 717 TFKGDVKNDE-DDEATRVSKQTIESLKAGERLMDALDLGIKEIEEMENYEAEMVKYKKKQ 775

Query: 781 LGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAVM 840
             +AP+KP GN++L+AV+KTP +YIMDTL  I+ SQLED+L+V+PFSYVLKFLKF D VM
Sbjct: 776 RIDAPVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVM 835

Query: 841 QNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLGF 900
           +   +L+N L LICKNLFFI+K N KEL+SQKNEELKLQI+RVK +LR+AL++ EDDLGF
Sbjct: 836 KVPNILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGF 895

Query: 901 NVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARK 936
           N+QGLKFI+QQWN+KHN+EFVD+YDQQ +   SA+K
Sbjct: 896 NIQGLKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKK 931

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 1369 bits (3543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 638/944 (67%), Positives = 782/944 (82%), Gaps = 8/944 (0%)

Query: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60
           MVKSYQRFEQA+  GVI+SN+NC+WIPA +R    +  GQ++T ALENVN W +K+GDL+
Sbjct: 1   MVKSYQRFEQASVLGVISSNSNCIWIPAETR----NASGQVLTGALENVNCWSMKSGDLL 56

Query: 61  TTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGH 120
           +TLSDGLPPGA DAK SKPAE T+L+ H +T LLA GY DGV+K+WDL+SK+VL+NFNGH
Sbjct: 57  STLSDGLPPGAVDAKSSKPAETTFLQYHPETKLLAAGYNDGVVKIWDLLSKSVLINFNGH 116

Query: 121 KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVST 180
           K+AIT+++FDSTGTRLISGSKDS+IIVWDLVGEVGL+KLRSHKD+ITG WC+GEDWLVST
Sbjct: 117 KSAITVLKFDSTGTRLISGSKDSDIIVWDLVGEVGLFKLRSHKDSITGLWCEGEDWLVST 176

Query: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGE 240
           SKDGLIK+WDLKTQQC+ETH+AH GECW + V +DL++T   D+Q+K+W ++ E + +G 
Sbjct: 177 SKDGLIKVWDLKTQQCVETHVAHVGECWSMGVHEDLVVTCGGDNQIKLWSVDYE-KPVGS 235

Query: 241 KLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIAXXXXXXX 300
            LTE G  EKQSKQRG+ +EF T  SDGV+FF++QNAD+T+ET+R+R E+EI+       
Sbjct: 236 MLTERGTHEKQSKQRGVSVEF-TTISDGVTFFFVQNADRTVETFRLRTEDEISKALKKRE 294

Query: 301 XXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNN 360
                   T EEI  ++K+SY+S I+HPFQ +RS YKIKSA W   T+SKLE+VV+TSNN
Sbjct: 295 KRLSDKGLTGEEIQANLKESYTSFIMHPFQILRSPYKIKSACWAVTTTSKLEIVVSTSNN 354

Query: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVK 420
           T++YYSIPY K++P  P+P K ++I+++G RTDVR+ID+SDDNKLLATASNGSLKIWN+K
Sbjct: 355 TVDYYSIPYNKKEPKLPSPPKIYSIDIKGHRTDVRAIDISDDNKLLATASNGSLKIWNIK 414

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           T  CIRTFECGYAL CKFLPGG LV++GT++G+L LFDLASS+LL +IE AH  AIWSLD
Sbjct: 415 TKSCIRTFECGYALACKFLPGGALVVIGTKTGDLNLFDLASSTLLSSIEAAHSGAIWSLD 474

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS 540
           LT+DGKRLVTGSADK+V+FWDFQVE+ LVPGT DKFVP LK+ HDTTLELNDD+L+V+IS
Sbjct: 475 LTADGKRLVTGSADKSVRFWDFQVEQELVPGTTDKFVPKLKMFHDTTLELNDDVLAVKIS 534

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           PD+R LAISLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDISFDSK++ITSSADKNIK+W
Sbjct: 535 PDNRLLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKVW 594

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAH DSIM V FLPESHNFFSC KD +VKYWDG+KFECIQKL AHQ EV
Sbjct: 595 GLDFGDCHKSLFAHSDSIMKVAFLPESHNFFSCGKDGLVKYWDGDKFECIQKLAAHQKEV 654

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           W +AIS DG+FVVS+SHD SIR+W ET+DQVF           QYE TLL SLE+G GD 
Sbjct: 655 WTIAISHDGTFVVSASHDQSIRVWVETDDQVFLEEEREKEMDEQYEKTLLNSLEDGAGDA 714

Query: 721 AFKGDAT-GENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRK 779
            F GD   G  + DEA+ VHKQT ESLKA E+LMEA+D+G+AEI     Y + +K WQ+K
Sbjct: 715 MFHGDGNGGAEIGDEATDVHKQTTESLKASERLMEAMDMGMAEISNHLEYEQALKEWQKK 774

Query: 780 KLGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAV 839
           K G  P +PQ NS+LIA+ KTP +YIMD L+RI+ SQLEDAL+V+PFSYVL+FL F + V
Sbjct: 775 KSGPHPGRPQPNSILIAINKTPLEYIMDVLARIKPSQLEDALLVLPFSYVLEFLHFIELV 834

Query: 840 MQNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLG 899
           +++K+L+  HLPL+CKNLFFIIK NH+EL SQKNE+LK+QI+R+K  LRN++K+  DDLG
Sbjct: 835 IEDKSLVRRHLPLLCKNLFFIIKANHRELFSQKNEKLKIQIDRIKYGLRNSIKAKADDLG 894

Query: 900 FNVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFERVI 943
           FN+QGLKFI+QQWNLKHN+EF D+     K++   +KRVFE V+
Sbjct: 895 FNIQGLKFIKQQWNLKHNFEFSDDV-IISKQDKKVKKRVFETVV 937

>KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.324
           YLR129W
          Length = 942

 Score = 1367 bits (3539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 660/947 (69%), Positives = 792/947 (83%), Gaps = 9/947 (0%)

Query: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60
           MVKSYQRFEQ+A FGVI+S AN VW+P     ++GS PGQ+ITSALENVNIWDIKTG+L+
Sbjct: 1   MVKSYQRFEQSAVFGVISSEANNVWLPPLKGRSSGS-PGQIITSALENVNIWDIKTGELI 59

Query: 61  TTLSDGLPPGASDAK-GSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNG 119
             L DG+ PG++D+K  +KPAE T+L+ H D++LLAVGY DG IKVWDLVSKTVL+N NG
Sbjct: 60  AQLQDGITPGSADSKVNTKPAEVTFLQYHPDSSLLAVGYRDGNIKVWDLVSKTVLINLNG 119

Query: 120 HKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGE-DWLV 178
           HK++IT+++FD   TRL+SGS DSNII+WDLV EVG+ KLRSHKD I+  +   + +WL+
Sbjct: 120 HKSSITVLKFDVNCTRLVSGSSDSNIIIWDLVSEVGICKLRSHKDRISDLYVDDDFNWLL 179

Query: 179 STSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKM 238
           S SKDGLIK+WDLKT QC+ETHIAHTGECW L +KDD++ITTS  SQ+K+W L+++ E +
Sbjct: 180 SVSKDGLIKVWDLKTNQCVETHIAHTGECWSLGIKDDVVITTSNTSQIKLWSLDLDGE-V 238

Query: 239 GEKLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIAXXXXX 298
           G KL E G++EKQSKQRG  ++FI N+S GV+FF I NADKTIE +RIR +EEI      
Sbjct: 239 GSKLIEKGVYEKQSKQRGTSVKFIENSS-GVAFFAIGNADKTIEIFRIRPQEEITRALKK 297

Query: 299 XXXXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTS 358
                      DE+I ++IK+S+ S ++H FQTVRS +K+KS SWT  T+SKLELV TTS
Sbjct: 298 REKRLKEKGMEDEDIQQNIKESFVSTMMHSFQTVRSAFKLKSFSWTFATNSKLELVATTS 357

Query: 359 NNTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWN 418
           +NTIEYY+I YEKR+PT PAP + +TIELQG RTD+R+ D+SDDN LLATASNG LKIWN
Sbjct: 358 SNTIEYYTIAYEKREPTQPAPNRLYTIELQGLRTDIRATDISDDNMLLATASNGLLKIWN 417

Query: 419 VKTHKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWS 478
           ++T +CIRTF+CGYALTCKFLPGGLLVILGTR+GELQLFDLASS+ ++ IE AHDAAIWS
Sbjct: 418 LRTKQCIRTFDCGYALTCKFLPGGLLVILGTRNGELQLFDLASSTQIENIEGAHDAAIWS 477

Query: 479 LDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVR 538
           LDLTS+GKRLVTGSADKTVKFWDFQ+E+  + GT  K    L LNHDTTLELNDD+L V+
Sbjct: 478 LDLTSNGKRLVTGSADKTVKFWDFQLEQLPIEGTSGKSESKLTLNHDTTLELNDDVLCVK 537

Query: 539 ISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIK 598
           ISP+D++LA+SLLDNTVK+FFLD+MKF+LSLYGHKLPVLSIDISFDSKM+ITSSADKNIK
Sbjct: 538 ISPEDKHLAVSLLDNTVKIFFLDTMKFFLSLYGHKLPVLSIDISFDSKMVITSSADKNIK 597

Query: 599 IWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQS 658
           IWGLDFGDCHKSLFAHQDSIM+VKFLPESHNFFSCSKD  VKYWDG+KFEC+QKL +HQS
Sbjct: 598 IWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGQVKYWDGDKFECVQKLVSHQS 657

Query: 659 EVWALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNG 718
           EVW LA+  DGSFVVS+SHDHSIRIW+ETEDQVF           QYE+TLL SLEEG G
Sbjct: 658 EVWCLAMGLDGSFVVSTSHDHSIRIWQETEDQVFLEEEREKEMEEQYEETLLNSLEEGTG 717

Query: 719 DDAFKGDAT-GENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQ 777
           DDAFK D+  GE   DEA+ VHKQT+ESLKA EKLM+ALDLG+ EIE ME YN DM LW+
Sbjct: 718 DDAFKKDSVDGEG--DEATDVHKQTIESLKANEKLMDALDLGLTEIEAMERYNSDMALWK 775

Query: 778 RKKLG-EAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFT 836
           +KK+G E P+KP GN+VL+AVKK+PEQYIM+TL+RI+ SQLEDAL+++PFSYVLKFLKF 
Sbjct: 776 KKKIGSEMPVKPSGNAVLLAVKKSPEQYIMETLARIKPSQLEDALLILPFSYVLKFLKFI 835

Query: 837 DAVMQNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTED 896
           D V++NK +LHN+L LICKNLFFI++ NHKELISQKNEELKLQI RVK ELRN LK  ED
Sbjct: 836 DIVLKNKKMLHNYLALICKNLFFIVRTNHKELISQKNEELKLQITRVKQELRNTLKQNED 895

Query: 897 DLGFNVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFERVI 943
            LGFN+QGLKFI+QQW+LKHN+EFVDEYDQ+ +E   A+KR+FE ++
Sbjct: 896 ALGFNIQGLKFIKQQWDLKHNFEFVDEYDQRIQEEKKAKKRIFETLV 942

>CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highly
           similar to uniprot|Q12220 Saccharomyces cerevisiae
           YLR129w DIP2 DOM34P-interacting protein
          Length = 940

 Score = 1344 bits (3478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 633/940 (67%), Positives = 772/940 (82%), Gaps = 5/940 (0%)

Query: 1   MVKSYQRFEQAAAFGVIASNANCVWI-PASSRTNNGSGPGQLITSALENVNIWDIKTGDL 59
           MVKSYQRFEQA  FGVI+SN+N VWI P +S+   G+  GQ+I   LEN+ +WDIKTG+ 
Sbjct: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGN-LGQVIVGGLENILVWDIKTGEQ 59

Query: 60  VTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNG 119
           +  L+DGLPPGASDAK SKPAE T+L+ H +TNLLA GYADGVIK+WDL+SKTVL++FNG
Sbjct: 60  IAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNG 119

Query: 120 HKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVS 179
           HK+AIT++ FD+TGTRLIS SKDS+IIVWDLVGE GLYKLRSHKDAITG WC+ E+WL+S
Sbjct: 120 HKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIS 179

Query: 180 TSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMG 239
           TSKDGL+KIWDLK+QQC+ETH+AHTGECW L + +D+ +T S DSQVK+WKL+++ E  G
Sbjct: 180 TSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAEN-G 238

Query: 240 EKLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIAXXXXXX 299
            KLTE GI EKQSKQRG++I+F   A DGV FFYIQNADKTIE YR+RKEEEI+      
Sbjct: 239 SKLTEKGIIEKQSKQRGVEIDFAV-APDGVKFFYIQNADKTIEIYRLRKEEEISRALKKR 297

Query: 300 XXXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSN 359
                    ++EEI +++  S  SL+ H FQ VRS YKIKSA WT  ++SKLELVVTTSN
Sbjct: 298 EKRLQDKGMSEEEIKEAM-GSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSN 356

Query: 360 NTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNV 419
           N+IEYYSIPY KR+PT PAPLK HTI+L GQRTD+RS  +SDDNKLLATASNGSLKIWN+
Sbjct: 357 NSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNI 416

Query: 420 KTHKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSL 479
           KT +CIR+FECGYALTCKFLPGG LV++GTR+GELQLFD+ASS++LD  E AHDAAIWSL
Sbjct: 417 KTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSL 476

Query: 480 DLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRI 539
           DLTSDG++LVTGSADKTV+FW F+V +  V    +K +PML+L HDTTLEL+DDILSV I
Sbjct: 477 DLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVI 536

Query: 540 SPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKI 599
           SPDD+++A+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS+DSK+I+T SADKNIKI
Sbjct: 537 SPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKI 596

Query: 600 WGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSE 659
           WGLDFGDCHKSLFAHQDSIM+VKFLPES+NFFSCSKDA VKYWDG+KFECIQKL AHQSE
Sbjct: 597 WGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSE 656

Query: 660 VWALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGD 719
           VW++++S DG+FV+S+ HDHSIR+WEETEDQVF           QYEDTLLTSLE G GD
Sbjct: 657 VWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGD 716

Query: 720 DAFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRK 779
           +            +E  GVHKQT+ESLKAGE+LMEAL++G+ +I  ME +N+ +  W++ 
Sbjct: 717 EMLSVKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKS 776

Query: 780 KLGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAV 839
           K G  P++PQ N++L+A+KKTPE+YI++TL +I+ SQ+EDALMVMPFSY+LKFLKF D V
Sbjct: 777 KKGIQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVV 836

Query: 840 MQNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLG 899
                LL  H+ L+CK LFF+I+FN+KEL++QKN  LKLQI RVK  LR +LKS  D+LG
Sbjct: 837 TTKAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELG 896

Query: 900 FNVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVF 939
           FN++G+KFI+QQW L H+ EF DEY+++  E   ++KRVF
Sbjct: 897 FNIEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVF 936

>Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129W
           (DIP2) - interacts with Dom3p [contig 171] FULL
          Length = 937

 Score = 1343 bits (3477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 622/944 (65%), Positives = 772/944 (81%), Gaps = 8/944 (0%)

Query: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60
           MVKSYQRFEQ + FGVI+SN+NC+W+PA +R + G    Q++T ALENVN W +K+G+L+
Sbjct: 1   MVKSYQRFEQESVFGVISSNSNCLWLPAENRNSTG----QVLTGALENVNCWSMKSGELI 56

Query: 61  TTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGH 120
            TL+DGLPPGA DAK +KPAE +YL+ H +T LLAVGY DG IK+WDL+SK+VL++FNGH
Sbjct: 57  GTLTDGLPPGAVDAKSTKPAETSYLQYHPETRLLAVGYNDGAIKIWDLLSKSVLISFNGH 116

Query: 121 KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVST 180
           K+AIT++ FD TGTRLISGS+DS+IIVWDLVGEVGLYKLRSHKD+ITG WC+GE+WL+ST
Sbjct: 117 KSAITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKLRSHKDSITGLWCEGEEWLIST 176

Query: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGE 240
           SKDGLIK+WDLK QQC+ETH+AH GECW + V +DL+IT   D+Q+K+W LN E E  G 
Sbjct: 177 SKDGLIKVWDLKVQQCVETHVAHVGECWSMGVHEDLVITAGADNQIKLWNLNFE-ESAGS 235

Query: 241 KLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIAXXXXXXX 300
            L E G  EKQS+QRG+ I+F T  SD  +FF+IQNAD+++ET+R+RK++EIA       
Sbjct: 236 MLIEKGTHEKQSRQRGVAIQF-TTVSDETTFFFIQNADRSVETFRLRKQDEIAKALKKRE 294

Query: 301 XXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNN 360
                   +++EI +++KDS++S I+HPFQ VRS+YK++S  W T T+SKL+LVVTT+NN
Sbjct: 295 KRLTEKGLSEDEIQQNLKDSFTSFIMHPFQIVRSIYKVRSVCWATTTTSKLDLVVTTANN 354

Query: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVK 420
           T++YYSI Y+KR+PT P+P K H+I+++G R+DVR+ID+S DNKLLATASNG+LKIWN+K
Sbjct: 355 TVDYYSIKYQKREPTMPSPPKLHSIDIRGHRSDVRAIDISGDNKLLATASNGTLKIWNIK 414

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           T+ CIRTFECGYAL CKFLPGG LV+LGT++G+L L+DLASS+LL+TIE AH  AIWSLD
Sbjct: 415 TNSCIRTFECGYALACKFLPGGALVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLD 474

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS 540
           +T+DGKRLVTGSADKTV FWDFQVE+  VPGT DKF P LK+ HDTTLELNDD+L+V+IS
Sbjct: 475 MTTDGKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKIS 534

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           PD+R LA+SLLDNTVKVFF+DSMKF+LSLYGHKLPVLSIDISFDSK++ITSSADKNIKIW
Sbjct: 535 PDNRLLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIW 594

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCH+SLFAH DSIM V F+PESHNFFSCSKDA+VKYWDG+KFECIQKL AHQ EV
Sbjct: 595 GLDFGDCHRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWDGDKFECIQKLAAHQKEV 654

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           W LAIS+DG FVVS+SHD SIR+W ET+DQVF           QYE TLL SLE G GDD
Sbjct: 655 WTLAISSDGRFVVSASHDQSIRVWSETDDQVFLEEERERESDEQYEKTLLNSLENGAGDD 714

Query: 721 AFKGDATGEN-VEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRK 779
            F+ D  G+  + D+A+ VHKQT ESLKA EKLMEALDLG++EI  +  Y K +K W++K
Sbjct: 715 MFEKDGNGDGEITDQATDVHKQTTESLKASEKLMEALDLGMSEINNLLEYEKALKQWEKK 774

Query: 780 KLGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAV 839
           + G  P KP  NS+L+A+ KTP +YIMD L +I+ SQLEDAL+V+PF+YVL FL F D V
Sbjct: 775 RSGPHPGKPLPNSILVAINKTPLEYIMDVLVKIKPSQLEDALLVLPFTYVLTFLHFIDLV 834

Query: 840 MQNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLG 899
           ++ K L    LPLIC+NLFFIIK NH+EL SQKNEELK+Q+NR+K  LR ++K+  DDLG
Sbjct: 835 LKEKELARRRLPLICRNLFFIIKSNHRELFSQKNEELKIQMNRIKDGLRKSIKAKSDDLG 894

Query: 900 FNVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFERVI 943
           FN+QGL FI+QQWN+KHN+EF D+     K N  A+KRVFE ++
Sbjct: 895 FNIQGLTFIKQQWNMKHNFEFSDDI-TVNKTNEKAKKRVFETLV 937

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 1333 bits (3449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 627/943 (66%), Positives = 768/943 (81%), Gaps = 7/943 (0%)

Query: 1   MVKSYQRFEQAAAFGVIASNANCVWIPA-SSRTNNGSGPGQLITSALENVNIWDIKTGDL 59
           MV SYQRFEQ + FGVIASN+NCVWIP   SRT+    PGQ+ITS+LEN+N WDIKTG+L
Sbjct: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTS----PGQIITSSLENINCWDIKTGNL 56

Query: 60  VTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNG 119
           + TLSD +PPG+ DAK  KPAE  YLE H +TNLLA GYADGVIK+WD+ ++TVL+ FN 
Sbjct: 57  LKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNS 116

Query: 120 HKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVS 179
           H AAIT ++FD +GTRLISGS+DSNII+WDLVGEVGL KLRSHKD+ITG W + +DWL+S
Sbjct: 117 HTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLIS 176

Query: 180 TSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMG 239
           TSKDGLIK+WD+K+QQC+ETH+AHT ECW LA+ DDL++T + DS++KIW+L++E E  G
Sbjct: 177 TSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLEREN-G 235

Query: 240 EKLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIAXXXXXX 299
            KL E GI+EKQS+QR + ++ +TN  D V FFY+QNADKT E +RIR   E++      
Sbjct: 236 SKLKEKGIYEKQSRQRSVDVKIVTNP-DEVKFFYVQNADKTTEVFRIRTSSELSKALKKR 294

Query: 300 XXXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSN 359
                    +++EI + IK S+ + I+ PFQ VRS +K KSA+WT  + SKLELV TTSN
Sbjct: 295 EKRLKEKGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSN 354

Query: 360 NTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNV 419
           NTIEYYSIPY+ + PT  A  K +TIELQG RTDVRSID+S+DNKLLA ASNG LKIWN+
Sbjct: 355 NTIEYYSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNI 414

Query: 420 KTHKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSL 479
            T  CIRTF+CGYAL CKFLPGG LV++GTR GELQLFDLASS +L+  E AHDAAIWSL
Sbjct: 415 TTQSCIRTFDCGYALCCKFLPGGTLVVVGTRGGELQLFDLASSIVLENKEAAHDAAIWSL 474

Query: 480 DLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRI 539
           DLTSDG+RL+TGSADKTVKFW+FQVEK L+  + DK+   L++ HDTTLEL +DILSV+I
Sbjct: 475 DLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKI 534

Query: 540 SPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKI 599
           SP+DR+LA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDIS+DSK+IITSSADKNIKI
Sbjct: 535 SPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKI 594

Query: 600 WGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSE 659
           WGLDFGDCH+SLFAHQD+IM+VKF+P+SHNFFSC KD V+KYWDG KF+CIQKL AH+SE
Sbjct: 595 WGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSE 654

Query: 660 VWALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGD 719
           VWALA+S+DG F VS SHD SIR+WEETEDQVF           QYE+ LL++LE    D
Sbjct: 655 VWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASD 714

Query: 720 DAFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRK 779
           + F  ++  +    E + VHKQT+ESLKAGE+LMEALDLGI+E+E  E Y++++ LW + 
Sbjct: 715 EKFARNSEEDTDVTEVTDVHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKN 774

Query: 780 KLGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAV 839
           K G+ PMKPQ NS+LIAV K PE+YIMDTL RI+ +QLEDAL+V+PFSYVLKFLKF DA 
Sbjct: 775 KSGDQPMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDAS 834

Query: 840 MQNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLG 899
           ++ K L++NHLPLIC+NL +++K NHKELI+QKNEELKLQIN+VK +LR ALK   DDLG
Sbjct: 835 IEKKQLVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLG 894

Query: 900 FNVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFERV 942
           FN++GLKFI+QQWN+KHN+EFVDEYDQ++ E  S++KRVF  V
Sbjct: 895 FNIEGLKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937

>AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR129W
           (DIP2)
          Length = 935

 Score = 1319 bits (3414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/939 (65%), Positives = 758/939 (80%), Gaps = 7/939 (0%)

Query: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60
           MVKSYQRFEQA  FGV+ +N+NCVW+P+ ++    + PGQ+IT ALE V  W+IKTG+L+
Sbjct: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAK----NSPGQVITGALEEVKCWEIKTGELL 56

Query: 61  TTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGH 120
            T+ DGLPPGA D K  KPAE TYL+ H++T +LAVGYADG IK+WD+ ++TVL+ F+ H
Sbjct: 57  KTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSH 116

Query: 121 KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVST 180
            +AIT+++FD TGTRLISGS+D+ II+WDLV E GL KLRSHKDAITG WC+ +DWL+S 
Sbjct: 117 SSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISV 176

Query: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGE 240
           SKDGLIK+WD+K  QC+ETH+AHTGECW LAVKD+++IT + +S++K+W+L++E    G 
Sbjct: 177 SKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPN-GS 235

Query: 241 KLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIAXXXXXXX 300
            L E G +EKQSKQR  ++ F T  +DG +FFY  N+DKT+E +RIR E EIA       
Sbjct: 236 MLLEKGSYEKQSKQRCTELSF-TTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKRE 294

Query: 301 XXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNN 360
                   +DEEI +S ++SY++L+LHPFQ VRSL+K+K++SWT  T SKLELV+TT+NN
Sbjct: 295 KRFKEKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANN 354

Query: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVK 420
           TIEYYSIPY+K++P  P  +K H+IE  G RTD+R+ D+S D+KLLATASNG+LK+WN+K
Sbjct: 355 TIEYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIK 414

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           T  CIR  +CGYAL CKFLPGG LVILGTR+G+LQLFDLASS++L+ IE+AH AAIWSLD
Sbjct: 415 TKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLD 474

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS 540
           LTSDGKRLVT SADKTVKFWDF+VE+ LV GT DKFVP +KL HDTTL+L +D+  V+IS
Sbjct: 475 LTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKIS 534

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           P+DR+LA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS DSK+IITSSADKNIKIW
Sbjct: 535 PEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIW 594

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIM+VKFLPESHNFFSCSKD  VKYWDG  F+CIQKLY HQ EV
Sbjct: 595 GLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEV 654

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           WALA+S+DG  VVS SHD SIR+WEETEDQVF           QYE TLLTSLE G+GDD
Sbjct: 655 WALAVSSDGQAVVSVSHDRSIRVWEETEDQVFLEEEREKELEEQYEKTLLTSLEGGSGDD 714

Query: 721 AFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRKK 780
           AF  +   E    E++ VHKQT+ESLKAGE+LMEALDLGI EI+  E Y + MKLW  KK
Sbjct: 715 AFISNNGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWN-KK 773

Query: 781 LGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAVM 840
           LG+ P KPQ N++L A+ KTPE Y+M+TLS+I+ SQLEDAL+V+PFSYVLKFLKF D  +
Sbjct: 774 LGDQPTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAI 833

Query: 841 QNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLGF 900
           +N  +LH  LPL+CK L F+++ NHKEL+SQKNEELK+QINRVK +LR AL+S  DDLGF
Sbjct: 834 KNDVILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGF 893

Query: 901 NVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVF 939
           N+QGLKF+R  WN+ HNY+F DEYDQ  KE   ++KR+F
Sbjct: 894 NIQGLKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLF 932

>KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 936

 Score = 1212 bits (3137), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/946 (63%), Positives = 741/946 (78%), Gaps = 15/946 (1%)

Query: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60
           MVKSYQRFEQ+  FG+I+++   +++PA++ T+     G+LIT ALEN+ IW +KT + V
Sbjct: 1   MVKSYQRFEQSGLFGLISTSNQSIYLPATNSTS-----GKLITGALENIQIWTLKTNE-V 54

Query: 61  TTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGH 120
             L+DGLP GA +   SKP+  T +  H++T LL VGY DGVIKVWDL+SK+VL+ FNGH
Sbjct: 55  EVLTDGLPIGAVETNISKPSVVTAMCFHKETELLCVGYEDGVIKVWDLLSKSVLMQFNGH 114

Query: 121 KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWC-QGEDWLVS 179
           K+ +T+++ DS GTRL+SGSKDS++I+WDLVGEVGL KLRSHKDAITG W     DWL+S
Sbjct: 115 KSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIWIDHNMDWLIS 174

Query: 180 TSKDGLIKIWDLKTQ-QCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKM 238
            +KDGLIK+WDLK   QC+ETH+AHTG+CW +A+ ++++ITTS DSQ KIW+L++E    
Sbjct: 175 VAKDGLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWELDLEKSN- 233

Query: 239 GEKLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIAXXXXX 298
           GEK++E G FE +SKQRG+  EFIT A +G  FFYIQN DKTIE +RIR EEEI      
Sbjct: 234 GEKISERGTFETESKQRGVSTEFIT-APNGTRFFYIQNNDKTIEIFRIRPEEEIRKALNR 292

Query: 299 XXXXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTS 358
                     ++EEI +++  +  S++ H F TVRS YKIKS++W   ++SKLE+V+TTS
Sbjct: 293 REKRLRDKGASEEEIQEAVNPNDISVLFHSFSTVRSSYKIKSSNWIQASNSKLEVVLTTS 352

Query: 359 NNTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWN 418
           NNTIE Y IPY KRD  +  P++ + +ELQG RTD+RS+D+SDD KLL+TASNG LK+WN
Sbjct: 353 NNTIESYQIPYSKRD--AEPPVRRYNVELQGHRTDIRSMDISDDGKLLSTASNGELKVWN 410

Query: 419 VKTHKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWS 478
           + T KCIRTF CGYAL  + LPGGLLV++GTR GELQLFDLASS+LL T E AH AAIWS
Sbjct: 411 LTTKKCIRTFSCGYALCSQMLPGGLLVVVGTRQGELQLFDLASSTLLSTTE-AHTAAIWS 469

Query: 479 LDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVR 538
           LDLTS+GKRLVTGSADK+ KFWDF+V + LVPGTKDK++P LKL HDTTLEL DDIL+V+
Sbjct: 470 LDLTSNGKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVK 529

Query: 539 ISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIK 598
           IS +DRYLA+SLLDNTVKVFF DS+KFYLSLYGHKLPVLSID S DSKM+ITSSADKNIK
Sbjct: 530 ISSEDRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIK 589

Query: 599 IWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQS 658
           IWG+DFGDCHKS+FAHQDSIMSV+F  ++HNFFSC KD  VK WDG+KF+CIQKL  HQS
Sbjct: 590 IWGVDFGDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQS 649

Query: 659 EVWALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNG 718
           EVW +A+S DG  VVS+SHDHSIR+W+ET+DQVF           +YE+TLL SLE G+G
Sbjct: 650 EVWCIAVSPDGRTVVSTSHDHSIRVWQETDDQVFLEEEKEREMEEEYEETLLKSLEGGSG 709

Query: 719 DDAFKGDATG--ENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLW 776
           DD F  D     + V DE SGV+KQTLESLKAGEKLMEALDLG+AEIE  E Y K +K W
Sbjct: 710 DDQFLRDKNSGDDGVIDEVSGVNKQTLESLKAGEKLMEALDLGVAEIESWENYEKSLKSW 769

Query: 777 QRKKLGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFT 836
           ++KK GE PMKPQ N++LIA+K  PE+YIMDTL +I+ SQLED+L+V+PFSYV+KF KF 
Sbjct: 770 KKKKSGEPPMKPQSNAILIAMKIKPEKYIMDTLGKIKPSQLEDSLLVLPFSYVIKFFKFF 829

Query: 837 DAVMQNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTED 896
           D +M+ K L+  HL LICK LFFI++ N+KEL++QKNEELK +I RVKT +R  L+   D
Sbjct: 830 DVIMKQKDLVLLHLSLICKILFFIVRTNNKELVAQKNEELKQRIERVKTNIRTMLQKNAD 889

Query: 897 DLGFNVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFERV 942
           DLGFN+ GL FI+QQWNL+HN EF D+Y Q E E   A+KRVFE V
Sbjct: 890 DLGFNIAGLNFIKQQWNLRHNLEFTDDYSQLEHEKKVAKKRVFETV 935

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score =  137 bits (344), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 173/716 (24%), Positives = 293/716 (40%), Gaps = 138/716 (19%)

Query: 39  GQLIT--SALENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAV 96
           GQ +T  S  + + I+ +KTG +V ++    P    DA  +             + LLAV
Sbjct: 73  GQYLTYVSQAQLLKIFHLKTGKVVRSMKISSPSYILDADST-------------STLLAV 119

Query: 97  GYADGVIKVWDLVSKTVLLNFNGHKAAITLMQF----DSTGTRLISGSKDSNIIVWDLVG 152
           G  DG I V D+ +  +  +F GH   I+ ++F    DS    L SG  +  + VWDLV 
Sbjct: 120 GGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLDSKIWLLASGDTNGMVKVWDLVK 179

Query: 153 EVGLYKLRSHKDAITGF---WCQGEDW----LVSTSKDGLIKIWDL---KTQQCIETHIA 202
              L+ L+ H  A+ G      Q  D     L+S  +D +I IWD    KT + I+T   
Sbjct: 180 RKCLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLSGGRDDIINIWDFNMKKTCKLIKTLPV 239

Query: 203 H--TGECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEMGIFEKQSKQRGLK 258
           +     C  L   DD  L+ T   D+  ++  L            E GI  K++  + ++
Sbjct: 240 NQQVESCGFLRYHDDKHLIYTAGGDAIFQLIDL------------ESGIMIKKT-NKPIE 286

Query: 259 IEFITNASDGVSF--FYIQNADKTIETYR----IRKEEEIAXXXXXXXXXXXXXXXTDEE 312
             FI      VS    ++  +D+T++       I+ E EI                   E
Sbjct: 287 ELFIIGVLPIVSSSKMFLVMSDQTLQLINVEEVIKSENEII------------------E 328

Query: 313 ISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNNTIEYYSIPYEKR 372
           +S +I  ++  +                A    V     +L + T++ ++    IP +  
Sbjct: 329 VSSTIAGNHGII----------------ADMRFVGPELNKLALATNSPSLRIIPIP-DLA 371

Query: 373 DPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTFECG 431
             T+  PL     E  G    + S+D ++D   +ATAS + S  +W  K ++  R FE  
Sbjct: 372 GTTASLPLDVEIYE--GHEDLLNSLDATEDGLWIATASKDNSAIVW--KYNENTRKFE-- 425

Query: 432 YALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKR---- 487
             +  K++                                H +A+ ++ L     +    
Sbjct: 426 --VYSKYI-------------------------------GHSSAVTAVGLPKIMPKGYPE 452

Query: 488 -LVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYL 546
            L+T S D T+K W  ++ K   P      V  +K++  T      DI ++ ISP+D   
Sbjct: 453 FLLTASNDLTIKKW--KIPKPTFPFD----VQTIKVSEYTRHAHEKDINALSISPNDSIF 506

Query: 547 AISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGD 606
           A +  D T K++ L++ +   +L  HK  +  +      K++ T S DK +KIW LD   
Sbjct: 507 ATASYDKTCKIWNLENGELEATLSNHKRGLWDVTFCQYDKLLATCSGDKTVKIWSLDTFS 566

Query: 607 CHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIS 666
             K+L  H +++    F+ +     SC  D ++K WD    EC++ L  H + +WAL   
Sbjct: 567 VMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLKTLDGHNNRLWALNTM 626

Query: 667 TDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
            DG  +VS+  D   + W++  +Q             + E +L   + +G+  +AF
Sbjct: 627 NDGDIIVSADADGVFQFWKDCTEQEKEEEQEKAKLQVEQEQSLQNYISQGDWTNAF 682

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 152/658 (23%), Positives = 256/658 (38%), Gaps = 101/658 (15%)

Query: 41  LITSALENVNIWDIKTG--DLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGY 98
           L T  L+ +NI D+  G  +++  +S+               E T L++  D   L    
Sbjct: 32  LATPMLDEINIIDLTPGSRNIIHRISN-----------EDEQEITALKLTPDGQYLTYVS 80

Query: 99  ADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYK 158
              ++K++ L +  V+ +      +  ++  DST T L  G  D +IIV D+      + 
Sbjct: 81  QAQLLKIFHLKTGKVVRSMKISSPSY-ILDADSTSTLLAVGGTDGSIIVVDIENGYITHS 139

Query: 159 LRSHKDAITGFWCQGE----DWLVSTS-KDGLIKIWDLKTQQCIETHIAHTGECWGLAVK 213
            + H   I+     G+     WL+++   +G++K+WDL  ++C+ T   H+    GL + 
Sbjct: 140 FKGHGGTISSLKFYGQLDSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHSSAVRGLDIV 199

Query: 214 DDL--------LITTSTDSQVKIWKLNMENEKMGEKLTEMGIFEKQSKQRGL------KI 259
           +          L++   D  + IW  NM   K   KL +     +Q +  G       K 
Sbjct: 200 EVQNSDEPFLKLLSGGRDDIINIWDFNM---KKTCKLIKTLPVNQQVESCGFLRYHDDKH 256

Query: 260 EFITNASDGV-------SFFYIQNADKTIETYRIRKEEEIAXXXXX--XXXXXXXXXXTD 310
              T   D +       S   I+  +K IE   I     I                    
Sbjct: 257 LIYTAGGDAIFQLIDLESGIMIKKTNKPIEELFIIGVLPIVSSSKMFLVMSDQTLQLINV 316

Query: 311 EEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNNTIEYYSIPYE 370
           EE+ KS  +     I+    T+   + I  A    V     +L + T++ ++    IP +
Sbjct: 317 EEVIKSENE-----IIEVSSTIAGNHGI-IADMRFVGPELNKLALATNSPSLRIIPIP-D 369

Query: 371 KRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTFE 429
               T+  PL     E  G    + S+D ++D   +ATAS + S  +W  K ++  R FE
Sbjct: 370 LAGTTASLPLDVEIYE--GHEDLLNSLDATEDGLWIATASKDNSAIVW--KYNENTRKFE 425

Query: 430 C-------GYALTC----KFLPGGLLVILGTRSGELQL-----------FDLASSSLLDT 467
                     A+T     K +P G    L T S +L +           FD+ +  + + 
Sbjct: 426 VYSKYIGHSSAVTAVGLPKIMPKGYPEFLLTASNDLTIKKWKIPKPTFPFDVQTIKVSEY 485

Query: 468 IEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF---QVEKTLVPGTKDKFVPMLKLNH 524
              AH+  I +L ++ +     T S DKT K W+    ++E TL              NH
Sbjct: 486 TRHAHEKDINALSISPNDSIFATASYDKTCKIWNLENGELEATLS-------------NH 532

Query: 525 DTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFD 584
              L        V     D+ LA    D TVK++ LD+     +L GH   V        
Sbjct: 533 KRGL------WDVTFCQYDKLLATCSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINK 586

Query: 585 SKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYW 642
            K +++  AD  IKIW    G+C K+L  H + + ++  + +     S   D V ++W
Sbjct: 587 QKQLVSCGADGLIKIWDCSSGECLKTLDGHNNRLWALNTMNDGDIIVSADADGVFQFW 644

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 83/188 (44%), Gaps = 18/188 (9%)

Query: 508 LVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYL 567
           L PG+++       + H  + E   +I +++++PD +YL        +K+F L + K   
Sbjct: 45  LTPGSRN-------IIHRISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVR 97

Query: 568 SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPES 627
           S+     P   +D    S ++     D +I +  ++ G    S   H  +I S+KF  + 
Sbjct: 98  SMKISS-PSYILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQL 156

Query: 628 HN----FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI----STDGSF--VVSSSH 677
            +      S   + +VK WD  K +C+  L  H S V  L I    ++D  F  ++S   
Sbjct: 157 DSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLSGGR 216

Query: 678 DHSIRIWE 685
           D  I IW+
Sbjct: 217 DDIINIWD 224

>TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {ON}
           Anc_8.435 YLR222C
          Length = 805

 Score =  132 bits (332), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 147/626 (23%), Positives = 265/626 (42%), Gaps = 118/626 (18%)

Query: 91  TNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDS--TGTRLISGSKDSNII-- 146
           + L+A+G  DG I V D+ +  +  +F GH   I+ ++F     G + +  S D+N +  
Sbjct: 113 STLIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKFHGELNGDKWLLASGDTNGVAK 172

Query: 147 VWDLVGEVGLYKLRSHKDAITGF---WCQGEDW--LVSTSKDGLIKIWDL---KTQQCIE 198
           VWDLV    L+ ++ H  AI G      +GED   L+S  +D ++ +W+    K  + ++
Sbjct: 173 VWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRDDIVNLWEFNMKKHSKLLK 232

Query: 199 THIAHTG-ECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGEKLTEMGIFEKQSKQRGL 257
           T   H   E  G   + DL+ T   ++ +++  +++E++K+ +K            Q+ +
Sbjct: 233 TVPVHQQVESCGFVRESDLVYTAGGEAVLQL--ISLESQKVIKK-----------TQKPI 279

Query: 258 KIEFITNASDGVSF--FYIQNADKTIETYRIRKEEEIAXXXXXXXXXXXXXXXTDEE--- 312
           +  FI      +S   FY+  +D+T++   I  EE I+                D+E   
Sbjct: 280 EELFIVGVLPILSGREFYLVLSDQTLQL--INMEEAISNF--------------DDELIN 323

Query: 313 ISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNNTIEYYSIPYEKR 372
           ++ SI  ++ ++                A    V     ++ + T++  +    IP    
Sbjct: 324 VASSIAGNHGTI----------------ADIRVVGPGLNKIALATNSPALRIIPIPQTSE 367

Query: 373 DPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKI-WNVKTHKCIRTFECG 431
           +     PL     E  G    + S+D ++D   LAT S  S  I W              
Sbjct: 368 NSL---PLDVEVYE--GHEDLLNSLDATEDGLWLATCSKDSSAILWRFNVE--------- 413

Query: 432 YALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKR---- 487
              T KF P                               H A++ ++ L +   R    
Sbjct: 414 ---TAKFFPYAKFT-------------------------GHSASVTAVALPNVMLRGWPE 445

Query: 488 -LVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELN-DDILSVRISPDDRY 545
            L+T S D TVK W     K   P  +D    +     + T  ++  DI ++ ++P+D  
Sbjct: 446 FLITASNDLTVKRW-----KVPKPANEDISDLLTIKQSEYTFHVHAKDINALSLAPNDSL 500

Query: 546 LAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG 605
            A +  D T K++ +++ +   +L GHK  +  +      K++ TSS DK IKIW LD  
Sbjct: 501 FATASYDKTCKIWDVETGESKATLAGHKRGLWDVSFCQYDKLLATSSGDKTIKIWNLDTF 560

Query: 606 DCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI 665
            C K+L  H +++    F+ +     S   D ++K WD    +C++ L  H + +WA+ +
Sbjct: 561 SCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLKTLDGHGNRIWAMNV 620

Query: 666 STDGSFVVSSSHDHSIRIWEE-TEDQ 690
             DG  ++S+  D   + W + TE+Q
Sbjct: 621 CNDGDLIISADADGVFQFWRDCTEEQ 646

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 136/589 (23%), Positives = 221/589 (37%), Gaps = 127/589 (21%)

Query: 126 LMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGE----DWLVSTS 181
           +M  DST T +  G  D +I V D+      +  + H   I+     GE     WL+++ 
Sbjct: 106 VMDSDSTSTLIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKFHGELNGDKWLLASG 165

Query: 182 -KDGLIKIWDLKTQQCIETHIAHTGECWGLAVK----DDL--LITTSTDSQVKIWKLNME 234
             +G+ K+WDL  ++C+ T   HT    GL  K    +D   L++   D  V +W+ NM+
Sbjct: 166 DTNGVAKVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRDDIVNLWEFNMK 225

Query: 235 NEKM---------------------------GEKLTEMGIFEKQ----SKQRGLKIEFIT 263
                                          GE + ++   E Q      Q+ ++  FI 
Sbjct: 226 KHSKLLKTVPVHQQVESCGFVRESDLVYTAGGEAVLQLISLESQKVIKKTQKPIEELFIV 285

Query: 264 NASDGVSF--FYIQNADKTIETYRIRKEEEIAXXXXXXXXXXXXXXXTDEE---ISKSIK 318
                +S   FY+  +D+T++   I  EE I+                D+E   ++ SI 
Sbjct: 286 GVLPILSGREFYLVLSDQTLQL--INMEEAISNF--------------DDELINVASSIA 329

Query: 319 DSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNNTIEYYSIPYEKRDPTSPA 378
            ++ ++                A    V     ++ + T++  +    IP    +     
Sbjct: 330 GNHGTI----------------ADIRVVGPGLNKIALATNSPALRIIPIPQTSEN---SL 370

Query: 379 PLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKI---WNVKTHKCIRTFE-CGY-- 432
           PL     E  G    + S+D ++D   LAT S  S  I   +NV+T K     +  G+  
Sbjct: 371 PLDVEVYE--GHEDLLNSLDATEDGLWLATCSKDSSAILWRFNVETAKFFPYAKFTGHSA 428

Query: 433 ALTCKFLPGGLLV----ILGTRSGEL-------------QLFDLASSSLLDTIEDAHDAA 475
           ++T   LP  +L      L T S +L              + DL +    +     H   
Sbjct: 429 SVTAVALPNVMLRGWPEFLITASNDLTVKRWKVPKPANEDISDLLTIKQSEYTFHVHAKD 488

Query: 476 IWSLDLTSDGKRLVTGSADKTVKFWDFQV--EKTLVPGTKDKFVPMLKLNHDTTLELNDD 533
           I +L L  +     T S DKT K WD +    K  + G K                    
Sbjct: 489 INALSLAPNDSLFATASYDKTCKIWDVETGESKATLAGHKRG------------------ 530

Query: 534 ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSA 593
           +  V     D+ LA S  D T+K++ LD+     +L GH   V         K +++S A
Sbjct: 531 LWDVSFCQYDKLLATSSGDKTIKIWNLDTFSCVKTLEGHTNAVQRCAFMNKQKQLVSSGA 590

Query: 594 DKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYW 642
           D  IKIW    GDC K+L  H + I ++    +     S   D V ++W
Sbjct: 591 DGLIKIWDCITGDCLKTLDGHGNRIWAMNVCNDGDLIISADADGVFQFW 639

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 70/156 (44%), Gaps = 3/156 (1%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           L +  + +L A    D   K+WD+ +        GHK  +  + F      L + S D  
Sbjct: 492 LSLAPNDSLFATASYDKTCKIWDVETGESKATLAGHKRGLWDVSFCQYDKLLATSSGDKT 551

Query: 145 IIVWDLVGEVGLYKLRSHKDAITGF-WCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAH 203
           I +W+L     +  L  H +A+    +   +  LVS+  DGLIKIWD  T  C++T   H
Sbjct: 552 IKIWNLDTFSCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLKTLDGH 611

Query: 204 TGECWGLAVKD--DLLITTSTDSQVKIWKLNMENEK 237
               W + V +  DL+I+   D   + W+   E ++
Sbjct: 612 GNRIWAMNVCNDGDLIISADADGVFQFWRDCTEEQR 647

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 78/179 (43%), Gaps = 15/179 (8%)

Query: 518 PMLKLNHDTTLELNDD---ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKL 574
           P  KL H  T+E NDD   I ++R++PD RYL        +K+F LDSMK   S+     
Sbjct: 47  PTQKLLH--TIE-NDDEQEITALRLTPDGRYLCYVSQAQQLKIFSLDSMKITRSMKISS- 102

Query: 575 PVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN----F 630
           P   +D    S +I     D +I +  ++ G    S   H  +I S+KF  E +      
Sbjct: 103 PSYVMDSDSTSTLIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKFHGELNGDKWLL 162

Query: 631 FSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI----STDGSFVVSSSHDHSIRIWE 685
            S   + V K WD  K  C+  +  H S +  L        D   ++S   D  + +WE
Sbjct: 163 ASGDTNGVAKVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRDDIVNLWE 221

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 61/140 (43%), Gaps = 13/140 (9%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           IWD++TG+   TL+ G   G  D      + C Y        LLA    D  IK+W+L +
Sbjct: 512 IWDVETGESKATLA-GHKRGLWDV-----SFCQY------DKLLATSSGDKTIKIWNLDT 559

Query: 111 KTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGF- 169
            + +    GH  A+    F +   +L+S   D  I +WD +    L  L  H + I    
Sbjct: 560 FSCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLKTLDGHGNRIWAMN 619

Query: 170 WCQGEDWLVSTSKDGLIKIW 189
            C   D ++S   DG+ + W
Sbjct: 620 VCNDGDLIISADADGVFQFW 639

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 86  EVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDST----GTRLISGSK 141
           E++ D  LLA G  +GV KVWDLV +  L     H +AI  + F         +L+SG +
Sbjct: 154 ELNGDKWLLASGDTNGVAKVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGR 213

Query: 142 DSNIIVWDL 150
           D  + +W+ 
Sbjct: 214 DDIVNLWEF 222

>AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR222C (UTP13)
          Length = 806

 Score =  131 bits (329), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 154/674 (22%), Positives = 266/674 (39%), Gaps = 119/674 (17%)

Query: 75  KGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGT 134
           K S PA    L+  + + LLAVG  DG + V+D+ +  V  +  GH A I+ ++F     
Sbjct: 99  KISSPA--YVLDCDESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKF----- 151

Query: 135 RLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQ 194
                            GEV            +G W      L S   +G++KIWDL  +
Sbjct: 152 ----------------YGEVD-----------SGMWL-----LASGDTNGMVKIWDLVKR 179

Query: 195 QCIETHIAHTGECWGLAVK-----DDLLITTSTDSQVKIWKLNMENEKMGEKLTEMGIFE 249
           +CI T   HT    GL ++     + LL++   D  V +   +M   K   KL +    +
Sbjct: 180 RCIHTVQEHTAAVRGLDIRVQEGAESLLLSGGRDDVVHVHHFDM---KKKCKLLQTIPVK 236

Query: 250 KQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIAXXXXXXXXXXXXXXXT 309
           +Q +  G    FI    D  S  Y    D   +   +   + I                 
Sbjct: 237 RQIESCG----FI---GDNTSLIYTAGGDAVYQIISLESGKSIKQTAQPVEELFIVGVLP 289

Query: 310 DEEISKS-IKDSYSSLILHPF-----QTVRSLYKIKSASWTTVTSSKLELVVTTSNNTIE 363
            +  +K  +  S  +L L        QT + +   K  +    T + + LV  + N    
Sbjct: 290 VQNSTKCYLVLSDQTLFLIDVEKALSQTEKMIEIEKKIAGNHGTIADMRLVGPSLNRLAL 349

Query: 364 YYSIPYEKRDPTSPAPLKTHTIELQ-----GQRTDVRSIDVSDDNKLLATAS-NGSLKIW 417
             + P  +  PT  A      +E++     G    + S+D + D   LATAS + S+ +W
Sbjct: 350 ATNSPTLRIIPTPQASEDKEVMEIETEMYEGHTDLLNSLDATSDGLWLATASKDHSVILW 409

Query: 418 NVKTHKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIW 477
             + ++   +FE       KFL                                H   + 
Sbjct: 410 --RYNEASSSFEP----FTKFL-------------------------------GHAGPVT 432

Query: 478 SLDLTSDGKR-----LVTGSADKTVKFWDFQVEKTLVPGTKDK----FVPMLKLNHDTTL 528
           ++ L +   R     L+T S D T+K W        VP   D+       ++K +  T  
Sbjct: 433 AIALPNVMNRNWPEFLLTASNDLTIKRWK-------VPNPNDRKAIELPHIVKASEYTRR 485

Query: 529 ELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMI 588
               DI ++ +SP+D   A +  D T K++ +D+ +   +L  HK  +  +       ++
Sbjct: 486 AHEKDINAISMSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLL 545

Query: 589 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFE 648
            T S D++I +W L+     K+L  H +++  V F+  +    S   D +VK WD    E
Sbjct: 546 ATCSGDRSINLWSLESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTGE 605

Query: 649 CIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDT 708
           C++ L AH + +WALA++ DG  ++++  D   + WE+  ++             + E +
Sbjct: 606 CVRTLDAHNNRIWALAVANDGQLIITADADGVFQFWEDNSEEEHERNIEQEKLRVEQEQS 665

Query: 709 LLTSLEEGNGDDAF 722
           L   + EG+ ++AF
Sbjct: 666 LQNYISEGDWNNAF 679

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 86/205 (41%), Gaps = 21/205 (10%)

Query: 92  NLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLV 151
           ++ A    D   K+W++ +  V      HK  +  + F      L + S D +I +W L 
Sbjct: 501 SIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLLATCSGDRSINLWSLE 560

Query: 152 GEVGLYKLRSHKDAITGF-WCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGL 210
               L  L  H +A+    +  G   LVST  DGL+KIWD  T +C+ T  AH    W L
Sbjct: 561 SFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTGECVRTLDAHNNRIWAL 620

Query: 211 AVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEMGIFEKQSKQRGLKIE-------F 261
           AV +D  L+IT   D   + W+ N E E            E+  +Q  L++E       +
Sbjct: 621 AVANDGQLIITADADGVFQFWEDNSEEEH-----------ERNIEQEKLRVEQEQSLQNY 669

Query: 262 ITNASDGVSFFYIQNADKTIETYRI 286
           I+      +F      D  +  Y +
Sbjct: 670 ISEGDWNNAFLLAMTLDHPMRLYHV 694

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 72/167 (43%), Gaps = 8/167 (4%)

Query: 524 HDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISF 583
           H    E   D+ ++R++PD RYL  +  +  ++ + L++ +   S+     P   +D   
Sbjct: 53  HKIENEDEQDVTALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMKISS-PAYVLDCDE 111

Query: 584 DSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN----FFSCSKDAVV 639
            S ++     D ++ ++ +  G    SL  H  +I SVKF  E  +      S   + +V
Sbjct: 112 SSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNGMV 171

Query: 640 KYWDGEKFECIQKLYAHQSEVWALAISTD---GSFVVSSSHDHSIRI 683
           K WD  K  CI  +  H + V  L I       S ++S   D  + +
Sbjct: 172 KIWDLVKRRCIHTVQEHTAAVRGLDIRVQEGAESLLLSGGRDDVVHV 218

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 68/153 (44%), Gaps = 15/153 (9%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGS-KPAECTYLEVHQDTNLLAVGYADGVIKVWDLV 109
           IW++ TG++  TL       A+  +G    A C Y        LLA    D  I +W L 
Sbjct: 514 IWNVDTGEVEATL-------ANHKRGLWGVAFCEY------DWLLATCSGDRSINLWSLE 560

Query: 110 SKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGF 169
           S TVL    GH  A+  + F +   +L+S   D  + +WD      +  L +H + I   
Sbjct: 561 SFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTGECVRTLDAHNNRIWAL 620

Query: 170 WCQGEDWLVSTS-KDGLIKIWDLKTQQCIETHI 201
               +  L+ T+  DG+ + W+  +++  E +I
Sbjct: 621 AVANDGQLIITADADGVFQFWEDNSEEEHERNI 653

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 70/160 (43%), Gaps = 21/160 (13%)

Query: 463 SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKL 522
           +++  IE+  +  + +L LT DG+ L   S ++ ++F+D + ++T           +L  
Sbjct: 50  AIIHKIENEDEQDVTALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMKISSPAYVLDC 109

Query: 523 NHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDI- 581
           +  +TL                 LA+   D +V VF + +     SL GH   + S+   
Sbjct: 110 DESSTL-----------------LAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFY 152

Query: 582 -SFDSKMIITSSADKN--IKIWGLDFGDCHKSLFAHQDSI 618
              DS M + +S D N  +KIW L    C  ++  H  ++
Sbjct: 153 GEVDSGMWLLASGDTNGMVKIWDLVKRRCIHTVQEHTAAV 192

>NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {ON}
           Anc_8.435
          Length = 857

 Score =  123 bits (308), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 144/615 (23%), Positives = 252/615 (40%), Gaps = 104/615 (16%)

Query: 126 LMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGED----WLV-ST 180
           +M  DST T +  G  D +IIV D+      +  + H   I+     G +    WL+ S 
Sbjct: 123 IMDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSVKFYGNNDTNCWLLCSG 182

Query: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVK------DDL---LITTSTDSQVKIWKL 231
             +G++KIWDL  + CI T   H     GL V+      D++   L++ S D+ V +W+ 
Sbjct: 183 DTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSGSRDNIVNLWEF 242

Query: 232 NMENEKMGEKLTEMGIFEKQSKQRGL------KIEFITNASDGVSFFYIQNADKTIETYR 285
           N+   K+ + L  + +  +Q +  G       +++ I   + G + F + +  K     R
Sbjct: 243 NLR--KLCKLLKTLPV-NQQVESCGFIHDHDNELQDIIYTAGGEAIFQLISLSKGSVIKR 299

Query: 286 IRKEEEIAXXXXXXXXXXXXXXXTDEEISKSIKDSYSSL-------ILHPFQTVRSLYKI 338
             K  E                 T+ +++  I  S  +L        L P +    + +I
Sbjct: 300 TVKPTE-----ELFIIGTLPFTATNNDLNSYIVMSDQTLQMINLTKALSPTELSNPIIEI 354

Query: 339 KSA---SWTTVTSSKL------ELVVTTSNNTIEYYSIPYEKRDPTSP------APLKTH 383
           +S    +  T+   K       +L + T++ T+    +P   ++   P      A L  +
Sbjct: 355 ESCIAGNHGTIADMKFVGQDLNKLALATNSPTLRIIPVPSTMKEAADPNTQDNSADLPIN 414

Query: 384 TIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGL 443
               +G    + S+  ++D + LATAS     I    + +  R F   YA   KF+    
Sbjct: 415 METYEGHTDLLNSLAATEDGQWLATASKDHTSILWKYSSETSRFF--AYA---KFI---- 465

Query: 444 LVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKR-----LVTGSADKTVK 498
                                       H +++ ++ L +   R     L+T S D T+K
Sbjct: 466 ---------------------------GHSSSVTAVGLPNVLLRGYPEFLITASNDLTIK 498

Query: 499 FWDFQVEKTLVPG-------TKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLL 551
            W     K   P        +KDK   ++K++  T    + DI S+ ISP+D  +A    
Sbjct: 499 KW-----KIPTPSKERSDDESKDK-THIIKVSEYTRHAHDKDINSISISPNDSLIATGSY 552

Query: 552 DNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSL 611
           D + K++ LDS +   +L  HK  +  +      K+I T S DK IK+W LD     K+ 
Sbjct: 553 DKSCKLWNLDSGELVATLNNHKRGIWDVSFCQFDKLIATCSGDKTIKLWSLDTFAVLKTF 612

Query: 612 FAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSF 671
             H +++    F+ +     S   D ++K WD    +C++ L  H + +WAL    DG  
Sbjct: 613 AGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCTTGDCLKTLDGHDNRIWALTTWNDGEL 672

Query: 672 VVSSSHDHSIRIWEE 686
           +VS+  D  ++ W +
Sbjct: 673 IVSADADGVLQFWND 687

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 68/148 (45%), Gaps = 3/148 (2%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           + +  + +L+A G  D   K+W+L S  ++   N HK  I  + F      + + S D  
Sbjct: 538 ISISPNDSLIATGSYDKSCKLWNLDSGELVATLNNHKRGIWDVSFCQFDKLIATCSGDKT 597

Query: 145 IIVWDLVGEVGLYKLRSHKDAITGF-WCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAH 203
           I +W L     L     H +A+    +   +  LVS+  DGLIKIWD  T  C++T   H
Sbjct: 598 IKLWSLDTFAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCTTGDCLKTLDGH 657

Query: 204 TGECWGLAVKDD--LLITTSTDSQVKIW 229
               W L   +D  L+++   D  ++ W
Sbjct: 658 DNRIWALTTWNDGELIVSADADGVLQFW 685

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 67/153 (43%), Gaps = 19/153 (12%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           +W++ +G+LV TL++    G  D      + C +        L+A    D  IK+W L +
Sbjct: 558 LWNLDSGELVATLNNH-KRGIWDV-----SFCQF------DKLIATCSGDKTIKLWSLDT 605

Query: 111 KTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGF- 169
             VL  F GH  A+    F +   +L+S   D  I +WD      L  L  H + I    
Sbjct: 606 FAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCTTGDCLKTLDGHDNRIWALT 665

Query: 170 -WCQGEDWLVSTSKDGLIKIWDLKTQQCIETHI 201
            W  GE  +VS   DG+++ W+     C E  I
Sbjct: 666 TWNDGE-LIVSADADGVLQFWN----DCTELEI 693

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 86/186 (46%), Gaps = 26/186 (13%)

Query: 526 TTLELNDD--ILSVRISPDDRYL-AISLLDNTVKVFFLDSMKFYLSLYGHKL-------- 574
           TT+  ND+  I  ++++PD ++L +I+L    +K++ L +++   ++   +         
Sbjct: 56  TTITNNDEQEITCLKLTPDGKFLISIALQSQALKIYNLTAIEGETTMNTKQQSLQPIKTL 115

Query: 575 ----PVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP--ESH 628
               P   +D    S ++     D +I +  ++ G    S   H  +I SVKF    +++
Sbjct: 116 KLSSPSYIMDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSVKFYGNNDTN 175

Query: 629 NFFSCSKD--AVVKYWDGEKFECIQKLYAHQSEVWAL---AISTDGSFVV----SSSHDH 679
            +  CS D   +VK WD  K  CI  L  H S V  L   ++S +   VV    S S D+
Sbjct: 176 CWLLCSGDTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSGSRDN 235

Query: 680 SIRIWE 685
            + +WE
Sbjct: 236 IVNLWE 241

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 59/123 (47%), Gaps = 12/123 (9%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQF----DSTGTRLISGS 140
           ++    + L+AVG  DG I V D+ +  +  +F GH   I+ ++F    D+    L SG 
Sbjct: 124 MDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSVKFYGNNDTNCWLLCSGD 183

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGED--------WLVSTSKDGLIKIWDLK 192
            +  + +WDLV    ++ L+ H  A+ G   +            L+S S+D ++ +W+  
Sbjct: 184 TNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSGSRDNIVNLWEFN 243

Query: 193 TQQ 195
            ++
Sbjct: 244 LRK 246

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 50/118 (42%), Gaps = 9/118 (7%)

Query: 118 NGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFW----CQG 173
           + H   I  +      + + +GS D +  +W+L     +  L +HK    G W    CQ 
Sbjct: 529 HAHDKDINSISISPNDSLIATGSYDKSCKLWNLDSGELVATLNNHK---RGIWDVSFCQF 585

Query: 174 EDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAV--KDDLLITTSTDSQVKIW 229
           +  + + S D  IK+W L T   ++T   HT          K   L+++  D  +KIW
Sbjct: 586 DKLIATCSGDKTIKLWSLDTFAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIW 643

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score =  122 bits (307), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 144/678 (21%), Positives = 271/678 (39%), Gaps = 94/678 (13%)

Query: 81  ECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGS 140
           E T L +  D   LA      ++K++ L +  ++ +      +  ++  D T T L  G 
Sbjct: 63  EITALRLTPDGQYLAYVSQAQLLKIFQLKTGRIVRSLKISSPSY-ILDTDPTSTLLAVGG 121

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDAITG--FWCQ--GEDWLVSTS-KDGLIKIWDLKTQQ 195
            D +I++ D+      + L+ H   I+   F+ Q   E WL+++   +G++K+WDL  ++
Sbjct: 122 TDGSIVIVDIENGYITHSLKGHGGTISSLKFYGQLDSETWLLASGDTNGMVKVWDLVKRK 181

Query: 196 CIETHIAHTGECWGLAVKDD--------LLITTSTDSQVKIWKLNMENEKMGEKLTEMGI 247
           C+ T   H+    GL + +          L++   D  V +W  +M+ +    KL +   
Sbjct: 182 CLLTLQEHSSAVRGLDIIEGESGDGSSLKLLSGGRDDIVNVWDFDMKKKC---KLVKTLP 238

Query: 248 FEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIAXXXXXXXXX---XX 304
             +Q +  G    F+ N  DG    Y    D   +   +     +               
Sbjct: 239 VNQQVESCG----FLKN-HDGKRIIYTAGGDAIFQLIDLESGTVLKRTNKPIEELFIIGV 293

Query: 305 XXXXTDEEISKSIKDSYSSLI------LHPFQTVRSLYKIKS-----ASWTTVTSSKLEL 353
                D E+   + D    LI       +   T+ +   I       A    V     +L
Sbjct: 294 LPIMNDSEMFLVMSDQTLQLINIEEVLENENDTINARSTIAGNNGIIADMRFVGPELNKL 353

Query: 354 VVTTSNNTIEYYSIP-YEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNG 412
            + T++ ++    IP     D + P  ++ +    +G    + S+D ++D   +ATAS  
Sbjct: 354 ALATNSPSLRIIPIPDLSGADASLPLDVEIY----EGHEDLLNSLDATEDGLWIATASKD 409

Query: 413 SLKI---WNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIE 469
           +  I   +N +T K                                 FD+ +  +     
Sbjct: 410 NTAILWKYNERTSK---------------------------------FDIYAKYI----- 431

Query: 470 DAHDAAIWSLDLTSDGKR-----LVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNH 524
             H +A+ ++ L +   +     L+T S D T+K W      +++       V ++K++ 
Sbjct: 432 -GHSSAVTAVGLPNVMPKGYPEFLLTASNDLTIKKWKVPKPTSIMD------VQIIKVSE 484

Query: 525 DTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFD 584
            T      DI ++ +SP+D   A +  D T K++ L++ +   +L  HK  +  +     
Sbjct: 485 YTRHAHEKDINALSVSPNDSIFATASYDKTCKIWSLENGELEATLANHKRGLWDVSFCQY 544

Query: 585 SKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDG 644
            K++ TSS DK +KIW LD     K+L  H +++    F+ +     SC  D ++K WD 
Sbjct: 545 DKLLATSSGDKTVKIWSLDTFSVMKTLEGHSNAVQRCSFINKQKQLVSCGADGLIKIWDC 604

Query: 645 EKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQ 704
              EC+  L  H + +WAL    DG  +VS+  D   + W++  +Q             +
Sbjct: 605 SSGECLNTLDGHNNRLWALNTMNDGDMIVSADADGVFQFWKDCSEQEKEEELEKAKVQVE 664

Query: 705 YEDTLLTSLEEGNGDDAF 722
            E +L   + +G+  +AF
Sbjct: 665 QEQSLQNYISQGDWTNAF 682

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 81/175 (46%), Gaps = 11/175 (6%)

Query: 521 KLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSID 580
           K+ H  + E   +I ++R++PD +YLA       +K+F L + +   SL     P   +D
Sbjct: 51  KILHKISNEDEQEITALRLTPDGQYLAYVSQAQLLKIFQLKTGRIVRSLKISS-PSYILD 109

Query: 581 ISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPE--SHNFFSCSKD-- 636
               S ++     D +I I  ++ G    SL  H  +I S+KF  +  S  +   S D  
Sbjct: 110 TDPTSTLLAVGGTDGSIVIVDIENGYITHSLKGHGGTISSLKFYGQLDSETWLLASGDTN 169

Query: 637 AVVKYWDGEKFECIQKLYAHQSEVWALAI----STDGSF--VVSSSHDHSIRIWE 685
            +VK WD  K +C+  L  H S V  L I    S DGS   ++S   D  + +W+
Sbjct: 170 GMVKVWDLVKRKCLLTLQEHSSAVRGLDIIEGESGDGSSLKLLSGGRDDIVNVWD 224

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 73/158 (46%), Gaps = 24/158 (15%)

Query: 49  VNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDL 108
           + I+ +KTG +V +L           K S P+    L+    + LLAVG  DG I + D+
Sbjct: 85  LKIFQLKTGRIVRSL-----------KISSPS--YILDTDPTSTLLAVGGTDGSIVIVDI 131

Query: 109 VSKTVLLNFNGHKAAITLMQF----DSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKD 164
            +  +  +  GH   I+ ++F    DS    L SG  +  + VWDLV    L  L+ H  
Sbjct: 132 ENGYITHSLKGHGGTISSLKFYGQLDSETWLLASGDTNGMVKVWDLVKRKCLLTLQEHSS 191

Query: 165 AITGF-WCQGEDW------LVSTSKDGLIKIWDLKTQQ 195
           A+ G    +GE        L+S  +D ++ +WD   ++
Sbjct: 192 AVRGLDIIEGESGDGSSLKLLSGGRDDIVNVWDFDMKK 229

>NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {ON}
           Anc_8.435
          Length = 815

 Score =  113 bits (282), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 137/592 (23%), Positives = 237/592 (40%), Gaps = 87/592 (14%)

Query: 126 LMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITG--FWCQGED--WLV-ST 180
           +M  DST T +  G  D +I V D+      + L+ H   I+   F+ Q     WL+ S 
Sbjct: 111 IMDCDSTSTLVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSG 170

Query: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDD----LLITTSTDSQVKIWKLNMENE 236
             +G++K+WDL  ++C+ T   H+    GL V++      LI+   D+   +W     N 
Sbjct: 171 DTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLWNF---NL 227

Query: 237 KMGEKLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKE------- 289
           K    L +     +Q +  G    FI +  D     Y    D  ++   + K        
Sbjct: 228 KKKCTLLKTIPVHQQVESCG----FINHEHD--DLIYTAGGDALLQFISLEKATMIKKTK 281

Query: 290 ---EEIAXXXXXXXXXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTV 346
              EE+                   + +  + D  S+L L+    +  +    + +  T+
Sbjct: 282 KHIEELFIIGVLPILENDKMYLVMSDQTLELVDIKSNL-LNESSDIIEIESCIAGNNGTI 340

Query: 347 TSSKL------ELVVTTSNNTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVS 400
              K       +L + T++ T+    +P  +++     P+     E  G    + S+D +
Sbjct: 341 ADMKFVGPNHDKLALATNSPTLRIIPVPSSEQEE---LPINVEMYE--GHEDLLNSLDTT 395

Query: 401 DDNKLLATASNGSLKI-WNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDL 459
           DD   +ATAS     I W  K +  I  F+  Y    KF+                    
Sbjct: 396 DDGLWMATASKDHTAIVW--KYNSIINKFQ-PYV---KFI-------------------- 429

Query: 460 ASSSLLDTIEDAHDAAIWSLDLTSDGKR-----LVTGSADKTVKFWDFQVEKTLVPGTKD 514
                       H A + ++ L +   R     L+T S D T+K W      T V    +
Sbjct: 430 -----------GHSATVTAVGLPNVMLRGYPEFLLTASNDLTIKKWKIPKPSTTV----E 474

Query: 515 KFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKL 574
           +   ++K++  T      DI ++ ISP+D   A +  D T K++ L++ +   +L  HK 
Sbjct: 475 EDCQIVKVSEYTRRAHEKDINALAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKR 534

Query: 575 PVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCS 634
            +  +      K+I T S DK IKIW LD     K+L  H +++    F+ +     S  
Sbjct: 535 GLWDVAFCQYDKLIATCSGDKTIKIWSLDTFSVMKTLEGHTNAVQRCMFINKQLQLVSSG 594

Query: 635 KDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEE 686
            D ++K WD    +C++ L  H + +WAL    DG  +VS+  D   + W++
Sbjct: 595 ADGLIKIWDCSTGDCLKTLDGHDNRIWALTEINDGDMIVSADADGVFQFWKD 646

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 70/156 (44%), Gaps = 3/156 (1%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           L +  + ++ A    D   K+WDL +  +    + HK  +  + F      + + S D  
Sbjct: 497 LAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKT 556

Query: 145 IIVWDLVGEVGLYKLRSHKDAIT-GFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAH 203
           I +W L     +  L  H +A+    +   +  LVS+  DGLIKIWD  T  C++T   H
Sbjct: 557 IKIWSLDTFSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGH 616

Query: 204 TGECWGLA-VKD-DLLITTSTDSQVKIWKLNMENEK 237
               W L  + D D++++   D   + WK   E EK
Sbjct: 617 DNRIWALTEINDGDMIVSADADGVFQFWKDCTELEK 652

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 66/128 (51%), Gaps = 9/128 (7%)

Query: 75  KGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQF----D 130
           K S P  C  ++    + L+A+G  DG I V D+ +  +  +  GH A I+ ++F    +
Sbjct: 104 KMSSP--CYIMDCDSTSTLVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQAN 161

Query: 131 STGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQ--GEDW-LVSTSKDGLIK 187
           S    L SG  +  + VWDLV    L+ ++ H +A+ G   +  G++W L+S  +D +  
Sbjct: 162 SNVWLLCSGDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCT 221

Query: 188 IWDLKTQQ 195
           +W+   ++
Sbjct: 222 LWNFNLKK 229

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 61/143 (42%), Gaps = 19/143 (13%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           IWD++ G+L  TLS+    G  D      A C Y        L+A    D  IK+W L +
Sbjct: 517 IWDLENGELTATLSNH-KRGLWDV-----AFCQY------DKLIATCSGDKTIKIWSLDT 564

Query: 111 KTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFW 170
            +V+    GH  A+    F +   +L+S   D  I +WD      L  L  H + I   W
Sbjct: 565 FSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGHDNRI---W 621

Query: 171 CQGE----DWLVSTSKDGLIKIW 189
              E    D +VS   DG+ + W
Sbjct: 622 ALTEINDGDMIVSADADGVFQFW 644

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 77/167 (46%), Gaps = 13/167 (7%)

Query: 531 NDD---ILSVRISPDDRYLAISLLDNTVKVFFLDSMK----FYLSLYGHKLPVLSIDISF 583
           NDD   I +++++PD +YL+    +  +K+F LD  K      +       P   +D   
Sbjct: 57  NDDEQEITALKLTPDAQYLSFISQNQLLKIFKLDQEKKDQGKIIRSMKMSSPCYIMDCDS 116

Query: 584 DSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN--FFSCSKD--AVV 639
            S ++     D +I +  ++ G    SL  H  +I ++KF  ++++  +  CS D   +V
Sbjct: 117 TSTLVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMV 176

Query: 640 KYWDGEKFECIQKLYAHQSEVWALAISTDGS--FVVSSSHDHSIRIW 684
           K WD  K +C+  +  H + V  L +   G    ++S   D+   +W
Sbjct: 177 KVWDLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLW 223

>Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}
           similar to Ashbya gossypii AGR180W
          Length = 810

 Score =  111 bits (278), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 118/235 (50%), Gaps = 3/235 (1%)

Query: 488 LVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLA 547
           L++ S D TVK W  +V K     T+D+ +P++K +  T      DI ++ ISP+D   A
Sbjct: 447 LLSSSTDMTVKKW--KVPKPTQNPTEDE-IPVVKTSEYTRRAHEKDINALSISPNDSIFA 503

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            +  D T K++ L + +   +L  HK  +  +      K+I T S DK IKIW L+  + 
Sbjct: 504 TASYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQHDKLIATCSGDKTIKIWSLENYNI 563

Query: 608 HKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST 667
             +L  H +++  + F+ ++    SC  D +VK WD    EC++ L AH + +WAL ++ 
Sbjct: 564 KATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAHDNRIWALEVAD 623

Query: 668 DGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
           DG   V++  D   + W++  ++             + E +L   L +G+  +AF
Sbjct: 624 DGDRFVTADADGLFQFWKDNSEEEHEQDLEKKRLKVEQEQSLQNYLSKGDWVNAF 678

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 67/155 (43%), Gaps = 3/155 (1%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           L +  + ++ A    D   K+WDLV+  ++     HK  +  + F      + + S D  
Sbjct: 493 LSISPNDSIFATASYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQHDKLIATCSGDKT 552

Query: 145 IIVWDLVGEVGLYKLRSHKDAITGF-WCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAH 203
           I +W L        L  H +A+    +      LVS   DGL+KIWD  T +C+ T  AH
Sbjct: 553 IKIWSLENYNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAH 612

Query: 204 TGECWGLAVKD--DLLITTSTDSQVKIWKLNMENE 236
               W L V D  D  +T   D   + WK N E E
Sbjct: 613 DNRIWALEVADDGDRFVTADADGLFQFWKDNSEEE 647

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 78/172 (45%), Gaps = 16/172 (9%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLEL 530
           AH+  I +L ++ +     T S DKT K WD      LV G   + V  L  NH   L  
Sbjct: 485 AHEKDINALSISPNDSIFATASYDKTCKIWD------LVTG---ELVATLA-NHKRGL-- 532

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
                 V     D+ +A    D T+K++ L++     +L GH   V  I     +K +++
Sbjct: 533 ----WDVSFCQHDKLIATCSGDKTIKIWSLENYNIKATLEGHTNAVQRISFINKNKQLVS 588

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYW 642
             AD  +KIW    G+C ++L AH + I +++   +   F +   D + ++W
Sbjct: 589 CGADGLVKIWDCSTGECLRTLDAHDNRIWALEVADDGDRFVTADADGLFQFW 640

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 101/211 (47%), Gaps = 25/211 (11%)

Query: 28  ASSRTNNGSGPGQLITSALENVNIWDIK-TGDLVTTLSDGLPPGASDAKGSKPAECTYLE 86
           A S TN+GS    L TS L+ +NI  +K   ++V  +++               E T L+
Sbjct: 22  AVSITNDGS---LLATSVLDVINIVQLKERHEIVHKINN-----------DDEQEITALK 67

Query: 87  VHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNII 146
           +  D + L     + +++++ L SK ++ +     + + +M  D T T L+ G  D ++ 
Sbjct: 68  LTPDGSYLCFVAQNQLLRIYSLASKKIVRSMKV-SSPVYVMDCDETSTLLVIGGTDGSVS 126

Query: 147 VWDLVGEVGLYKLRSHKDAITGFWCQGE----DWLVSTS-KDGLIKIWDLKTQQCIETHI 201
           ++D+      +  + H   I+     GE    +WL+++   +G++KIWDL  ++C+ T  
Sbjct: 127 IFDIENGYVTHSFKGHGGIISSVKFYGELDGANWLLASGDTNGVVKIWDLVKRRCMHTIQ 186

Query: 202 AHTGECWGL--AVKDD--LLITTSTDSQVKI 228
            HT    GL   VKD   LLI+   D  + +
Sbjct: 187 EHTAAVRGLDFCVKDSEMLLISGGRDEIINL 217

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 78/177 (44%), Gaps = 11/177 (6%)

Query: 517 VPMLKLNHDTTLELNDD----ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGH 572
           +  LK  H+   ++N+D    I +++++PD  YL     +  ++++ L S K   S+   
Sbjct: 42  IVQLKERHEIVHKINNDDEQEITALKLTPDGSYLCFVAQNQLLRIYSLASKKIVRSMKVS 101

Query: 573 KLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPE--SHNF 630
             PV  +D    S +++    D ++ I+ ++ G    S   H   I SVKF  E    N+
Sbjct: 102 S-PVYVMDCDETSTLLVIGGTDGSVSIFDIENGYVTHSFKGHGGIISSVKFYGELDGANW 160

Query: 631 FSCSKD--AVVKYWDGEKFECIQKLYAHQSEVWALAISTDGS--FVVSSSHDHSIRI 683
              S D   VVK WD  K  C+  +  H + V  L      S   ++S   D  I +
Sbjct: 161 LLASGDTNGVVKIWDLVKRRCMHTIQEHTAAVRGLDFCVKDSEMLLISGGRDEIINL 217

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 57/102 (55%), Gaps = 6/102 (5%)

Query: 403 NKLLATAS-NGSLKIWNVKTHKCIRTFECGYALTCK---FLPGGLLVILGTRSGELQLFD 458
           +KL+AT S + ++KIW+++ +    T E G+    +   F+     ++     G ++++D
Sbjct: 541 DKLIATCSGDKTIKIWSLENYNIKATLE-GHTNAVQRISFINKNKQLVSCGADGLVKIWD 599

Query: 459 LASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
            ++   L T+ DAHD  IW+L++  DG R VT  AD   +FW
Sbjct: 600 CSTGECLRTL-DAHDNRIWALEVADDGDRFVTADADGLFQFW 640

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 59/140 (42%), Gaps = 13/140 (9%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           IWD+ TG+LV TL++    G  D           +   Q   L+A    D  IK+W L +
Sbjct: 513 IWDLVTGELVATLANH-KRGLWD-----------VSFCQHDKLIATCSGDKTIKIWSLEN 560

Query: 111 KTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFW 170
             +     GH  A+  + F +   +L+S   D  + +WD      L  L +H + I    
Sbjct: 561 YNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAHDNRIWALE 620

Query: 171 CQGE-DWLVSTSKDGLIKIW 189
              + D  V+   DGL + W
Sbjct: 621 VADDGDRFVTADADGLFQFW 640

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 49/252 (19%), Positives = 99/252 (39%), Gaps = 62/252 (24%)

Query: 353 LVVTTSNNTIEYYSIPYEKRDPTSP--APLKTHTIELQGQRTDVRSIDVSDDNKLLATAS 410
           L+ ++++ T++ + +P   ++PT      +KT     +    D+ ++ +S ++ + ATAS
Sbjct: 447 LLSSSTDMTVKKWKVPKPTQNPTEDEIPVVKTSEYTRRAHEKDINALSISPNDSIFATAS 506

Query: 411 NGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIED 470
                                Y  TCK                  ++DL +  L+ T+ +
Sbjct: 507 ---------------------YDKTCK------------------IWDLVTGELVATLAN 527

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLEL 530
            H   +W +      K + T S DKT+K W  +                   N   TLE 
Sbjct: 528 -HKRGLWDVSFCQHDKLIATCSGDKTIKIWSLE-----------------NYNIKATLEG 569

Query: 531 NDDILSVRIS--PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMI 588
           + + +  RIS    ++ L     D  VK++   + +   +L  H   + +++++ D    
Sbjct: 570 HTNAVQ-RISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAHDNRIWALEVADDGDRF 628

Query: 589 ITSSADKNIKIW 600
           +T+ AD   + W
Sbjct: 629 VTADADGLFQFW 640

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 65/143 (45%), Gaps = 27/143 (18%)

Query: 568 SLYGHKLPVL-SIDISFDSKMIITSSADKNIKIWGL--DFGDC--HKSLFAHQDSIMSVK 622
           ++YG  + +L ++D S D   I T+S D  + +W      GD   +     H  S+ +V 
Sbjct: 375 NMYGGHVDLLNALDASEDGLWIATASKDHTVLLWRYSEQLGDFKQYAKFIGHAGSVTAVA 434

Query: 623 F--LPESH--NF-FSCSKDAVVKYWDGEK---------------FECIQKLYAHQSEVWA 662
              + + H  NF  S S D  VK W   K                E  ++  AH+ ++ A
Sbjct: 435 LPNIMDQHFPNFLLSSSTDMTVKKWKVPKPTQNPTEDEIPVVKTSEYTRR--AHEKDINA 492

Query: 663 LAISTDGSFVVSSSHDHSIRIWE 685
           L+IS + S   ++S+D + +IW+
Sbjct: 493 LSISPNDSIFATASYDKTCKIWD 515

 Score = 32.0 bits (71), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 55/140 (39%), Gaps = 25/140 (17%)

Query: 117 FNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLY----KLRSHKDAITGFWCQ 172
           + GH   +  +     G  + + SKD  +++W    ++G +    K   H  ++T     
Sbjct: 377 YGGHVDLLNALDASEDGLWIATASKDHTVLLWRYSEQLGDFKQYAKFIGHAGSVTAVALP 436

Query: 173 G------EDWLVSTSKDGLIKIWDL--KTQQCIETHI-----------AHTGECWGLAV- 212
                   ++L+S+S D  +K W +   TQ   E  I           AH  +   L++ 
Sbjct: 437 NIMDQHFPNFLLSSSTDMTVKKWKVPKPTQNPTEDEIPVVKTSEYTRRAHEKDINALSIS 496

Query: 213 -KDDLLITTSTDSQVKIWKL 231
             D +  T S D   KIW L
Sbjct: 497 PNDSIFATASYDKTCKIWDL 516

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score =  110 bits (274), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 91/378 (24%), Positives = 163/378 (43%), Gaps = 54/378 (14%)

Query: 352 ELVVTTSNNTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASN 411
           +L + T++ ++    +P +   P +  PL     E  G    + S+D ++D   +ATAS 
Sbjct: 352 KLALATNSPSLRIIPVP-DLSGPEASLPLDVEIYE--GHEDLLNSLDATEDGLWIATASK 408

Query: 412 GSLKI-WNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIED 470
            +  I W    + C                                FD+ +  +      
Sbjct: 409 DNTAIVWRYNENSC-------------------------------KFDIYAKYI------ 431

Query: 471 AHDAAIWSLDL---TSDG--KRLVTGSADKTVKFWDFQVEKTLVP-GTKDKFVPMLKLNH 524
            H AA+ ++ L    S G  + L+T S D T+K W       ++P  T    V ++K++ 
Sbjct: 432 GHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKKW-------IIPKPTASMDVQIIKVSE 484

Query: 525 DTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFD 584
            T      DI ++ +SP+D   A +  D T K++ L++ +   +L  HK  +  +     
Sbjct: 485 YTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQY 544

Query: 585 SKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDG 644
            K++ TSS DK +KIW LD     K+L  H +++    F+ +     SC  D ++K WD 
Sbjct: 545 DKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDC 604

Query: 645 EKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQ 704
              EC++ L  H + +WAL+   DG  +VS+  D   + W++  +Q             +
Sbjct: 605 SSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWKDCTEQEIEEEQEKAKLQVE 664

Query: 705 YEDTLLTSLEEGNGDDAF 722
            E +L   + +G+  +AF
Sbjct: 665 QEQSLQNYMSKGDWTNAF 682

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 75/175 (42%), Gaps = 12/175 (6%)

Query: 68  PPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVI---------KVWDLVSKTVLLNFN 118
           P  + D +  K +E T     +D N L+V   D +          K+W+L +  +     
Sbjct: 471 PTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLA 530

Query: 119 GHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGF-WCQGEDWL 177
            HK  +  + F      L + S D  + +W L     +  L  H +A+    +   +  L
Sbjct: 531 NHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQL 590

Query: 178 VSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKD--DLLITTSTDSQVKIWK 230
           +S   DGLIKIWD  + +C++T   H    W L+  +  D++++   D   + WK
Sbjct: 591 ISCGADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWK 645

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 90/208 (43%), Gaps = 27/208 (12%)

Query: 41  LITSALENVNIWDIKTGD--LVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGY 98
           L T  L+ +NI D+  G   ++  +S+               E T L++  D   L    
Sbjct: 32  LATPVLDEINIIDLTPGSRKILHKISN-----------EDEQEITALKLTPDGQYLTYVS 80

Query: 99  ADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYK 158
              ++K++ L +  V+ +      +  ++  DST T L  G  D +IIV D+      + 
Sbjct: 81  QAQLLKIFHLKTGKVVRSMKISSPSY-ILDADSTSTLLAVGGTDGSIIVVDIENGYITHS 139

Query: 159 LRSHKDAITGFWCQGE----DWLVSTS-KDGLIKIWDLKTQQCIETHIAHTGECWGL--- 210
            + H   I+     G+     WL+++   +G++K+WDL  ++C+ T   HT    GL   
Sbjct: 140 FKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDII 199

Query: 211 AVKDD-----LLITTSTDSQVKIWKLNM 233
            V D+      L++   D  + +W  NM
Sbjct: 200 EVPDNDEPSLNLLSGGRDDIINLWDFNM 227

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 72/162 (44%), Gaps = 12/162 (7%)

Query: 508 LVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYL 567
           L PG++       K+ H  + E   +I +++++PD +YL        +K+F L + K   
Sbjct: 45  LTPGSR-------KILHKISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVR 97

Query: 568 SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPES 627
           S+     P   +D    S ++     D +I +  ++ G    S   H  +I S+KF  + 
Sbjct: 98  SMKISS-PSYILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQL 156

Query: 628 HN----FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI 665
           ++      S   + +VK WD  K +C+  L  H S V  L I
Sbjct: 157 NSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDI 198

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 54/336 (16%), Positives = 115/336 (34%), Gaps = 104/336 (30%)

Query: 176 WLVSTSKDGLIKIWDLKTQQC----IETHIAHTGECWGLAVKD-------DLLITTSTDS 224
           W+ + SKD    +W      C       +I H+     + + +       + L+T S D 
Sbjct: 402 WIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGLPNIVSKGYPEFLLTASNDL 461

Query: 225 QVKIWKLNMENEKMGEKLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETY 284
            +K W +      M  ++ ++  + + + ++ +      + S   S F   + DKT + +
Sbjct: 462 TIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDIN---ALSVSPNDSIFATASYDKTCKIW 518

Query: 285 RIRKEEEIAXXXXXXXXXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWT 344
            +   E  A                             +L  H     R L+ +    + 
Sbjct: 519 NLENGELEA-----------------------------TLANHK----RGLWDVSFCQYD 545

Query: 345 TVTSSKLELVVTTSNNTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNK 404
            +      L  ++ + T++ +S+       T    L+ HT  +Q      R   ++   +
Sbjct: 546 KL------LATSSGDKTVKIWSLDTFSVMKT----LEGHTNAVQ------RCSFINKQKQ 589

Query: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSL 464
           L++  ++G +KIW+  + +C++T                                     
Sbjct: 590 LISCGADGLIKIWDCSSGECLKTL------------------------------------ 613

Query: 465 LDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
                D H+  +W+L   +DG  +V+  AD   +FW
Sbjct: 614 -----DGHNNRLWALSTMNDGDMIVSADADGVFQFW 644

>TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.717
           YOR269W
          Length = 848

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 100/200 (50%), Gaps = 2/200 (1%)

Query: 488 LVTGSADKTVKFWDFQVEKTLVPGTKDKFVPM-LKLNHDTTLELNDDILSVRISPDDRYL 546
           ++T S D T+K W    + T      D F P  +KL+  T    + DI ++ ISP+D   
Sbjct: 473 VITASNDSTIKKWKVP-KPTKNLDNNDSFKPHEVKLSEYTRRAHDKDINALSISPNDSIF 531

Query: 547 AISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGD 606
           A +  D T K++ L+S     +L  HK  +  +      K I+T+S DK IK+W LD   
Sbjct: 532 ATASYDKTCKIWDLESGDLKATLVNHKRGLWDVSFCQYDKFIVTASGDKTIKMWSLDTFT 591

Query: 607 CHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIS 666
             K+   H +++   +F+ +     SC  D ++K WD    ECI+ L  H + +WAL++ 
Sbjct: 592 VVKTFEGHSNAVQRCQFINKQKQLVSCGADGLIKIWDCSSGECIKTLDGHSNRIWALSVI 651

Query: 667 TDGSFVVSSSHDHSIRIWEE 686
            DG  ++S+  D   + W +
Sbjct: 652 NDGDVIISADADGVFQFWRD 671

 Score = 71.2 bits (173), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 85/187 (45%), Gaps = 8/187 (4%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           L +  + ++ A    D   K+WDL S  +      HK  +  + F      +++ S D  
Sbjct: 522 LSISPNDSIFATASYDKTCKIWDLESGDLKATLVNHKRGLWDVSFCQYDKFIVTASGDKT 581

Query: 145 IIVWDLVGEVGLYKLRSHKDAITGFWCQ---GEDWLVSTSKDGLIKIWDLKTQQCIETHI 201
           I +W L     +     H +A+    CQ    +  LVS   DGLIKIWD  + +CI+T  
Sbjct: 582 IKMWSLDTFTVVKTFEGHSNAVQR--CQFINKQKQLVSCGADGLIKIWDCSSGECIKTLD 639

Query: 202 AHTGECWGLAVKD--DLLITTSTDSQVKIWK-LNMENEKMGEKLTEMGIFEKQSKQRGLK 258
            H+   W L+V +  D++I+   D   + W+    EN +   +   + + ++QS Q  L 
Sbjct: 640 GHSNRIWALSVINDGDVIISADADGVFQFWRDCTGENREKDLEKERLKVEQEQSLQNYLA 699

Query: 259 IEFITNA 265
            E  TNA
Sbjct: 700 NEDWTNA 706

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 60/140 (42%), Gaps = 13/140 (9%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           IWD+++GDL  TL +    G  D      + C Y         +     D  IK+W L +
Sbjct: 542 IWDLESGDLKATLVNH-KRGLWDV-----SFCQY------DKFIVTASGDKTIKMWSLDT 589

Query: 111 KTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFW 170
            TV+  F GH  A+   QF +   +L+S   D  I +WD      +  L  H + I    
Sbjct: 590 FTVVKTFEGHSNAVQRCQFINKQKQLVSCGADGLIKIWDCSSGECIKTLDGHSNRIWALS 649

Query: 171 CQGE-DWLVSTSKDGLIKIW 189
              + D ++S   DG+ + W
Sbjct: 650 VINDGDVIISADADGVFQFW 669

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 55/101 (54%), Gaps = 4/101 (3%)

Query: 403 NKLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALTCKFLPGGLLVILGTRSGELQLFDL 459
           +K + TAS + ++K+W++ T   ++TFE        C+F+     ++     G ++++D 
Sbjct: 570 DKFIVTASGDKTIKMWSLDTFTVVKTFEGHSNAVQRCQFINKQKQLVSCGADGLIKIWDC 629

Query: 460 ASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
           +S   + T+ D H   IW+L + +DG  +++  AD   +FW
Sbjct: 630 SSGECIKTL-DGHSNRIWALSVINDGDVIISADADGVFQFW 669

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 58/128 (45%), Gaps = 17/128 (13%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQF-------DSTGTRLI 137
           + + Q + LLAVG  DG + V D+ +  +  +F GH A I+ ++F       ++ G  L 
Sbjct: 108 MSIDQTSTLLAVGGTDGSVTVIDIENSYITHSFKGHGATISAVKFYSDASTQNNEGWLLF 167

Query: 138 SGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGED----------WLVSTSKDGLIK 187
           SG     I V D+V    LY  + H  AI G   +              L+S  +D ++ 
Sbjct: 168 SGDTAGMIKVCDMVKRRCLYTFQEHTSAIRGLDIRLSPSHVENDEPLLQLLSGGRDDIVN 227

Query: 188 IWDLKTQQ 195
           +W+   ++
Sbjct: 228 LWEFNLRR 235

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 75/173 (43%), Gaps = 20/173 (11%)

Query: 81  ECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGS 140
           E T L++  D   L     + ++K++++V K  + +      +  +M  D T T L  G 
Sbjct: 63  EITALQLSPDGKYLCYASTNQLLKIYNIVEKKFVKSLKISSPSY-VMSIDQTSTLLAVGG 121

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDAITG--FWCQG-----EDWLV-STSKDGLIKIWDLK 192
            D ++ V D+      +  + H   I+   F+        E WL+ S    G+IK+ D+ 
Sbjct: 122 TDGSVTVIDIENSYITHSFKGHGATISAVKFYSDASTQNNEGWLLFSGDTAGMIKVCDMV 181

Query: 193 TQQCIETHIAHTGECWGLAVK-------DD----LLITTSTDSQVKIWKLNME 234
            ++C+ T   HT    GL ++       +D     L++   D  V +W+ N+ 
Sbjct: 182 KRRCLYTFQEHTSAIRGLDIRLSPSHVENDEPLLQLLSGGRDDIVNLWEFNLR 234

 Score = 40.0 bits (92), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 55/264 (20%), Positives = 101/264 (38%), Gaps = 68/264 (25%)

Query: 346 VTSSKLELVVTTSNN-TIEYYSIPYEKRDPTSPAPLKTHTIEL-----QGQRTDVRSIDV 399
           +T +  + V+T SN+ TI+ + +P   ++  +    K H ++L     +    D+ ++ +
Sbjct: 465 LTKNYPDYVITASNDSTIKKWKVPKPTKNLDNNDSFKPHEVKLSEYTRRAHDKDINALSI 524

Query: 400 SDDNKLLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDL 459
           S ++ + ATAS                     Y  TCK                  ++DL
Sbjct: 525 SPNDSIFATAS---------------------YDKTCK------------------IWDL 545

Query: 460 ASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD---FQVEKTLVPGTKDKF 516
            S  L  T+ + H   +W +      K +VT S DKT+K W    F V KT         
Sbjct: 546 ESGDLKATLVN-HKRGLWDVSFCQYDKFIVTASGDKTIKMWSLDTFTVVKTFE------- 597

Query: 517 VPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPV 576
                  H   ++        +     + L     D  +K++   S +   +L GH   +
Sbjct: 598 ------GHSNAVQ------RCQFINKQKQLVSCGADGLIKIWDCSSGECIKTLDGHSNRI 645

Query: 577 LSIDISFDSKMIITSSADKNIKIW 600
            ++ +  D  +II++ AD   + W
Sbjct: 646 WALSVINDGDVIISADADGVFQFW 669

 Score = 35.8 bits (81), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 83/359 (23%), Positives = 145/359 (40%), Gaps = 56/359 (15%)

Query: 380 LKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNV------KTHKCIRTFECGYA 433
            + HT  ++G    +    V +D  LL   S G   I N+      +  K I+T      
Sbjct: 189 FQEHTSAIRGLDIRLSPSHVENDEPLLQLLSGGRDDIVNLWEFNLRRKSKLIKTIPVYQQ 248

Query: 434 L-TCKFLPGGL--LVILGTRSGELQLFDLASSSLLD-TIEDAHDAAIWSLDLTSDGKRLV 489
           +  C FL G    L+  G      Q+  ++S+ +L  T++   +  I  +    D  +  
Sbjct: 249 VEACGFLNGNYEDLIYTGGSDAIFQILSISSNKILKKTLKPIEELFIIGVLPILDNSKFY 308

Query: 490 TGSADKTVKFWDFQVEKTL---------VPGTKDKFVPMLKLNHDTTLELN--DDILS-- 536
              +D+T+   D  VE+ +         V  T  K    +  NH T  ++   D  LS  
Sbjct: 309 LVLSDQTLLLVD--VEENMAEDENPSEYVDHTIIKIENSIAGNHGTIADMRVVDPTLSKL 366

Query: 537 --VRISPDDRYLAISLLDNTVKVF-FLDSMKFYLSLY-GHKLPVLSIDISFDSKMIITSS 592
                SP  R + IS  +        L  +   + +Y GH   + S+D + DS  I T+S
Sbjct: 367 ALATNSPTLRIIPISEANEEADSKDALSRIPIDVDMYEGHTDLLNSLDSTEDSLWIATAS 426

Query: 593 ADKNIKIWG----LDFGDCHKSLFAHQDSIMSVKFLPE--SHNF----FSCSKDAVVKYW 642
            D +  +W     L+    +     H  S+ +V  LP   + N+     + S D+ +K W
Sbjct: 427 KDNSCILWRYNAVLEKYQIYAKFLGHASSVTAVG-LPNVLTKNYPDYVITASNDSTIKKW 485

Query: 643 ----------DGEKFECIQ-KL-----YAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
                     + + F+  + KL      AH  ++ AL+IS + S   ++S+D + +IW+
Sbjct: 486 KVPKPTKNLDNNDSFKPHEVKLSEYTRRAHDKDINALSISPNDSIFATASYDKTCKIWD 544

 Score = 32.0 bits (71), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 79/199 (39%), Gaps = 33/199 (16%)

Query: 461 SSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPML 520
           +S LLD + +  +  I +L L+ DGK L   S ++ +K ++  VEK        KFV  L
Sbjct: 49  NSYLLDNVSNDDEQEITALQLSPDGKYLCYASTNQLLKIYNI-VEK--------KFVKSL 99

Query: 521 KLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSID 580
           K++  + +        + I      LA+   D +V V  +++     S  GH   + ++ 
Sbjct: 100 KISSPSYV--------MSIDQTSTLLAVGGTDGSVTVIDIENSYITHSFKGHGATISAVK 151

Query: 581 ISFDSK-------MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF-LPESH---- 628
              D+        ++ +      IK+  +    C  +   H  +I  +   L  SH    
Sbjct: 152 FYSDASTQNNEGWLLFSGDTAGMIKVCDMVKRRCLYTFQEHTSAIRGLDIRLSPSHVEND 211

Query: 629 ----NFFSCSKDAVVKYWD 643
                  S  +D +V  W+
Sbjct: 212 EPLLQLLSGGRDDIVNLWE 230

>KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {ON}
           Anc_8.435 YLR222C
          Length = 783

 Score =  106 bits (265), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 109/237 (45%), Gaps = 7/237 (2%)

Query: 488 LVTGSADKTVKFWDFQVEKTLVPGTKDKFVPM--LKLNHDTTLELNDDILSVRISPDDRY 545
           L+T S D T+K W     K   P   D+ V    +K++  T      DI ++ ISP+D  
Sbjct: 423 LLTASNDLTIKKW-----KIPKPSAGDEEVEFHDVKISEYTRRAHEKDINALSISPNDSI 477

Query: 546 LAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG 605
            A +  D T K++ L++ +   +L  HK  +  +      K+I T S DK IKIW LD  
Sbjct: 478 FATASYDKTCKIWDLETGESVATLSNHKRGLWDVSFCQFDKIIATCSGDKTIKIWSLDTF 537

Query: 606 DCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI 665
              K+L  H +++    F+ + +   S   D ++K WD    ECI  L  H + +WAL +
Sbjct: 538 SVIKTLEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDISNGECISTLDGHNNRIWALCV 597

Query: 666 STDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
             DG  +VS+  D   + W +  D+             + E +L   L E +  +AF
Sbjct: 598 QNDGDLIVSADADGVFQFWRDCTDEQREEDMAKEKERIEQEQSLQNYLNERDWTNAF 654

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 136/621 (21%), Positives = 237/621 (38%), Gaps = 90/621 (14%)

Query: 126 LMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGE----DWLV-ST 180
           ++  D T T +  G  D +++V D+      + L+ H   I+     GE     WL+ S 
Sbjct: 75  IIDCDKTSTLVTIGGTDGSVVVIDIENGYITHSLKGHGGTISSLKFFGELNSNIWLLCSG 134

Query: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDD-------LLITTSTDSQVKIWKLNM 233
             +G++KIWDL  ++CI T   HT    G+ + +         L+T   D+ V  W+ N+
Sbjct: 135 DTNGMVKIWDLVKRKCIHTVQEHTSPVRGVDIVESENDTDVLQLVTGGRDNIVNFWEFNL 194

Query: 234 ENEKMGEKLTEMGIFEKQSKQRG-LKIEFITNASDGVSFFYIQNADKTIETYRIRKE-EE 291
              K    L +     +Q +  G +  +FI  A     F  I   +  +   R RK  EE
Sbjct: 195 ---KKKCTLVKTIPAHQQIESSGFINHDFIYTAGSDAVFQVISLKNGQV-IKRTRKPIEE 250

Query: 292 IAXXXXXXXXXXXXXXXTDEEISKSIKDSYSSLILHPFQTVRSLYKIKS-----ASWTTV 346
           +                   + S ++ D   +L     + + S   I       A  T V
Sbjct: 251 LFIIGVLPILNGTEYYLVMSDQSLNLIDVQGALEEEEDELISSKSCIAGNHGIIADMTFV 310

Query: 347 TSSKLELVVTTSNNTIEYYSIPYEKR----DPTSPAPLKTHTIELQGQRTDVRSIDVSDD 402
                 L + T++ T+    +P   +    +  S  P+     E  G    + +ID ++D
Sbjct: 311 GPDLKHLALATNSPTLRLIPVPNTNKSDGNEDESFLPIDVDMYE--GHEDLLNAIDSTED 368

Query: 403 NKLLATAS-NGSLKIWNVKTHKCIRTFECGY-----ALTC----KFLPGGLLVILGTRSG 452
              +ATAS + S  +W   T K   T    +     ++T       +P      L T S 
Sbjct: 369 GLWIATASKDHSAIVWKYNTIKQKFTQYARFSGHSSSVTAVGLPNVMPKSYPEYLLTASN 428

Query: 453 ELQL--FDLASSSLLDTIEDAHDAAIW------------SLDLTSDGKRLVTGSADKTVK 498
           +L +  + +   S  D   + HD  I             +L ++ +     T S DKT K
Sbjct: 429 DLTIKKWKIPKPSAGDEEVEFHDVKISEYTRRAHEKDINALSISPNDSIFATASYDKTCK 488

Query: 499 FWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVF 558
            WD +  +++   +          NH   L        V     D+ +A    D T+K++
Sbjct: 489 IWDLETGESVATLS----------NHKRGL------WDVSFCQFDKIIATCSGDKTIKIW 532

Query: 559 FLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSI 618
            LD+     +L GH   V           ++++ AD  IKIW +  G+C  +L  H + I
Sbjct: 533 SLDTFSVIKTLEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDISNGECISTLDGHNNRI 592

Query: 619 MSVKFLPESHNFFSCSKDAVVKYW--------------DGEKFECIQKLYAHQSEV-WAL 663
            ++    +     S   D V ++W              + E+ E  Q L  + +E  W  
Sbjct: 593 WALCVQNDGDLIVSADADGVFQFWRDCTDEQREEDMAKEKERIEQEQSLQNYLNERDWT- 651

Query: 664 AISTDGSFVVSSSHDHSIRIW 684
                 +F+++ S DH +R++
Sbjct: 652 -----NAFLLAISLDHPMRLF 667

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 126/296 (42%), Gaps = 26/296 (8%)

Query: 6   QRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALE-NVNIWDI---KTGDLVT 61
           Q+F Q A F   +S+   V +P        S P  L+T++ +  +  W I     GD   
Sbjct: 391 QKFTQYARFSGHSSSVTAVGLP---NVMPKSYPEYLLTASNDLTIKKWKIPKPSAGDEEV 447

Query: 62  TLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHK 121
              D     +   + +   +   L +  + ++ A    D   K+WDL +   +   + HK
Sbjct: 448 EFHD--VKISEYTRRAHEKDINALSISPNDSIFATASYDKTCKIWDLETGESVATLSNHK 505

Query: 122 AA---ITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGF-WCQGEDWL 177
                ++  QFD     + + S D  I +W L     +  L  H +A+    +   ++ L
Sbjct: 506 RGLWDVSFCQFDKI---IATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKCSFINKQNQL 562

Query: 178 VSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKD--DLLITTSTDSQVKIWKLNMEN 235
           VST  DGLIKIWD+   +CI T   H    W L V++  DL+++   D   + W+ +  +
Sbjct: 563 VSTGADGLIKIWDISNGECISTLDGHNNRIWALCVQNDGDLIVSADADGVFQFWR-DCTD 621

Query: 236 EKMGEKLTEMG--IFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKE 289
           E+  E + +    I ++QS Q  L     TNA     F    + D  +  + + +E
Sbjct: 622 EQREEDMAKEKERIEQEQSLQNYLNERDWTNA-----FLLAISLDHPMRLFNVLRE 672

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 80/177 (45%), Gaps = 10/177 (5%)

Query: 518 PMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVL 577
           P+ K+ H  +     +I +++++PD +YL        +K+  + + K   S+     P  
Sbjct: 16  PVKKILHTISNNDEQEITALKVTPDGKYLIFVSQAQLLKIVNVSTGKIIKSMKVSS-PSY 74

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPE--SHNFFSCSK 635
            ID    S ++     D ++ +  ++ G    SL  H  +I S+KF  E  S+ +  CS 
Sbjct: 75  IIDCDKTSTLVTIGGTDGSVVVIDIENGYITHSLKGHGGTISSLKFFGELNSNIWLLCSG 134

Query: 636 D--AVVKYWDGEKFECIQKLYAHQSEVWALAI-----STDGSFVVSSSHDHSIRIWE 685
           D   +VK WD  K +CI  +  H S V  + I      TD   +V+   D+ +  WE
Sbjct: 135 DTNGMVKIWDLVKRKCIHTVQEHTSPVRGVDIVESENDTDVLQLVTGGRDNIVNFWE 191

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 116/236 (49%), Gaps = 5/236 (2%)

Query: 488 LVTGSADKTVKFWDFQVEKTLVPGTKDKF-VPMLKLNHDTTLELNDDILSVRISPDDRYL 546
           ++T S D TVK W   V K +   + + F + ++K++  T      DI ++ ++P+D   
Sbjct: 445 ILTASNDLTVKKW--AVPKPV--ASNESFELQVVKVSEYTRRAHEKDINALSVAPNDSTF 500

Query: 547 AISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGD 606
           A +  D T KV+ L+S +   +L  H+  +  +      ++I T S DK IKIW LD   
Sbjct: 501 ATASYDKTCKVWDLESGEVKATLANHRRGLWDVAFCQYERLIATCSGDKTIKIWSLDTFA 560

Query: 607 CHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIS 666
             K+   H +++    F+ +     S S D +VK WD    EC++ L  H + +WAL ++
Sbjct: 561 VVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTGECVKTLDGHTNRIWALCVA 620

Query: 667 TDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
            DG  +VS+  D   + W+++ +Q             + E +L   L +G+  +AF
Sbjct: 621 EDGDLIVSADADGVFQFWKDSTEQERQQHNEQQHLKVEQEQSLQNYLSQGDWTNAF 676

 Score = 75.1 bits (183), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 91/209 (43%), Gaps = 9/209 (4%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           L V  + +  A    D   KVWDL S  V      H+  +  + F      + + S D  
Sbjct: 491 LSVAPNDSTFATASYDKTCKVWDLESGEVKATLANHRRGLWDVAFCQYERLIATCSGDKT 550

Query: 145 IIVWDLVGEVGLYKLRSHKDAITGF-WCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAH 203
           I +W L     +     H +A+    +   +  LVS+S DGL+KIWD  T +C++T   H
Sbjct: 551 IKIWSLDTFAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTGECVKTLDGH 610

Query: 204 TGECWGLAVKD--DLLITTSTDSQVKIWKLNMENEKMGEKLTE-MGIFEKQSKQRGLKIE 260
           T   W L V +  DL+++   D   + WK + E E+      + + + ++QS Q  L   
Sbjct: 611 TNRIWALCVAEDGDLIVSADADGVFQFWKDSTEQERQQHNEQQHLKVEQEQSLQNYLSQG 670

Query: 261 FITNASDGVSFFYIQNADKTIETYRIRKE 289
             TNA     F      D  +  +R+ K+
Sbjct: 671 DWTNA-----FLLAITLDHPLRLFRVLKQ 694

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 115/286 (40%), Gaps = 47/286 (16%)

Query: 385 IEL-QGQRTDVRSIDVSDDNKLLATASNGSLKI---WNVKTHKCI--RTFEC-GYALTCK 437
           +EL +G +  + ++D ++D   LATAS  S  I   +   ++K +    FE    A+T  
Sbjct: 372 VELYEGHKDLLNAVDATEDGLWLATASKDSTAILWWYQSNSNKFVPYAKFEGHSSAVTAV 431

Query: 438 FLPG----GLLVILGTRSGELQL--------------FDLASSSLLDTIEDAHDAAIWSL 479
            LP     G    + T S +L +              F+L    + +    AH+  I +L
Sbjct: 432 GLPNIMHKGWPEFILTASNDLTVKKWAVPKPVASNESFELQVVKVSEYTRRAHEKDINAL 491

Query: 480 DLTSDGKRLVTGSADKTVKFWDF---QVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILS 536
            +  +     T S DKT K WD    +V+ TL              NH   L        
Sbjct: 492 SVAPNDSTFATASYDKTCKVWDLESGEVKATLA-------------NHRRGL------WD 532

Query: 537 VRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKN 596
           V     +R +A    D T+K++ LD+     +  GH   V           +++SSAD  
Sbjct: 533 VAFCQYERLIATCSGDKTIKIWSLDTFAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGL 592

Query: 597 IKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYW 642
           +KIW    G+C K+L  H + I ++    +     S   D V ++W
Sbjct: 593 VKIWDCSTGECVKTLDGHTNRIWALCVAEDGDLIVSADADGVFQFW 638

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 77/167 (46%), Gaps = 14/167 (8%)

Query: 81  ECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGS 140
           + T L++  D   L       ++K++DL    ++ +      +  ++  DST T L  G 
Sbjct: 62  DITALKLTADGRYLCFASQAQLLKIFDLREGKIVRSMKISSPSY-VVDSDSTSTLLAIGG 120

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDAITG--FWCQ--GEDWLVSTS-KDGLIKIWDLKTQQ 195
            D +I V D+      + L+ H   I+   F+ +  GE WL+++   +G++KIWDL  ++
Sbjct: 121 TDGSITVVDVENGYVTHSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVKIWDLVKRK 180

Query: 196 CIETHIAHTGECWGLAVKDD--------LLITTSTDSQVKIWKLNME 234
           CI T   HT    G+   +          LI+   D  +  W+ N++
Sbjct: 181 CIHTVQEHTAAVRGIDFHESKNNDESELFLISGGRDDVINYWQFNLK 227

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 56/106 (52%), Gaps = 4/106 (3%)

Query: 404 KLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALTCKFLPGGLLVILGTRSGELQLFDLA 460
           +L+AT S + ++KIW++ T   ++TFE        C F+     ++  +  G ++++D +
Sbjct: 540 RLIATCSGDKTIKIWSLDTFAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCS 599

Query: 461 SSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEK 506
           +   + T+ D H   IW+L +  DG  +V+  AD   +FW    E+
Sbjct: 600 TGECVKTL-DGHTNRIWALCVAEDGDLIVSADADGVFQFWKDSTEQ 644

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 82/190 (43%), Gaps = 23/190 (12%)

Query: 508 LVPGTKDKFVPMLKLNHDTTLELND--DILSVRISPDDRYLAISLLDNTVKVFFLDSMKF 565
           LVP  K  F          T+E +D  DI +++++ D RYL  +     +K+F L   K 
Sbjct: 45  LVPERKTLF----------TIENDDEQDITALKLTADGRYLCFASQAQLLKIFDLREGKI 94

Query: 566 YLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP 625
             S+     P   +D    S ++     D +I +  ++ G    SL  H  +I SVKF  
Sbjct: 95  VRSMKISS-PSYVVDSDSTSTLLAIGGTDGSITVVDVENGYVTHSLKGHGGTISSVKFYG 153

Query: 626 ESHN----FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWAL----AISTDGS--FVVSS 675
           E +       S   + +VK WD  K +CI  +  H + V  +    + + D S  F++S 
Sbjct: 154 EQNGEVWLLASGDTNGMVKIWDLVKRKCIHTVQEHTAAVRGIDFHESKNNDESELFLISG 213

Query: 676 SHDHSIRIWE 685
             D  I  W+
Sbjct: 214 GRDDVINYWQ 223

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 81/188 (43%), Gaps = 27/188 (14%)

Query: 465 LDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNH 524
           L TIE+  +  I +L LT+DG+ L   S  + +K +D + E  +V   K    P   ++ 
Sbjct: 52  LFTIENDDEQDITALKLTADGRYLCFASQAQLLKIFDLR-EGKIVRSMKIS-SPSYVVDS 109

Query: 525 DTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDI--S 582
           D+T  L               LAI   D ++ V  +++     SL GH   + S+     
Sbjct: 110 DSTSTL---------------LAIGGTDGSITVVDVENGYVTHSLKGHGGTISSVKFYGE 154

Query: 583 FDSKMIITSSADKN--IKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN------FFSCS 634
            + ++ + +S D N  +KIW L    C  ++  H  ++  + F    +N        S  
Sbjct: 155 QNGEVWLLASGDTNGMVKIWDLVKRKCIHTVQEHTAAVRGIDFHESKNNDESELFLISGG 214

Query: 635 KDAVVKYW 642
           +D V+ YW
Sbjct: 215 RDDVINYW 222

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score =  103 bits (257), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 129/278 (46%), Gaps = 39/278 (14%)

Query: 432 YALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G     ++++DL+S  +L T++  H+  I+SLD    G +LV+G
Sbjct: 371 YIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQ-GHEQDIYSLDYFPAGDKLVSG 429

Query: 492 SADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISP-DDRYLAISL 550
           S D+TV+ WD +  +  +                 TL + D + +V +SP D +Y+A   
Sbjct: 430 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 472

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL- 602
           LD TV+V      F ++ +     L  GHK  V S+  + D + +++ S D+++K+W L 
Sbjct: 473 LDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLR 532

Query: 603 ------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH 656
                     C  +   H+D ++SV    +     S SKD  V +WD      +  L  H
Sbjct: 533 GLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGH 592

Query: 657 QSEVWALAI------STDGSFVVSSSHDHSIRIWEETE 688
           ++ V ++A+        D     + S D   RIW+ T+
Sbjct: 593 RNSVISVAVVNGFPLGPDIGVFATGSGDCKARIWKYTK 630

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 72/273 (26%), Positives = 124/273 (45%), Gaps = 42/273 (15%)

Query: 394 VRSIDVSDDNKLLATASNGSL-KIWNVKTHKCIRTFECG----YALTCKFLPGGLLVILG 448
           +RS+  S D K LAT +   L +IW++ + K + T +      Y+L   + P G  ++ G
Sbjct: 372 IRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSL--DYFPAGDKLVSG 429

Query: 449 TRSGELQLFDLASS--SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD----F 502
           +    ++++DL +   SL  +IED       S     DGK +  GS D+TV+ WD    F
Sbjct: 430 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVS---PGDGKYIAAGSLDRTVRVWDSETGF 486

Query: 503 QVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS 562
            VE+             L   ++ +    D + SV  + D R +    LD +VK++ L  
Sbjct: 487 LVER-------------LDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLRG 533

Query: 563 MKFY-------LSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQ 615
           +          ++  GHK  VLS+  + D + I++ S D+ +  W    G+    L  H+
Sbjct: 534 LNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHR 593

Query: 616 DSIMSVKFL------PESHNFFSCSKDAVVKYW 642
           +S++SV  +      P+   F + S D   + W
Sbjct: 594 NSVISVAVVNGFPLGPDIGVFATGSGDCKARIW 626

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 100/240 (41%), Gaps = 37/240 (15%)

Query: 41  LITSALENVNIWDIKTGDLVTTLSDGLPPGASDAKGS------------------KPAEC 82
           L T   +   ++ + TG+LV  LSD    G ++   S                  +P   
Sbjct: 308 LATGCNKTTQVYKVSTGELVARLSDDSVSGINNESSSVVAGNGATEKGDESSATIQPGSS 367

Query: 83  TYLEVHQ-----DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLI 137
           + L +       D   LA G  D +I++WDL SK +L+   GH+  I  + +   G +L+
Sbjct: 368 SDLYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSLDYFPAGDKLV 427

Query: 138 SGSKDSNIIVWDL-VGEVGLYKLRSHKDAITGFWCQGED--WLVSTSKDGLIKIWDLKTQ 194
           SGS D  + +WDL  G+  L    S +D +T       D  ++ + S D  +++WD +T 
Sbjct: 428 SGSGDRTVRIWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETG 485

Query: 195 QCIET-------HIAHTGECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEM 245
             +E           H    + +    D   +++ S D  VK+W L   N +      E+
Sbjct: 486 FLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLRGLNGQKSHATCEV 545

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 56/113 (49%), Gaps = 2/113 (1%)

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
           L + S+  S D K + T + DK I+IW L       +L  H+  I S+ + P      S 
Sbjct: 370 LYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSLDYFPAGDKLVSG 429

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST-DGSFVVSSSHDHSIRIWE 685
           S D  V+ WD    +C   L + +  V  +A+S  DG ++ + S D ++R+W+
Sbjct: 430 SGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWD 481

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 92/231 (39%), Gaps = 47/231 (20%)

Query: 25  WIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLVTTLS--DGLPPGASDAKGSKPAEC 82
           + PA  +  +GSG           V IWD++TG    TLS  DG+               
Sbjct: 419 YFPAGDKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGV--------------T 456

Query: 83  TYLEVHQDTNLLAVGYADGVIKVWD-----LVSKTVLLN--FNGHKAAITLMQFDSTGTR 135
           T      D   +A G  D  ++VWD     LV +    N    GHK ++  + F   G  
Sbjct: 457 TVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRS 516

Query: 136 LISGSKDSNIIVWDLVGEVGL-------YKLRSHKDAITGFWC-QGEDWLVSTSKDGLIK 187
           ++SGS D ++ +WDL G  G             HKD +      Q +++++S SKD  + 
Sbjct: 517 VVSGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVL 576

Query: 188 IWDLKTQQCIETHIAHTGECWGLAVKD--------DLLITTSTDSQVKIWK 230
            WD  +   +     H      +AV +         +  T S D + +IWK
Sbjct: 577 FWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDIGVFATGSGDCKARIWK 627

>TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {ON}
           Anc_6.363 YCR084C
          Length = 699

 Score =  103 bits (257), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 102/424 (24%), Positives = 176/424 (41%), Gaps = 113/424 (26%)

Query: 357 TSNNTIEYYSIPYEKR-DPTSPAP-----LKTHTIE--LQGQRTDV---------RSIDV 399
           TS     +Y +PY++R + T P P     L + TI   L+ Q  D          R+IDV
Sbjct: 284 TSATKESHYLVPYDQRANHTKPIPPFLLDLDSQTIPAGLKKQTDDYYILYNPALPRNIDV 343

Query: 400 -----------------SDDNKLLATASNGSLKIWNVKTHKCI----------------- 425
                            S+D K LAT  N + +++NV + + I                 
Sbjct: 344 ELHKSLDHTSVVCCVRFSNDGKFLATGCNKTTQVYNVASGELIARLSDDSASHITPGQNS 403

Query: 426 RTFECG-------------------YALTCKFLPGGLLVILGTRSGELQLFDLASSSLLD 466
           +  E G                   Y  +  F P G  +  G     ++++D+A   ++ 
Sbjct: 404 KDSEGGEENNDTTTYSTSATTSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIM 463

Query: 467 TIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDT 526
            ++  H+  I+SLD    G++LV+GS D+TV+ WD +  +  +                 
Sbjct: 464 VLQ-GHEQDIYSLDYFPSGEKLVSGSGDRTVRIWDLRTGQCSL----------------- 505

Query: 527 TLELNDDILSVRISPDD-RYLAISLLDNTVKV------FFLDSMKFYLSL-YGHKLPVLS 578
           TL + D + +V +SP+D +Y+A   LD  V+V      F ++ +     L  GHK  V S
Sbjct: 506 TLSIEDGVTTVAVSPEDGKYIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYS 565

Query: 579 IDISFDSKMIITSSADKNIKIWGLD-----------FGDCHKSLFAHQDSIMSVKFLPES 627
           +  + D   +++ S D+++K+W L+            G C  +   H+D ++SV      
Sbjct: 566 VVFTRDGNNVVSGSLDRSVKLWNLNDANNKDLKPNVPGTCEVTYTGHKDFVLSVATTQGD 625

Query: 628 HNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIS------TDGSFVVSSSHDHSI 681
               S SKD  V +WD +    +  L  H++ V ++A++      T+     + S D   
Sbjct: 626 EYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAVANGHPLGTEYGVFATGSGDCKA 685

Query: 682 RIWE 685
           RIW+
Sbjct: 686 RIWK 689

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 100/231 (43%), Gaps = 36/231 (15%)

Query: 41  LITSALENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECT----------------- 83
           L T   +   ++++ +G+L+  LSD      +  + SK +E                   
Sbjct: 367 LATGCNKTTQVYNVASGELIARLSDDSASHITPGQNSKDSEGGEENNDTTTYSTSATTSS 426

Query: 84  --YLE---VHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLIS 138
             Y+       D   LA G  D +I++WD+  K +++   GH+  I  + +  +G +L+S
Sbjct: 427 DLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQGHEQDIYSLDYFPSGEKLVS 486

Query: 139 GSKDSNIIVWDL-VGEVGLYKLRSHKDAITGFWCQGED--WLVSTSKDGLIKIWDLKTQQ 195
           GS D  + +WDL  G+  L    S +D +T      ED  ++ + S D  +++WD +T  
Sbjct: 487 GSGDRTVRIWDLRTGQCSL--TLSIEDGVTTVAVSPEDGKYIAAGSLDRAVRVWDSETGF 544

Query: 196 CIET-------HIAHTGECWGLAVKDDL--LITTSTDSQVKIWKLNMENEK 237
            +E           H    + +    D   +++ S D  VK+W LN  N K
Sbjct: 545 LVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLNDANNK 595

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 94/235 (40%), Gaps = 51/235 (21%)

Query: 25  WIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLVTTLS--DGLPPGASDAKGSKPAEC 82
           + P+  +  +GSG           V IWD++TG    TLS  DG+               
Sbjct: 477 YFPSGEKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGV--------------T 514

Query: 83  TYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFN-------GHKAAITLMQFDSTGTR 135
           T     +D   +A G  D  ++VWD  +  ++   +       GHK ++  + F   G  
Sbjct: 515 TVAVSPEDGKYIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNN 574

Query: 136 LISGSKDSNIIVWDL-----------VGEVGLYKLRSHKDAITGFWC-QGEDWLVSTSKD 183
           ++SGS D ++ +W+L           V          HKD +      QG+++++S SKD
Sbjct: 575 VVSGSLDRSVKLWNLNDANNKDLKPNVPGTCEVTYTGHKDFVLSVATTQGDEYILSGSKD 634

Query: 184 GLIKIWDLKTQQCIETHIAHTGECWGLAVKD--------DLLITTSTDSQVKIWK 230
             +  WD K+   +     H      +AV +         +  T S D + +IWK
Sbjct: 635 RGVLFWDTKSGNPLLMLQGHRNSVISVAVANGHPLGTEYGVFATGSGDCKARIWK 689

>SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]
           {ON} highly similar to uniprot|Q05946 Saccharomyces
           cerevisiae YLR222C UTP13 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 841

 Score =  103 bits (257), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 115/237 (48%), Gaps = 9/237 (3%)

Query: 488 LVTGSADKTVKFWDFQVEKTLVPGTKD--KFVPMLKLNHDTTLELNDDILSVRISPDDRY 545
           L++ S D T+K W        VP  +D    V ++K +  T      DI ++ +SP+D  
Sbjct: 486 LLSASNDLTIKKW-------AVPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPNDSV 538

Query: 546 LAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG 605
            A +  D T K++ LD+ +   +L  HK  +  ++     K++ T S DK +KIW LD  
Sbjct: 539 FATASYDKTCKIWSLDTGELEATLANHKRGLWDVNFCQYDKLLATCSGDKTVKIWSLDTY 598

Query: 606 DCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI 665
              K+L  H +++    F+ ++    S   D +VK WD    EC++ L AH + +WAL++
Sbjct: 599 SVMKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDCSTGECVKTLDAHNNRIWALSV 658

Query: 666 STDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
             DG  +V++  D   + W++   +             ++E +L   L +G+  +AF
Sbjct: 659 LKDGDIIVTADADGVFQFWKDCSKEEEERNLEKEKEKVEHEQSLQNYLSQGDWANAF 715

 Score = 65.5 bits (158), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 79/179 (44%), Gaps = 18/179 (10%)

Query: 69  PGASDAKGS----KPAECTYLEVHQDTNLLAVGYADGVI---------KVWDLVSKTVLL 115
           P   D K +    K +E T     +D N LAV   D V          K+W L +  +  
Sbjct: 501 PKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPNDSVFATASYDKTCKIWSLDTGELEA 560

Query: 116 NFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAI--TGFWCQG 173
               HK  +  + F      L + S D  + +W L     +  L  H +A+    F  + 
Sbjct: 561 TLANHKRGLWDVNFCQYDKLLATCSGDKTVKIWSLDTYSVMKTLEGHTNAVQRCSFISKN 620

Query: 174 EDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAV-KD-DLLITTSTDSQVKIWK 230
           +  LVS+  DGL+K+WD  T +C++T  AH    W L+V KD D+++T   D   + WK
Sbjct: 621 KQ-LVSSGADGLVKLWDCSTGECVKTLDAHNNRIWALSVLKDGDIIVTADADGVFQFWK 678

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 56/101 (55%), Gaps = 4/101 (3%)

Query: 403 NKLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALTCKFLPGGLLVILGTRSGELQLFDL 459
           +KLLAT S + ++KIW++ T+  ++T E        C F+     ++     G ++L+D 
Sbjct: 578 DKLLATCSGDKTVKIWSLDTYSVMKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDC 637

Query: 460 ASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
           ++   + T+ DAH+  IW+L +  DG  +VT  AD   +FW
Sbjct: 638 STGECVKTL-DAHNNRIWALSVLKDGDIIVTADADGVFQFW 677

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 65/138 (47%), Gaps = 11/138 (7%)

Query: 69  PGASDAKGSKPAECTY-LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLM 127
           P     +  K +   Y +E    + LLA+G  DG + + D+ +  V  +F GH   I+ +
Sbjct: 110 PSKKIVRSMKVSSPVYVMECDVTSTLLAIGGTDGSVSIIDIENGYVTHSFKGHGGTISSV 169

Query: 128 QF----DSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITG--FWCQGED----WL 177
           +F    +S   RL SG     + +WDLV    L+ ++ H  A+ G  F    ED     L
Sbjct: 170 KFHGELNSNVWRLASGDTTGVVKIWDLVKRKCLHTVQEHTMAVRGLDFRVLDEDEDQMQL 229

Query: 178 VSTSKDGLIKIWDLKTQQ 195
           +S  +D +I ++   +++
Sbjct: 230 ISGGRDNIINLYQFDSRK 247

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 70/168 (41%), Gaps = 24/168 (14%)

Query: 531 NDD---ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM 587
           NDD   I ++RI+PD ++L        ++V+ L S K   S+     PV  ++    S +
Sbjct: 77  NDDEQEITALRITPDGQFLCFVSQAQLLRVYHLPSKKIVRSMKVSS-PVYVMECDVTSTL 135

Query: 588 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN----FFSCSKDAVVKYWD 643
           +     D ++ I  ++ G    S   H  +I SVKF  E ++      S     VVK WD
Sbjct: 136 LAIGGTDGSVSIIDIENGYVTHSFKGHGGTISSVKFHGELNSNVWRLASGDTTGVVKIWD 195

Query: 644 GEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQV 691
             K +C+  +  H   V  L                  R+ +E EDQ+
Sbjct: 196 LVKRKCLHTVQEHTMAVRGL----------------DFRVLDEDEDQM 227

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 73/175 (41%), Gaps = 16/175 (9%)

Query: 41  LITSALENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYAD 100
           L TS L+ +NI  + +   V  +           +     E T L +  D   L      
Sbjct: 52  LATSVLDRINIVQLSSPRQVVHI----------IENDDEQEITALRITPDGQFLCFVSQA 101

Query: 101 GVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLR 160
            +++V+ L SK ++ +     + + +M+ D T T L  G  D ++ + D+      +  +
Sbjct: 102 QLLRVYHLPSKKIVRSMKV-SSPVYVMECDVTSTLLAIGGTDGSVSIIDIENGYVTHSFK 160

Query: 161 SHKDAITGFWCQGE----DW-LVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGL 210
            H   I+     GE     W L S    G++KIWDL  ++C+ T   HT    GL
Sbjct: 161 GHGGTISSVKFHGELNSNVWRLASGDTTGVVKIWDLVKRKCLHTVQEHTMAVRGL 215

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 59/141 (41%), Gaps = 15/141 (10%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAE-CTYLEVHQDTNLLAVGYADGVIKVWDLV 109
           IW + TG+L  TL       A+  +G      C Y        LLA    D  +K+W L 
Sbjct: 550 IWSLDTGELEATL-------ANHKRGLWDVNFCQY------DKLLATCSGDKTVKIWSLD 596

Query: 110 SKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGF 169
           + +V+    GH  A+    F S   +L+S   D  + +WD      +  L +H + I   
Sbjct: 597 TYSVMKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDCSTGECVKTLDAHNNRIWAL 656

Query: 170 WC-QGEDWLVSTSKDGLIKIW 189
              +  D +V+   DG+ + W
Sbjct: 657 SVLKDGDIIVTADADGVFQFW 677

 Score = 39.3 bits (90), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 92/209 (44%), Gaps = 29/209 (13%)

Query: 309 TDEEI-SKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNNTIEYYSI 367
           TD  I +  ++ SYSSL L PF          +   T + +S L+ +     N ++    
Sbjct: 14  TDRRILTMDLRTSYSSLSLSPFYAGSGAVASVTEDGTLLATSVLDRI-----NIVQL--- 65

Query: 368 PYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGS-LKIWNVKTHKCIR 426
                  +SP  +  H IE   ++ ++ ++ ++ D + L   S    L+++++ + K +R
Sbjct: 66  -------SSPRQV-VHIIENDDEQ-EITALRITPDGQFLCFVSQAQLLRVYHLPSKKIVR 116

Query: 427 TFECG---YALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSL---- 479
           + +     Y + C  +   LL I GT  G + + D+ +  +  + +  H   I S+    
Sbjct: 117 SMKVSSPVYVMECD-VTSTLLAIGGT-DGSVSIIDIENGYVTHSFK-GHGGTISSVKFHG 173

Query: 480 DLTSDGKRLVTGSADKTVKFWDFQVEKTL 508
           +L S+  RL +G     VK WD    K L
Sbjct: 174 ELNSNVWRLASGDTTGVVKIWDLVKRKCL 202

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 58/135 (42%), Gaps = 22/135 (16%)

Query: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLD----FGDCHKSLFAHQDSIMSVKFLPE 626
           GH+  + S+D + D   + T+S D  + +W  D        +     H   + +V  LP 
Sbjct: 418 GHEDLLNSLDATEDGMWLATASKDNFVILWRYDEQTELFKQYAKFVGHAGPVTAVG-LPN 476

Query: 627 SHN------FFSCSKDAVVKYW------DGEKFECIQKL-----YAHQSEVWALAISTDG 669
             N        S S D  +K W      DG+    + K       AH+ ++ ALA+S + 
Sbjct: 477 VMNRPWPEFLLSASNDLTIKKWAVPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPND 536

Query: 670 SFVVSSSHDHSIRIW 684
           S   ++S+D + +IW
Sbjct: 537 SVFATASYDKTCKIW 551

 Score = 32.0 bits (71), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 55/139 (39%), Gaps = 23/139 (16%)

Query: 117 FNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLY----KLRSHKDAITGFWCQ 172
           + GH+  +  +     G  L + SKD+ +I+W    +  L+    K   H   +T     
Sbjct: 416 YEGHEDLLNSLDATEDGMWLATASKDNFVILWRYDEQTELFKQYAKFVGHAGPVTAVGLP 475

Query: 173 G------EDWLVSTSKDGLIKIWDLK-------TQQCIE----THIAHTGECWGLAV--K 213
                   ++L+S S D  IK W +        T   ++    T  AH  +   LAV   
Sbjct: 476 NVMNRPWPEFLLSASNDLTIKKWAVPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPN 535

Query: 214 DDLLITTSTDSQVKIWKLN 232
           D +  T S D   KIW L+
Sbjct: 536 DSVFATASYDKTCKIWSLD 554

>KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {ON}
           Anc_8.435 YLR222C
          Length = 849

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 99/205 (48%), Gaps = 9/205 (4%)

Query: 488 LVTGSADKTVKFWDFQVEKTLVPGTKDKF--VPMLKLNHDTTLELNDDILSVRISPDDRY 545
           L+T S D T+K W+       +P   DK   + ++K +  T      DI ++ +SP+D  
Sbjct: 488 LLTASNDLTIKKWN-------IPKPSDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSV 540

Query: 546 LAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG 605
            A +  D T K++ L++ +   +L  HK  +  +      K++ T S DK IKIW LD  
Sbjct: 541 FATASYDKTSKIWDLETGELTATLANHKRGLWDVSFCQYDKLLATCSGDKTIKIWSLDTF 600

Query: 606 DCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI 665
              ++L  H +++    F+ +     S   D ++K WD    EC++ L  H + +WAL I
Sbjct: 601 SVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWALTI 660

Query: 666 STDGSFVVSSSHDHSIRIWEETEDQ 690
             DG  + S+  D   + W +  +Q
Sbjct: 661 QRDGELIASADADGVFQFWTDCSEQ 685

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 86/203 (42%), Gaps = 4/203 (1%)

Query: 67  LPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITL 126
           L  G+   + +   +   L V  + ++ A    D   K+WDL +  +      HK  +  
Sbjct: 514 LIKGSEYTRRAHEKDINALSVSPNDSVFATASYDKTSKIWDLETGELTATLANHKRGLWD 573

Query: 127 MQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAIT-GFWCQGEDWLVSTSKDGL 185
           + F      L + S D  I +W L     +  L  H +A+    +   +  LVS+  DGL
Sbjct: 574 VSFCQYDKLLATCSGDKTIKIWSLDTFSVVRTLEGHTNAVQRCHFINKQTQLVSSGADGL 633

Query: 186 IKIWDLKTQQCIETHIAHTGECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLT 243
           IKIWD  + +C++T   H    W L ++ D  L+ +   D   + W    E ++  +   
Sbjct: 634 IKIWDCSSGECVKTLDGHANRIWALTIQRDGELIASADADGVFQFWTDCSEQQREQDLER 693

Query: 244 EMGIFEK-QSKQRGLKIEFITNA 265
           E  + E+ QS Q  L  E   NA
Sbjct: 694 EKELVEQEQSLQNYLANEDWANA 716

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 84/198 (42%), Gaps = 14/198 (7%)

Query: 325 ILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNNTIEYYSIPYEKRDPTSPAPLKTHT 384
           I  P   +  ++ IK + +T     K    ++ S N   + +  Y+K            T
Sbjct: 502 IPKPSDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSVFATASYDKTSKIWDLETGELT 561

Query: 385 IELQGQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALTCKFLPG 441
             L   +  +  +     +KLLAT S + ++KIW++ T   +RT E        C F+  
Sbjct: 562 ATLANHKRGLWDVSFCQYDKLLATCSGDKTIKIWSLDTFSVVRTLEGHTNAVQRCHFINK 621

Query: 442 GLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW- 500
              ++     G ++++D +S   + T+ D H   IW+L +  DG+ + +  AD   +FW 
Sbjct: 622 QTQLVSSGADGLIKIWDCSSGECVKTL-DGHANRIWALTIQRDGELIASADADGVFQFWT 680

Query: 501 ---------DFQVEKTLV 509
                    D + EK LV
Sbjct: 681 DCSEQQREQDLEREKELV 698

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 67/147 (45%), Gaps = 14/147 (9%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           IWD++TG+L  TL++    G  D      + C Y        LLA    D  IK+W L +
Sbjct: 552 IWDLETGELTATLANH-KRGLWDV-----SFCQY------DKLLATCSGDKTIKIWSLDT 599

Query: 111 KTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFW 170
            +V+    GH  A+    F +  T+L+S   D  I +WD      +  L  H + I    
Sbjct: 600 FSVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWALT 659

Query: 171 CQGEDWLVSTS-KDGLIKIW-DLKTQQ 195
            Q +  L++++  DG+ + W D   QQ
Sbjct: 660 IQRDGELIASADADGVFQFWTDCSEQQ 686

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 76/166 (45%), Gaps = 15/166 (9%)

Query: 81  ECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGS 140
           E T L++  D   L       ++K+ ++ +  V+ +      +  +M  ++T T +  G 
Sbjct: 92  EITALKLTADGKYLCFTSQAQLLKIVEVATGKVMRSMKISSPSY-IMDSEATSTLVAVGG 150

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGED----WLVSTS-KDGLIKIWDLKTQQ 195
            D +IIV D+      +  + H   I+     GE     WL+++   +G+IK+W+L T++
Sbjct: 151 TDGSIIVVDIENGYVTHSFKGHGGTISCLKFFGEANSNVWLLASGDTNGMIKVWNLVTRK 210

Query: 196 CIETHIAHTGECWGL---AVKDDL------LITTSTDSQVKIWKLN 232
           C  T   HT    G+   ++ DD       +I+   D  V  W+L+
Sbjct: 211 CTHTVQEHTSAVRGIDIRSISDDTKSMQLQMISGGRDDVVNYWELD 256

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score =  102 bits (253), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 128/278 (46%), Gaps = 39/278 (14%)

Query: 432 YALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G     ++++DL +  +L T++  H+  I+SLD    G +LV+G
Sbjct: 354 YIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQ-GHEQDIYSLDYFPAGDKLVSG 412

Query: 492 SADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDD-RYLAISL 550
           S D+TV+ WD +  +  +                 TL + D + +V +SP D +Y+A   
Sbjct: 413 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 455

Query: 551 LDNTVKV------FFLDSMKFYLSLY-GHKLPVLSIDISFDSKMIITSSADKNIKIWGL- 602
           LD TV+V      F ++ +     L  GHK  V S+  + D + +I+ S D+++K+W L 
Sbjct: 456 LDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLR 515

Query: 603 ------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH 656
                     C  +   H+D ++SV    +     S SKD  V +WD      +  L  H
Sbjct: 516 GLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGH 575

Query: 657 QSEVWALAI------STDGSFVVSSSHDHSIRIWEETE 688
           ++ V ++A+        D     + S D   RIW+ T+
Sbjct: 576 RNSVISVAVVNGFPLGPDVGVFATGSGDCKARIWKYTK 613

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 72/273 (26%), Positives = 124/273 (45%), Gaps = 42/273 (15%)

Query: 394 VRSIDVSDDNKLLATASNGSL-KIWNVKTHKCIRTFECG----YALTCKFLPGGLLVILG 448
           +RS+  S D K LAT +   L +IW++ T K + T +      Y+L   + P G  ++ G
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSL--DYFPAGDKLVSG 412

Query: 449 TRSGELQLFDLASS--SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD----F 502
           +    ++++DL +   SL  +IED       S     DGK +  GS D+TV+ WD    F
Sbjct: 413 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVS---PGDGKYIAAGSLDRTVRVWDSETGF 469

Query: 503 QVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS 562
            VE+             L   ++ +    D + SV  + D + +    LD +VK++ L  
Sbjct: 470 LVER-------------LDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRG 516

Query: 563 MKFY-------LSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQ 615
           +          ++  GHK  VLS+  + D + I++ S D+ +  W    G+    L  H+
Sbjct: 517 LNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHR 576

Query: 616 DSIMSVKFL------PESHNFFSCSKDAVVKYW 642
           +S++SV  +      P+   F + S D   + W
Sbjct: 577 NSVISVAVVNGFPLGPDVGVFATGSGDCKARIW 609

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 102/240 (42%), Gaps = 37/240 (15%)

Query: 41  LITSALENVNIWDIKTGDLVTTLSD----------GLPP---GASDAKGS-----KPAEC 82
           L T   +   ++ + TG+L+  LSD             P   G +D  G      +PA  
Sbjct: 291 LATGCNKTTQVYKVSTGELLARLSDDSVAGVNNEASTGPANNGTADNGGENSATIQPASS 350

Query: 83  TYLEVHQ-----DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLI 137
           + L +       D   LA G  D +I++WDL +K +L+   GH+  I  + +   G +L+
Sbjct: 351 SDLYIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLV 410

Query: 138 SGSKDSNIIVWDL-VGEVGLYKLRSHKDAITGFWCQGED--WLVSTSKDGLIKIWDLKTQ 194
           SGS D  + +WDL  G+  L    S +D +T       D  ++ + S D  +++WD +T 
Sbjct: 411 SGSGDRTVRIWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETG 468

Query: 195 QCIET-------HIAHTGECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEM 245
             +E           H    + +    D   +I+ S D  VK+W L   N +      E+
Sbjct: 469 FLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEV 528

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 108/231 (46%), Gaps = 24/231 (10%)

Query: 385 IELQGQRTDVRSID-VSDDNKLLATASNGSLKIWNVKTHKCIRTFECGYALTCKFL-PG- 441
           + LQG   D+ S+D     +KL++ + + +++IW+++T +C  T      +T   + PG 
Sbjct: 388 MTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGD 447

Query: 442 GLLVILGTRSGELQLFDLASSSLLDTIED------AHDAAIWSLDLTSDGKRLVTGSADK 495
           G  +  G+    ++++D  +  L++ ++        H  +++S+  T DG+ +++GS D+
Sbjct: 448 GKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDR 507

Query: 496 TVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTV 555
           +VK WD +     + G K      +     T     D +LSV  + DD Y+     D  V
Sbjct: 508 SVKLWDLRG----LNGQKSHATCEV-----TYTGHKDFVLSVATTQDDEYILSGSKDRGV 558

Query: 556 KVFFLDSMKFYLSLYGHKLPVLSIDI------SFDSKMIITSSADKNIKIW 600
             +   S    L L GH+  V+S+ +        D  +  T S D   +IW
Sbjct: 559 LFWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARIW 609

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 93/215 (43%), Gaps = 26/215 (12%)

Query: 472 HDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELN 531
           H + +  +  ++DG+ L TG  +KT + +     + L            +L+ D+   +N
Sbjct: 275 HSSVVCCVRFSNDGEYLATG-CNKTTQVYKVSTGELLA-----------RLSDDSVAGVN 322

Query: 532 DDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITS 591
           ++       P +   A +  +N+  +    S   Y         + S+  S D K + T 
Sbjct: 323 NE---ASTGPANNGTADNGGENSATIQPASSSDLY---------IRSVCFSPDGKYLATG 370

Query: 592 SADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQ 651
           + DK I+IW L       +L  H+  I S+ + P      S S D  V+ WD    +C  
Sbjct: 371 AEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSL 430

Query: 652 KLYAHQSEVWALAIST-DGSFVVSSSHDHSIRIWE 685
            L + +  V  +A+S  DG ++ + S D ++R+W+
Sbjct: 431 TL-SIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWD 464

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 99/248 (39%), Gaps = 49/248 (19%)

Query: 25  WIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLVTTLS--DGLPPGASDAKGSKPAEC 82
           + PA  +  +GSG           V IWD++TG    TLS  DG+               
Sbjct: 402 YFPAGDKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGV--------------T 439

Query: 83  TYLEVHQDTNLLAVGYADGVIKVWD-----LVSKTVLLN--FNGHKAAITLMQFDSTGTR 135
           T      D   +A G  D  ++VWD     LV +    N    GHK ++  + F   G  
Sbjct: 440 TVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQG 499

Query: 136 LISGSKDSNIIVWDLVGEVGL-------YKLRSHKDAITGFWC-QGEDWLVSTSKDGLIK 187
           +ISGS D ++ +WDL G  G             HKD +      Q +++++S SKD  + 
Sbjct: 500 VISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVL 559

Query: 188 IWDLKTQQCIETHIAHTGECWGLAVKD--------DLLITTSTDSQVKIWKLNMENEK-- 237
            WD  +   +     H      +AV +         +  T S D + +IWK   ++    
Sbjct: 560 FWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARIWKYTKKSNPTA 619

Query: 238 MGEKLTEM 245
            G KL E+
Sbjct: 620 TGAKLQEL 627

>Kpol_1031.49 s1031
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 bp, 760 aa] {ON}
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 nt, 761 aa]
          Length = 760

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 79/333 (23%), Positives = 132/333 (39%), Gaps = 55/333 (16%)

Query: 445 VILGTRSGELQLFDLASSSLLDTIE------DAHDAAIWSLDLTSDGKRLVTGSADKTVK 498
           + L T S  L++  + S    + I       D H+  + SLD T DG  + T S D T  
Sbjct: 296 IALATNSPTLRIIPVISEDNKNNIPLGVELYDGHEDLLNSLDATEDGLWIATASKDNTAM 355

Query: 499 FW--------------------------------------------DFQVEKTLVPGT-- 512
            W                                            DF V+K  VP    
Sbjct: 356 LWRFNDSENKFKKYAQFIGHASSVTSVSLPNVINNGWPEFIITSSNDFTVKKWKVPSPTK 415

Query: 513 ---KDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSL 569
               D  + ++K++  T      DI ++ I+P+D   A +  D T K++ LDS +   +L
Sbjct: 416 KSDNDDDMHLIKVSEYTRRAHEKDINALSIAPNDSIFATASYDKTCKIWDLDSGELMATL 475

Query: 570 YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN 629
             HK  +  +      K I T+S DK IKIW L+      +L  H +++    F+ +   
Sbjct: 476 ANHKRGLWDVSFCQYDKYIATASGDKTIKIWSLETFKVVNTLEGHTNAVQRCSFINKQKQ 535

Query: 630 FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETED 689
             S   D ++K WD    EC++ L  H + +WAL +  DG  ++++  D   + W++  +
Sbjct: 536 IVSTGADGLIKIWDCSSGECLKTLDGHANRIWALCVLRDGDMIITADADGVFQFWKDCTE 595

Query: 690 QVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
           +V            + E +L   +  G   +AF
Sbjct: 596 EVKEQDLEKEKLRVEQEQSLRNFIANGEWTNAF 628

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 122/295 (41%), Gaps = 19/295 (6%)

Query: 4   SYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALE-NVNIWDIKTGDLVTT 62
           S  +F++ A F   AS+   V +P  +  NNG  P  +ITS+ +  V  W + +    T 
Sbjct: 362 SENKFKKYAQFIGHASSVTSVSLP--NVINNG-WPEFIITSSNDFTVKKWKVPSP---TK 415

Query: 63  LSDG-----LPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNF 117
            SD      L   +   + +   +   L +  + ++ A    D   K+WDL S  ++   
Sbjct: 416 KSDNDDDMHLIKVSEYTRRAHEKDINALSIAPNDSIFATASYDKTCKIWDLDSGELMATL 475

Query: 118 NGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGF-WCQGEDW 176
             HK  +  + F      + + S D  I +W L     +  L  H +A+    +   +  
Sbjct: 476 ANHKRGLWDVSFCQYDKYIATASGDKTIKIWSLETFKVVNTLEGHTNAVQRCSFINKQKQ 535

Query: 177 LVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAV--KDDLLITTSTDSQVKIWKLNME 234
           +VST  DGLIKIWD  + +C++T   H    W L V    D++IT   D   + WK   E
Sbjct: 536 IVSTGADGLIKIWDCSSGECLKTLDGHANRIWALCVLRDGDMIITADADGVFQFWKDCTE 595

Query: 235 NEKMGEKLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKE 289
             K  +   E    E++   R     FI N     +F      D  +  Y + K+
Sbjct: 596 EVKEQDLEKEKLRVEQEQSLRN----FIANGEWTNAFLLAMTLDHPMRLYNVLKQ 646

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 94/227 (41%), Gaps = 33/227 (14%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLEL 530
           AH+  I +L +  +     T S DKT K WD    + +              NH   L  
Sbjct: 435 AHEKDINALSIAPNDSIFATASYDKTCKIWDLDSGELMATLA----------NHKRGL-- 482

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
                 V     D+Y+A +  D T+K++ L++ K   +L GH   V         K I++
Sbjct: 483 ----WDVSFCQYDKYIATASGDKTIKIWSLETFKVVNTLEGHTNAVQRCSFINKQKQIVS 538

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
           + AD  IKIW    G+C K+L  H + I ++  L +     +   D V ++W     +C 
Sbjct: 539 TGADGLIKIWDCSSGECLKTLDGHANRIWALCVLRDGDMIITADADGVFQFWK----DCT 594

Query: 651 QKLYAHQSEVWALAISTDGS-------------FVVSSSHDHSIRIW 684
           +++     E   L +  + S             F+++ + DH +R++
Sbjct: 595 EEVKEQDLEKEKLRVEQEQSLRNFIANGEWTNAFLLAMTLDHPMRLY 641

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 54/101 (53%), Gaps = 4/101 (3%)

Query: 403 NKLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALTCKFLPGGLLVILGTRSGELQLFDL 459
           +K +ATAS + ++KIW+++T K + T E        C F+     ++     G ++++D 
Sbjct: 491 DKYIATASGDKTIKIWSLETFKVVNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDC 550

Query: 460 ASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
           +S   L T+ D H   IW+L +  DG  ++T  AD   +FW
Sbjct: 551 SSGECLKTL-DGHANRIWALCVLRDGDMIITADADGVFQFW 590

 Score = 38.5 bits (88), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 9/74 (12%)

Query: 157 YKLRSHKDAITG--FWCQGED--WLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAV 212
           + L+ H   I+   F+ + ED  WL+++    ++K+WDL  ++CI T   H+    G+  
Sbjct: 83  HSLKGHGATISSLKFYGESEDSVWLLASGDTNMVKVWDLVKRKCIHTLQEHSSAVRGIDF 142

Query: 213 KDDLLITTSTDSQV 226
           K      +STDS +
Sbjct: 143 KQ-----SSTDSDI 151

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 76/358 (21%), Positives = 144/358 (40%), Gaps = 81/358 (22%)

Query: 387 LQGQRTDVRSIDV---SDDNKLLATASNGSLKIWN------VKTHKCIRTFE-------C 430
           LQ   + VR ID    S D+ ++   + G   I N      +K  K IRTF        C
Sbjct: 130 LQEHSSAVRGIDFKQSSTDSDIIHLVTGGRDNIINHWTISGLKNFKLIRTFPVHQQVEAC 189

Query: 431 GYALT-----CKFLPGGLLVILGTRSGELQLFDLASSSLLD-TIEDAHDAAIWSLDLTSD 484
           G+  +     C +  GG  V         Q+  L++ S++  T +   +  I  +    +
Sbjct: 190 GFIKSTEDDNCIYTAGGDAV--------FQILSLSNGSVIKKTKKPTEELFIIGVLPIKN 241

Query: 485 GKRLVTGSADKTVKFWD----FQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS 540
             +L    +D+T++  D    F+ +  ++          +  NH T  ++        + 
Sbjct: 242 FTKLYLVLSDQTLQLIDLIDTFEEDSEII-----TIKSSIAGNHGTIADMR------LVG 290

Query: 541 PDDRYLAISLLDNTVKVFFL------DSMKFYLSLY-GHKLPVLSIDISFDSKMIITSSA 593
           P+ + +A++    T+++  +      +++   + LY GH+  + S+D + D   I T+S 
Sbjct: 291 PELKSIALATNSPTLRIIPVISEDNKNNIPLGVELYDGHEDLLNSLDATEDGLWIATASK 350

Query: 594 DKNIKIWGLDFGDC------HKSLFAHQDSIMSVKFLPESHN------FFSCSKDAVVKY 641
           D    +W   F D       +     H  S+ SV  LP   N        + S D  VK 
Sbjct: 351 DNTAMLW--RFNDSENKFKKYAQFIGHASSVTSVS-LPNVINNGWPEFIITSSNDFTVKK 407

Query: 642 W----------DGEKFECIQ----KLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           W          + +    I+       AH+ ++ AL+I+ + S   ++S+D + +IW+
Sbjct: 408 WKVPSPTKKSDNDDDMHLIKVSEYTRRAHEKDINALSIAPNDSIFATASYDKTCKIWD 465

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 37/83 (44%), Gaps = 8/83 (9%)

Query: 610 SLFAHQDSIMSVKFLPESHN---FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI- 665
           SL  H  +I S+KF  ES +     +     +VK WD  K +CI  L  H S V  +   
Sbjct: 84  SLKGHGATISSLKFYGESEDSVWLLASGDTNMVKVWDLVKRKCIHTLQEHSSAVRGIDFK 143

Query: 666 --STDGSFV--VSSSHDHSIRIW 684
             STD   +  V+   D+ I  W
Sbjct: 144 QSSTDSDIIHLVTGGRDNIINHW 166

>Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222C
           (UTP13) - Protein required for cell viability [contig
           27] FULL
          Length = 823

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 114/235 (48%), Gaps = 5/235 (2%)

Query: 488 LVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLA 547
           ++T S D T+K W   V K   P + D  +  +K++  T      DI ++ ISP+D   A
Sbjct: 466 IITASNDLTIKKW--SVPK---PTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFA 520

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            +  D T K++ +DS +   +L  HK  +  +      K++ T S DK IK+W L+    
Sbjct: 521 TASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVWSLESMSV 580

Query: 608 HKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST 667
            K+L  H +++    F+  +    S   D ++K WD    ECI+ L AH + +WAL++ +
Sbjct: 581 VKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDLSTGECIRTLDAHSNRIWALSVLS 640

Query: 668 DGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
           DG   V++  D   + W++  ++             + E +L   + +G+  +AF
Sbjct: 641 DGKEFVTADADGVFQFWKDCSEEEQKENLENQKLMVEQEQSLQNYMAQGDWTNAF 695

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 171/724 (23%), Positives = 292/724 (40%), Gaps = 119/724 (16%)

Query: 41  LITSALENVNIWDIK-TGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYA 99
           L TS ++ VNI ++  T  L+ T+           +     E T L++  +   L     
Sbjct: 32  LATSVVDEVNIMELSPTKRLIHTI-----------ENDDEQEITALKLTPNGEYLCFVSQ 80

Query: 100 DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
             +++++ L SK ++ +     + + +M  DS+ T +  G  D ++ V D+      +  
Sbjct: 81  AQLLRIYKLSSKKIIRSMKV-SSPVYVMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSF 139

Query: 160 RSHKDAITGFWCQGED----W-LVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVK- 213
           + H   I+     GE     W L S    G++K+WDL  + CI T   H     GL  + 
Sbjct: 140 KGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRRNCIHTIQEHAAAVRGLDFRL 199

Query: 214 ---DD---LLITTSTDSQVKIWKLNMENEKMGEKLTEMGIFEKQSKQRGLKIEFITNASD 267
              DD    L+T   D  V +++LN   +    KL       +Q +  G    FI ++ D
Sbjct: 200 SPADDGVLELLTGGRDDIVNLFQLNSTKKA---KLMRTIPVHQQIEACG----FIRDSPD 252

Query: 268 GVSFFYIQNADKTIETY---------RIRKEEE---IAXXXXXXXXXXXXXXXTDE---- 311
           G S FY    D   +           R +K  E   I                +D+    
Sbjct: 253 G-SLFYTAGGDAVFQILSFTSASVAKRTKKPIEELFIIGVLPIMQGSKVYLVLSDQTLFL 311

Query: 312 -EISKSI-KDSYSSLILHPFQ----TVRSLYKI-----KSASWTTVTSSKLELVVTTSNN 360
             +S S+ KD    +I H       TV  +  +     K A  T   + ++     T +N
Sbjct: 312 VNLSASLSKDGDEIVIEHKIAGNHGTVADMRFVGKELDKLALATNSPALRVITAPVTKHN 371

Query: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTD-VRSIDVSDDNKLLATAS-NGSLKIWN 418
             E    P  K D  +  PL+   +EL    TD + S+D S++ + LAT S + ++ +W 
Sbjct: 372 AAEKEDEPTSKVDIQNCLPLE---VELYEGHTDLLNSLDSSENGEWLATCSKDHTVILWK 428

Query: 419 VKT----HKCIRTFECGYA--LTCKFLPGGLL----VILGTRSGELQL------------ 456
           +       K    F  G+A  +T   LP  +       + T S +L +            
Sbjct: 429 LNADSEKFKPYARF-TGHAGPVTAVGLPNVMRNTWPEFIITASNDLTIKKWSVPKPTSND 487

Query: 457 FDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF---QVEKTLVPGTK 513
            D+ +  + D    AH+  I +L ++ +     T S DKT K W+    ++E TL     
Sbjct: 488 VDMHNIKVSDYTRRAHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLA---- 543

Query: 514 DKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHK 573
                    NH   L        V     D+ LA    D T+KV+ L+SM    +L GH 
Sbjct: 544 ---------NHKRGL------WDVTFCQYDKLLATCSGDKTIKVWSLESMSVVKTLEGHT 588

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
             V        +K I+++ AD  IK+W L  G+C ++L AH + I ++  L +   F + 
Sbjct: 589 NAVQRCSFINRNKQIVSTGADGLIKVWDLSTGECIRTLDAHSNRIWALSVLSDGKEFVTA 648

Query: 634 SKDAVVKYW----DGEKFECI--QKLYAHQSEVWALAISTD---GSFVVSSSHDHSIRIW 684
             D V ++W    + E+ E +  QKL   Q +     ++      +F+++ + +H +R++
Sbjct: 649 DADGVFQFWKDCSEEEQKENLENQKLMVEQEQSLQNYMAQGDWTNAFLLAMTLNHPMRLY 708

Query: 685 EETE 688
              E
Sbjct: 709 RVLE 712

>KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 826

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 116/235 (49%), Gaps = 5/235 (2%)

Query: 488 LVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLA 547
           ++T S D T+K W   V K   PG +     ++K++  T    + DI ++ ISP+D   A
Sbjct: 469 IITASNDLTIKKW--TVPK---PGHETAEPHVVKVSDYTRRAHDKDINALSISPNDSTFA 523

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            +  D T KV+ +DS +   +L  HK  +  +      K++ T S DK +K+W LD    
Sbjct: 524 TASYDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTLSV 583

Query: 608 HKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST 667
            K+L  H +++    F+ ++    S   D ++K WD    EC++ L AH++ +WAL++  
Sbjct: 584 VKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAHENRIWALSVLH 643

Query: 668 DGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
           DG   V++  D   + W++  ++             + + +L   + +G+  +AF
Sbjct: 644 DGDEFVTADADGVFQFWKDCSEEQEKENLENHKRKVEQDQSLQNYMSQGDWTNAF 698

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 81/177 (45%), Gaps = 16/177 (9%)

Query: 466 DTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHD 525
           D    AHD  I +L ++ +     T S DKT K WD  V+   + GT          NH 
Sbjct: 500 DYTRRAHDKDINALSISPNDSTFATASYDKTCKVWD--VDSGELQGT--------LANHK 549

Query: 526 TTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDS 585
             L        V     D+ LA    D TVKV+ LD++    +L GH   V        +
Sbjct: 550 RGL------WDVSFCQYDKLLATCSGDKTVKVWSLDTLSVVKTLEGHTNAVQRCSFINKN 603

Query: 586 KMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYW 642
           K ++++ AD  IK+W L  G+C ++L AH++ I ++  L +   F +   D V ++W
Sbjct: 604 KQLVSTGADGLIKLWDLSTGECVRTLDAHENRIWALSVLHDGDEFVTADADGVFQFW 660

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 85/206 (41%), Gaps = 9/206 (4%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           L +  + +  A    D   KVWD+ S  +      HK  +  + F      L + S D  
Sbjct: 513 LSISPNDSTFATASYDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKT 572

Query: 145 IIVWDLVGEVGLYKLRSHKDAITGF-WCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAH 203
           + VW L     +  L  H +A+    +      LVST  DGLIK+WDL T +C+ T  AH
Sbjct: 573 VKVWSLDTLSVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAH 632

Query: 204 TGECWGLAV--KDDLLITTSTDSQVKIWK-LNMENEKMGEKLTEMGIFEKQSKQRGLKIE 260
               W L+V    D  +T   D   + WK  + E EK   +  +  + + QS Q  +   
Sbjct: 633 ENRIWALSVLHDGDEFVTADADGVFQFWKDCSEEQEKENLENHKRKVEQDQSLQNYMSQG 692

Query: 261 FITNASDGVSFFYIQNADKTIETYRI 286
             TNA     F      D  +  YR+
Sbjct: 693 DWTNA-----FLLAMTLDHPMRLYRV 713

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 55/101 (54%), Gaps = 4/101 (3%)

Query: 403 NKLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALTCKFLPGGLLVILGTRSGELQLFDL 459
           +KLLAT S + ++K+W++ T   ++T E        C F+     ++     G ++L+DL
Sbjct: 561 DKLLATCSGDKTVKVWSLDTLSVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDL 620

Query: 460 ASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
           ++   + T+ DAH+  IW+L +  DG   VT  AD   +FW
Sbjct: 621 STGECVRTL-DAHENRIWALSVLHDGDEFVTADADGVFQFW 660

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 76/181 (41%), Gaps = 11/181 (6%)

Query: 515 KFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKL 574
           +  P  ++ H    +   +I +++++PD  YL        ++++ L S +   S+     
Sbjct: 44  ELAPTKRVLHRIENDDEQEITALKLTPDGEYLCYVSQAQLLRIYHLRSKRVVRSMKVSS- 102

Query: 575 PVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN----F 630
           PV  ID    S ++     D ++ +  ++ G    SL  H  +I SVKF  E ++     
Sbjct: 103 PVYVIDCDPSSTLVALGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFFGELNSTTWRL 162

Query: 631 FSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQ 690
            S   + VVK WD  +  C+  +  H + V  L       F VS + D  + +     D 
Sbjct: 163 GSGDTNGVVKVWDLVRRSCLHTIQEHAAAVRGL------DFRVSDADDDVLELLSGGRDD 216

Query: 691 V 691
           +
Sbjct: 217 I 217

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 61/140 (43%), Gaps = 13/140 (9%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           +WD+ +G+L  TL++    G  D      + C Y        LLA    D  +KVW L +
Sbjct: 533 VWDVDSGELQGTLANH-KRGLWDV-----SFCQY------DKLLATCSGDKTVKVWSLDT 580

Query: 111 KTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFW 170
            +V+    GH  A+    F +   +L+S   D  I +WDL     +  L +H++ I    
Sbjct: 581 LSVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAHENRIWALS 640

Query: 171 C-QGEDWLVSTSKDGLIKIW 189
                D  V+   DG+ + W
Sbjct: 641 VLHDGDEFVTADADGVFQFW 660

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 73/163 (44%), Gaps = 13/163 (7%)

Query: 81  ECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGS 140
           E T L++  D   L       +++++ L SK V+ +     + + ++  D + T +  G 
Sbjct: 62  EITALKLTPDGEYLCYVSQAQLLRIYHLRSKRVVRSMKV-SSPVYVIDCDPSSTLVALGG 120

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGE----DW-LVSTSKDGLIKIWDLKTQQ 195
            D ++ V D+      + L+ H   I+     GE     W L S   +G++K+WDL  + 
Sbjct: 121 TDGSVSVIDIENGYVTHSLKGHGATISSVKFFGELNSTTWRLGSGDTNGVVKVWDLVRRS 180

Query: 196 CIETHIAHTGECWGLAVK-----DDL--LITTSTDSQVKIWKL 231
           C+ T   H     GL  +     DD+  L++   D  V +++L
Sbjct: 181 CLHTIQEHAAAVRGLDFRVSDADDDVLELLSGGRDDIVNLYQL 223

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 55/124 (44%), Gaps = 11/124 (8%)

Query: 86  EVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQF-----DSTGTRLISGS 140
           E++  T  L  G  +GV+KVWDLV ++ L     H AA+  + F     D     L+SG 
Sbjct: 154 ELNSTTWRLGSGDTNGVVKVWDLVRRSCLHTIQEHAAAVRGLDFRVSDADDDVLELLSGG 213

Query: 141 KDSNIIVWDL--VGEVGLYKLRSHKDAI--TGFWCQGE--DWLVSTSKDGLIKIWDLKTQ 194
           +D  + ++ L    +V L K       I   GF   GE  D   +   D + +I  L T 
Sbjct: 214 RDDIVNLYQLGSTKKVKLVKTIPVHQQIEACGFIHDGEHQDLFYTAGGDAVYQILSLATA 273

Query: 195 QCIE 198
             I+
Sbjct: 274 SVIK 277

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 111/235 (47%), Gaps = 6/235 (2%)

Query: 488 LVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLA 547
           L+T S D T+K W     K   P T    V ++K++  T      DI ++ +SP+D   A
Sbjct: 455 LLTASNDLTIKKW-----KIPKP-TSTNDVQIIKVSEYTRHAHEKDINALSVSPNDSIFA 508

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            +  D T K++ L++ +   +L  HK  +  +      K++ T S DK +KIW L+    
Sbjct: 509 TASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATCSGDKTVKIWSLETFSV 568

Query: 608 HKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST 667
            K+L  H +++    F+ +     SC  D ++K WD    EC++ L  H + +WAL    
Sbjct: 569 MKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSGECLKTLDGHNNRLWALNTMN 628

Query: 668 DGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
           DG  +VS+  D   + W++  +Q             + E +L   + +G+  +AF
Sbjct: 629 DGDTIVSADADGIFQFWKDCTEQEKEEELEKTKIQVEQEQSLQNYMSQGDWTNAF 683

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 135/615 (21%), Positives = 235/615 (38%), Gaps = 85/615 (13%)

Query: 81  ECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGS 140
           E T L++  D   L       ++K++ L +  V+ +      +  ++  DST T L  G 
Sbjct: 63  EITALQLTPDGQYLTYVSQAQLLKIFQLKTGKVVRSMKISSPSY-ILDTDSTSTLLAVGG 121

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDAITG--FWCQGED--WLVSTS-KDGLIKIWDLKTQQ 195
            D +IIV D+      + L+ H   I+   F+ Q +   WL+++   +G++K+WDL  ++
Sbjct: 122 TDGSIIVVDIENGYITHSLKGHGGTISSLKFYGQLDSKVWLLASGDTNGMVKVWDLVKRK 181

Query: 196 CIETHIAHTGECWGLAVKDD---------LLITTSTDSQVKIWKLNMENEKMGEKLTEMG 246
           C+ T   HT    GL + +           LI+   D  V  W  +M+ +    KL +  
Sbjct: 182 CLHTLQEHTSAVRGLDITEVENNDGPSHLKLISGGRDDIVNFWDFDMKKKC---KLIKTL 238

Query: 247 IFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIE------------TYRIRKEEEIAX 294
              +Q +  G       N  DG    Y    D   +            T +  +E  I  
Sbjct: 239 PVNQQVESCGF-----LNTRDGKHIIYTAGGDAIFQLIDLESGSMLKRTNKPIEELYIIG 293

Query: 295 XXXXXXXXXXXXXXTDEEISK-SIKDSYSSL--ILHPFQTVRSLYKIKSASWTTVTSSKL 351
                         +D+ +   +I+++  S   I+    ++   + I  A    V     
Sbjct: 294 VLPIMSDSKMFLVMSDQTLQLINIEEALESKEEIIQAESSIAGNHGI-IADMRFVGPELN 352

Query: 352 ELVVTTSNNTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATAS- 410
           +L + T++  +    IP +     S  PL     E  G    + S+D ++D   +ATAS 
Sbjct: 353 KLALATNSPALRIIPIP-DLTSTESSLPLDVEIYE--GHEDLLNSLDATEDGLWIATASK 409

Query: 411 NGSLKIWNVKTHKCIRTFECGY-----ALTC----KFLPGGLLVILGTRSGELQL----- 456
           + S  +W              Y     A+T       +P G    L T S +L +     
Sbjct: 410 DNSAIVWKYNNDTSKFDIYAKYIGHSSAVTAVGLPNVMPKGYPEFLLTASNDLTIKKWKI 469

Query: 457 ------FDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF---QVEKT 507
                  D+    + +    AH+  I +L ++ +     T S DKT K W+    ++E T
Sbjct: 470 PKPTSTNDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEAT 529

Query: 508 LVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYL 567
           L              NH   L        V     D+ LA    D TVK++ L++     
Sbjct: 530 LA-------------NHKRGL------WDVSFCQYDKLLATCSGDKTVKIWSLETFSVMK 570

Query: 568 SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPES 627
           +L GH   V         K +++  AD  IKIW    G+C K+L  H + + ++  + + 
Sbjct: 571 TLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSGECLKTLDGHNNRLWALNTMNDG 630

Query: 628 HNFFSCSKDAVVKYW 642
               S   D + ++W
Sbjct: 631 DTIVSADADGIFQFW 645

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 73/175 (41%), Gaps = 12/175 (6%)

Query: 68  PPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVI---------KVWDLVSKTVLLNFN 118
           P   +D +  K +E T     +D N L+V   D +          K+W+L +  +     
Sbjct: 472 PTSTNDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLA 531

Query: 119 GHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGF-WCQGEDWL 177
            HK  +  + F      L + S D  + +W L     +  L  H +A+    +   +  L
Sbjct: 532 NHKRGLWDVSFCQYDKLLATCSGDKTVKIWSLETFSVMKTLEGHTNAVQRCSFINKQKQL 591

Query: 178 VSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKD--DLLITTSTDSQVKIWK 230
           VS   DGLIKIWD  + +C++T   H    W L   +  D +++   D   + WK
Sbjct: 592 VSCGADGLIKIWDCYSGECLKTLDGHNNRLWALNTMNDGDTIVSADADGIFQFWK 646

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 77/176 (43%), Gaps = 12/176 (6%)

Query: 521 KLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSID 580
           K+ H  + E   +I +++++PD +YL        +K+F L + K   S+     P   +D
Sbjct: 51  KILHKISNEDEQEITALQLTPDGQYLTYVSQAQLLKIFQLKTGKVVRSMKISS-PSYILD 109

Query: 581 ISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN----FFSCSKD 636
               S ++     D +I +  ++ G    SL  H  +I S+KF  +  +      S   +
Sbjct: 110 TDSTSTLLAVGGTDGSIIVVDIENGYITHSLKGHGGTISSLKFYGQLDSKVWLLASGDTN 169

Query: 637 AVVKYWDGEKFECIQKLYAHQSEVWALAIS----TDGSF---VVSSSHDHSIRIWE 685
            +VK WD  K +C+  L  H S V  L I+     DG     ++S   D  +  W+
Sbjct: 170 GMVKVWDLVKRKCLHTLQEHTSAVRGLDITEVENNDGPSHLKLISGGRDDIVNFWD 225

>KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA
          Length = 814

 Score =  100 bits (250), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 110/235 (46%), Gaps = 4/235 (1%)

Query: 488 LVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLA 547
           ++T S D T+K W  +V K      +D  + ++K +  T      DI ++ ISP+D   A
Sbjct: 456 IITASNDLTIKKW--KVPKVTSDEPED--LILVKTSEYTRRAHEKDINAISISPNDSLFA 511

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            +  D T K++ LD  +F  +L  HK  +  +      K++ T S DK IKIW L+    
Sbjct: 512 TASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYAV 571

Query: 608 HKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST 667
            K+L  H +++    F+ ++    S   D +V  WD    E ++ L AH + +WALA+  
Sbjct: 572 VKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALAVMN 631

Query: 668 DGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
           DG   V++  D     W +  ++             + E +L   L EG+  +AF
Sbjct: 632 DGESFVTADADGFFEFWRDNSEEEHERNLEQEKLKIEQEQSLQNYLSEGDWTNAF 686

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 74/179 (41%), Gaps = 14/179 (7%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           + +  + +L A    D   K+W+L           HK  +  + F      L + S D  
Sbjct: 501 ISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKT 560

Query: 145 IIVWDLVGEVGLYKLRSHKDAITGF-WCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAH 203
           I +W L     +  L  H +A+    +      L+ST  DGL+ IWDL T + ++T  AH
Sbjct: 561 IKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAH 620

Query: 204 TGECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEMGIFEKQSKQRGLKIE 260
               W LAV +D    +T   D   + W+ N E E            E+  +Q  LKIE
Sbjct: 621 NNRIWALAVMNDGESFVTADADGFFEFWRDNSEEEH-----------ERNLEQEKLKIE 668

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 97/226 (42%), Gaps = 31/226 (13%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFW---DFQVEKTLVPGTKDKFVPMLKLNHDTT 527
           AH+  I ++ ++ +     T S DKT K W   D + + TL              NH   
Sbjct: 493 AHEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLA-------------NHKRG 539

Query: 528 LELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM 587
           L        V     D+ LA    D T+K++ L+S     +L GH   V        +K 
Sbjct: 540 L------WDVAFCQYDKLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQ 593

Query: 588 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYW----- 642
           +I++ AD  + IW L  G+  K+L AH + I ++  + +  +F +   D   ++W     
Sbjct: 594 LISTGADGLVIIWDLSTGESVKTLDAHNNRIWALAVMNDGESFVTADADGFFEFWRDNSE 653

Query: 643 -DGEKFECIQKLYAHQSEVWALAISTD---GSFVVSSSHDHSIRIW 684
            + E+    +KL   Q +     +S      +F+++ + DH +R++
Sbjct: 654 EEHERNLEQEKLKIEQEQSLQNYLSEGDWTNAFLLAMTLDHPMRLY 699

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 58/101 (57%), Gaps = 4/101 (3%)

Query: 403 NKLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALTCKFLPGGLLVILGTRSGELQLFDL 459
           +KLLAT S + ++KIW+++++  ++T E        C F+     +I     G + ++DL
Sbjct: 549 DKLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDL 608

Query: 460 ASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
           ++   + T+ DAH+  IW+L + +DG+  VT  AD   +FW
Sbjct: 609 STGESVKTL-DAHNNRIWALAVMNDGESFVTADADGFFEFW 648

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 58/140 (41%), Gaps = 13/140 (9%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           IW++  G+   TL++    G  D      A C Y        LLA    D  IK+W L S
Sbjct: 521 IWNLDDGEFQATLANH-KRGLWDV-----AFCQY------DKLLATCSGDKTIKIWSLES 568

Query: 111 KTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFW 170
             V+    GH  A+    F +   +LIS   D  +I+WDL     +  L +H + I    
Sbjct: 569 YAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALA 628

Query: 171 CQGE-DWLVSTSKDGLIKIW 189
              + +  V+   DG  + W
Sbjct: 629 VMNDGESFVTADADGFFEFW 648

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 53/108 (49%), Gaps = 9/108 (8%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQF----DSTGTRLISGS 140
           +   Q + LLA+G  DG + V D+ +  V  +  GH A I+ ++F    +S   +L SG 
Sbjct: 107 MNCDQTSTLLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGD 166

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVSTSKDGLIKI 188
            +  I VWDLV       ++ H  A+ G      D+ V+  + G +++
Sbjct: 167 TNGMIKVWDLVKRNCQCTIQEHTTAVRGL-----DFRVTDEEKGTLQL 209

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 59/135 (43%), Gaps = 6/135 (4%)

Query: 81  ECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGS 140
           + T L +  D + L       +++V+ L  + ++ +     + + +M  D T T L  G 
Sbjct: 62  DITALHLTPDGSYLCFVSQAQLLRVYSLKQERIIRSMK-ISSPVYVMNCDQTSTLLAIGG 120

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGE----DW-LVSTSKDGLIKIWDLKTQQ 195
            D ++ V D+      + L+ H   I+     GE     W L S   +G+IK+WDL  + 
Sbjct: 121 TDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGMIKVWDLVKRN 180

Query: 196 CIETHIAHTGECWGL 210
           C  T   HT    GL
Sbjct: 181 CQCTIQEHTTAVRGL 195

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 60/144 (41%), Gaps = 5/144 (3%)

Query: 524 HDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISF 583
           H    E   DI ++ ++PD  YL        ++V+ L   +   S+     PV  ++   
Sbjct: 53  HSVDTEDEQDITALHLTPDGSYLCFVSQAQLLRVYSLKQERIIRSMKISS-PVYVMNCDQ 111

Query: 584 DSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN----FFSCSKDAVV 639
            S ++     D ++ +  ++ G    SL  H  +I SVKF  E ++      S   + ++
Sbjct: 112 TSTLLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGMI 171

Query: 640 KYWDGEKFECIQKLYAHQSEVWAL 663
           K WD  K  C   +  H + V  L
Sbjct: 172 KVWDLVKRNCQCTIQEHTTAVRGL 195

 Score = 35.4 bits (80), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 5/55 (9%)

Query: 94  LAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDST----GT-RLISGSKDS 143
           LA G  +G+IKVWDLV +        H  A+  + F  T    GT +L+SG +D+
Sbjct: 162 LASGDTNGMIKVWDLVKRNCQCTIQEHTTAVRGLDFRVTDEEKGTLQLLSGGRDN 216

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 58/136 (42%), Gaps = 23/136 (16%)

Query: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMSVKF-- 623
           GH   + S+D + D   + T+S D ++ +W       DF    K    H  S+ +V    
Sbjct: 388 GHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTK-FVGHVGSVNAVGLPN 446

Query: 624 -LPESHNFF--SCSKDAVVKYWDGEKFECIQK------------LYAHQSEVWALAISTD 668
            +P S   F  + S D  +K W   K    +               AH+ ++ A++IS +
Sbjct: 447 VMPRSWPEFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAISISPN 506

Query: 669 GSFVVSSSHDHSIRIW 684
            S   ++S+D + +IW
Sbjct: 507 DSLFATASYDKTCKIW 522

>TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON}
           Anc_6.363 YCR084C
          Length = 727

 Score =  100 bits (248), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 79/333 (23%), Positives = 143/333 (42%), Gaps = 60/333 (18%)

Query: 394 VRSIDVSDDNKLLATASNGSLKIWNVKTHKCIRTFECG--------------------YA 433
           V  +  S+D + LAT  N + +++   T + I T                        Y 
Sbjct: 401 VCCVRFSNDGQFLATGCNKTTRVYKTSTGELIATLLVDPQSSNNSNSEQQTNPESSDLYI 460

Query: 434 LTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSA 493
            +  F P G  +  G     ++++D+ +  ++  I   H+  I+SLD    G++LV+GS 
Sbjct: 461 RSVCFSPDGKFLAAGAEDKLIRIWDITTKQIV-MILKGHEQDIYSLDYFPSGEKLVSGSG 519

Query: 494 DKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDD-RYLAISLLD 552
           DKTV+ WD +  +  +                 TL + D + +V  SP++ +++A   LD
Sbjct: 520 DKTVRIWDLRTGQCSL-----------------TLSIEDGVTTVSSSPNNGKFIAAGSLD 562

Query: 553 NTVKV------FFLDSMKFYLSLY-GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG 605
            + ++      F L  +     L  GHK  + S+  + D K +++ S D+++K+W LD  
Sbjct: 563 RSARIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTT 622

Query: 606 D------CHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSE 659
           +      C  +   H+D ++SV          S SKD  V +WD      +  L  H++ 
Sbjct: 623 NNNSNESCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLFWDTNSGNPLLMLQGHKNS 682

Query: 660 VWALAISTD-------GSFVVSSSHDHSIRIWE 685
           V ++A++         G F   S  D + +IW 
Sbjct: 683 VISVAVANGQPLGPEFGVFSTGSG-DFTAKIWR 714

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 111/227 (48%), Gaps = 18/227 (7%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLEL 530
           +H + +  +  ++DG+ L TG  +KT + +     + +     D   P    N ++  + 
Sbjct: 396 SHPSVVCCVRFSNDGQFLATG-CNKTTRVYKTSTGELIATLLVD---PQSSNNSNSEQQT 451

Query: 531 NDD-----ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDS 585
           N +     I SV  SPD ++LA    D  ++++ + + +  + L GH+  + S+D     
Sbjct: 452 NPESSDLYIRSVCFSPDGKFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSG 511

Query: 586 KMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC-SKDAVVKYWDG 644
           + +++ S DK ++IW L  G C  +L + +D + +V   P +  F +  S D   + WD 
Sbjct: 512 EKLVSGSGDKTVRIWDLRTGQCSLTL-SIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDT 570

Query: 645 EKFECIQKL-------YAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
           E    +++L         H+  +++++ + DG  +VS S D S+++W
Sbjct: 571 ETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLW 617

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 103/229 (44%), Gaps = 25/229 (10%)

Query: 387 LQGQRTDVRSID-VSDDNKLLATASNGSLKIWNVKTHKCIRTF--ECGYALTCKFLPGGL 443
           L+G   D+ S+D      KL++ + + +++IW+++T +C  T   E G          G 
Sbjct: 495 LKGHEQDIYSLDYFPSGEKLVSGSGDKTVRIWDLRTGQCSLTLSIEDGVTTVSSSPNNGK 554

Query: 444 LVILGTRSGELQLFDLASSSLLDTI------EDAHDAAIWSLDLTSDGKRLVTGSADKTV 497
            +  G+     +++D  +  LL  +      ++ H  +I+S+  T DGK+LV+GS D++V
Sbjct: 555 FIAAGSLDRSARIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSV 614

Query: 498 KFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKV 557
           K W+            ++   +  + H       D +LSV  S +D Y+     D  V  
Sbjct: 615 KLWNLDTTN----NNSNESCEVTFIGH------KDFVLSVTTSQNDEYVLSGSKDRGVLF 664

Query: 558 FFLDSMKFYLSLYGHKLPVLSIDISFDSKM------IITSSADKNIKIW 600
           +  +S    L L GHK  V+S+ ++    +        T S D   KIW
Sbjct: 665 WDTNSGNPLLMLQGHKNSVISVAVANGQPLGPEFGVFSTGSGDFTAKIW 713

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 100/224 (44%), Gaps = 21/224 (9%)

Query: 36  SGPGQ-LITSALENVNIWDIKTGDLVTTL-SDGLPPGASDAKGSKPAECTYLEVHQ---- 89
           S  GQ L T   +   ++   TG+L+ TL  D      S+++     E + L +      
Sbjct: 407 SNDGQFLATGCNKTTRVYKTSTGELIATLLVDPQSSNNSNSEQQTNPESSDLYIRSVCFS 466

Query: 90  -DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVW 148
            D   LA G  D +I++WD+ +K +++   GH+  I  + +  +G +L+SGS D  + +W
Sbjct: 467 PDGKFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSGEKLVSGSGDKTVRIW 526

Query: 149 DL-VGEVGLYKLRSHKDAITGFWCQGED--WLVSTSKDGLIKIWDLKT-------QQCIE 198
           DL  G+  L    S +D +T       +  ++ + S D   +IWD +T           +
Sbjct: 527 DLRTGQCSL--TLSIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDTETGFLLKRLDSQTD 584

Query: 199 THIAHTGECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGE 240
               H    + ++   D   L++ S D  VK+W L+  N    E
Sbjct: 585 LQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNSNE 628

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 99/242 (40%), Gaps = 48/242 (19%)

Query: 25  WIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLVTTLS--DGLPPGASDAKGSKPAEC 82
           + P+  +  +GSG         + V IWD++TG    TLS  DG+   +S     K    
Sbjct: 507 YFPSGEKLVSGSGD--------KTVRIWDLRTGQCSLTLSIEDGVTTVSSSPNNGK---- 554

Query: 83  TYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNF-------NGHKAAITLMQFDSTGTR 135
                      +A G  D   ++WD  +  +L          NGHK +I  + F   G +
Sbjct: 555 ----------FIAAGSLDRSARIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKK 604

Query: 136 LISGSKDSNIIVWDL------VGEVGLYKLRSHKDAITGFWC-QGEDWLVSTSKDGLIKI 188
           L+SGS D ++ +W+L        E        HKD +      Q +++++S SKD  +  
Sbjct: 605 LVSGSLDRSVKLWNLDTTNNNSNESCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLF 664

Query: 189 WDLKTQQCIETHIAHTGECWGLAVKD--------DLLITTSTDSQVKIWKLN--MENEKM 238
           WD  +   +     H      +AV +         +  T S D   KIW+    ++++KM
Sbjct: 665 WDTNSGNPLLMLQGHKNSVISVAVANGQPLGPEFGVFSTGSGDFTAKIWRYRKIIDSKKM 724

Query: 239 GE 240
            E
Sbjct: 725 EE 726

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 86/357 (24%), Positives = 153/357 (42%), Gaps = 70/357 (19%)

Query: 379 PLKTHTIELQGQRT-----DVRSIDVSDDNKLLATASNGSLKIWNVKTHKCIRTF----E 429
           P +   I+++  RT      V  +  S++ + LAT  N + KI+ V T   +       +
Sbjct: 301 PTQPKDIDIELHRTLLHDSVVCCVKFSNNGEYLATGCNKTTKIFEVATGNLVTELVDDTK 360

Query: 430 CG------------YALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIW 477
            G            Y  +  F P G  +  G     ++++D+A   ++  +   H+  I+
Sbjct: 361 TGTEDANSASSADLYIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLR-GHEQDIY 419

Query: 478 SLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSV 537
           SLD    G +LV+GS D+T++ WD    +  +                 TL + D + +V
Sbjct: 420 SLDYFQSGNKLVSGSGDRTIRIWDLHTGQCSL-----------------TLSIEDGVTTV 462

Query: 538 RISPDD-RYLAISLLDNTVKVFFLDSMKFYL---------SLYGHKLPVLSIDISFDSKM 587
            +SP +  Y+A   LD TV+V+  DS   +L         +  GHK  V S+  + D K 
Sbjct: 463 AVSPGNGNYVAAGSLDRTVRVW--DSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKN 520

Query: 588 IITSSADKNIKIWGLDF-------------GDCHKSLFAHQDSIMSVKFLPESHNFFSCS 634
           I++ S D+++K+W L               G+C  +   H+D ++SV          S S
Sbjct: 521 IVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGS 580

Query: 635 KDAVVKYWDGEKFECIQKLYAHQSEVWALAIS------TDGSFVVSSSHDHSIRIWE 685
           KD  V +WD      +  L  H++ V ++A++       + +   + S D   +IW+
Sbjct: 581 KDRGVIFWDKVSGVPLLMLQGHRNSVISVAVANGKPLGANYNVFATGSGDCKAKIWK 637

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 100/214 (46%), Gaps = 19/214 (8%)

Query: 32  TNNGSGPGQLITSALENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEV--HQ 89
           +NNG     L T   +   I+++ TG+LVT L D    G  DA  +  A+     V    
Sbjct: 327 SNNGE---YLATGCNKTTKIFEVATGNLVTELVDDTKTGTEDANSASSADLYIRSVCFSP 383

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++WD+  + +++   GH+  I  + +  +G +L+SGS D  I +WD
Sbjct: 384 DGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWD 443

Query: 150 L-VGEVGLYKLRSHKDAITGFWCQ--GEDWLVSTSKDGLIKIWDLKTQQCI-------ET 199
           L  G+  L    S +D +T         +++ + S D  +++WD  +   +       ET
Sbjct: 444 LHTGQCSL--TLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGET 501

Query: 200 HIAHTGECWGLAVKDDL--LITTSTDSQVKIWKL 231
            + H    + +    D   +++ S D  VK+W L
Sbjct: 502 GVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNL 535

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 67/165 (40%), Gaps = 25/165 (15%)

Query: 49  VNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDL 108
           V +WD  +G LV  L      G     G K +  + +      N+++ G  D  +K+W+L
Sbjct: 481 VRVWDSNSGFLVERLDSEGETGV----GHKDSVYSVVFTRDGKNIVS-GSLDRSVKLWNL 535

Query: 109 -------------VSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVG 155
                              + + GHK  +  +        ++SGSKD  +I WD V  V 
Sbjct: 536 RNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWDKVSGVP 595

Query: 156 LYKLRSHKDAITGFWCQ-----GEDWLV--STSKDGLIKIWDLKT 193
           L  L+ H++++           G ++ V  + S D   KIW  +T
Sbjct: 596 LLMLQGHRNSVISVAVANGKPLGANYNVFATGSGDCKAKIWKFQT 640

>CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON}
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222c
          Length = 816

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 111/240 (46%), Gaps = 10/240 (4%)

Query: 486 KRLVTGSADKTVKFWDFQVEKTLVPGTKDKF--VPMLKLNHDTTLELND-DILSVRISPD 542
           K ++T S D TVK W+       +P  K+    VP +  +   T   ++ DI ++ ++P+
Sbjct: 454 KYIITASNDLTVKKWE-------IPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPN 506

Query: 543 DRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGL 602
           D   A +  D T K++ +D+ +   +L  HK  +  +      K I T S DK +KIW L
Sbjct: 507 DSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKWIATCSGDKTVKIWSL 566

Query: 603 DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWA 662
           +     K+L  H +++    F+ +     S   D ++K WD    +CI+ L  H + +WA
Sbjct: 567 ESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIWA 626

Query: 663 LAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
           L++  DG  ++S+  D   + W++  +              + E +L   +  G   +AF
Sbjct: 627 LSVLEDGDLIISADADSVFQFWKDCTEAEIQGALEENKVRVEQEQSLTNYMNNGEWSNAF 686

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 69/151 (45%), Gaps = 3/151 (1%)

Query: 92  NLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLV 151
           ++ A    D   K+W++ +   +     HK  +  + F  +   + + S D  + +W L 
Sbjct: 508 SIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKWIATCSGDKTVKIWSLE 567

Query: 152 GEVGLYKLRSHKDAITGF-WCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGL 210
               L  L  H +A+    +   +  LVS   DGLIK+WD+ +  CI+    H+   W L
Sbjct: 568 SFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIWAL 627

Query: 211 AVKD--DLLITTSTDSQVKIWKLNMENEKMG 239
           +V +  DL+I+   DS  + WK   E E  G
Sbjct: 628 SVLEDGDLIISADADSVFQFWKDCTEAEIQG 658

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 75/173 (43%), Gaps = 18/173 (10%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKL-NHDTTLE 529
           AH+  I ++ +  +     T S DKT K W+            D   P+  L NH   L 
Sbjct: 493 AHEKDINAISMAPNDSIFATASYDKTCKLWNV-----------DTGEPVATLANHKRGL- 540

Query: 530 LNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMII 589
                  V     ++++A    D TVK++ L+S     +L GH   V         K ++
Sbjct: 541 -----WDVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLV 595

Query: 590 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYW 642
           ++ AD  IK+W +  GDC K+L  H + I ++  L +     S   D+V ++W
Sbjct: 596 SAGADGLIKVWDIASGDCIKNLDGHSNRIWALSVLEDGDLIISADADSVFQFW 648

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 65/152 (42%), Gaps = 17/152 (11%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           +W++ TG+ V TL       A+  +G    + ++ E  +    +A    D  +K+W L S
Sbjct: 521 LWNVDTGEPVATL-------ANHKRGL--WDVSFCESEK---WIATCSGDKTVKIWSLES 568

Query: 111 KTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFW 170
            TVL    GH  A+    F +   +L+S   D  I VWD+     +  L  H + I    
Sbjct: 569 FTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIWALS 628

Query: 171 C-QGEDWLVSTSKDGLIKIWDLKTQQCIETHI 201
             +  D ++S   D + + W    + C E  I
Sbjct: 629 VLEDGDLIISADADSVFQFW----KDCTEAEI 656

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 77/158 (48%), Gaps = 16/158 (10%)

Query: 91  TNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQF-DSTGTRL-ISGSKDSNII-- 146
           + L+A+G  DG I V D+ +  +  +F GH   I+ ++F    GT + + GS D+N +  
Sbjct: 115 STLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGELGTNIWLLGSGDTNGMAK 174

Query: 147 VWDLVGEVGLYKLRSHKDAITGF-WCQGEDW----LVSTSKDGLIKIWDL----KTQQCI 197
           VWDLV     + ++ H  AI G  + + +D     L++  +D ++ +W      K+ + +
Sbjct: 175 VWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVLNLWRFNIKGKSSKLV 234

Query: 198 ETHIAHTG-ECWGLAVKDD--LLITTSTDSQVKIWKLN 232
           +T  AH   E  G    +D     T   D+  +I  LN
Sbjct: 235 KTIPAHLQIEACGFITHNDETFAYTAGGDAVFQIIDLN 272

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 57/117 (48%), Gaps = 4/117 (3%)

Query: 387 LQGQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALTCKFLPGGL 443
           L   +  +  +   +  K +AT S + ++KIW++++   ++T E        C F+    
Sbjct: 533 LANHKRGLWDVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQK 592

Query: 444 LVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
            ++     G ++++D+AS   +  + D H   IW+L +  DG  +++  AD   +FW
Sbjct: 593 QLVSAGADGLIKVWDIASGDCIKNL-DGHSNRIWALSVLEDGDLIISADADSVFQFW 648

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 70/343 (20%), Positives = 143/343 (41%), Gaps = 52/343 (15%)

Query: 387 LQGQRTDVRSIDVS--DDNKLLATASNGS---LKIWNV----KTHKCIRTFECGYAL-TC 436
           +Q   + +R ID +  DD  +L   + G    L +W      K+ K ++T      +  C
Sbjct: 187 VQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVLNLWRFNIKGKSSKLVKTIPAHLQIEAC 246

Query: 437 KFLPGGLLVILGTRSGE--LQLFDLASSSLLD-TIEDAHDAAIWSLDLTSDGKRLVTGSA 493
            F+         T  G+   Q+ DL  SS++  T +   +  I  +   + G +     +
Sbjct: 247 GFITHNDETFAYTAGGDAVFQIIDLNESSVVKCTKKPIEELFITGVIPINQGNQFYAVLS 306

Query: 494 DKTVKFWDFQVEKTLVPGTKDKFVPM---LKLNHDTTLEL-----NDDILSVRI-SPDDR 544
           D+T++      E   +  +K +F+ +   +  NH T  +L     N D +++   SP  R
Sbjct: 307 DQTIQLLQPNSE---IFSSKSEFIQIQEYIAGNHGTVADLCLVTKNKDCIALATNSPSLR 363

Query: 545 YLAISLLDNTVKVFFLDSMKFYLSLY-GHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603
            + +  +D   +      +   ++LY GH   + S+  + D + + T+S DK   +W  +
Sbjct: 364 IIPLPKIDADTQD---TDLPIEVNLYEGHSDLLNSLACTEDGQWLATASKDKTAILWHWN 420

Query: 604 FGD----CHKSLFAHQDSIMSVKFLPE--SHNF----FSCSKDAVVKYWDGEKFE----- 648
                   + +   H  S+ +V  LP     N+     + S D  VK W+    +     
Sbjct: 421 NTSKRFYIYATFVGHAASVSAV-CLPNVMEKNYPKYIITASNDLTVKKWEIPPMKNDLNE 479

Query: 649 -------CIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
                   I   +AH+ ++ A++++ + S   ++S+D + ++W
Sbjct: 480 VPFIVKSSIYTRHAHEKDINAISMAPNDSIFATASYDKTCKLW 522

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 4/69 (5%)

Query: 84  YLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQF----DSTGTRLISG 139
           Y E+  +  LL  G  +G+ KVWDLV++        H +AI  + F    D     LI+G
Sbjct: 154 YGELGTNIWLLGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITG 213

Query: 140 SKDSNIIVW 148
            +D+ + +W
Sbjct: 214 GRDNVLNLW 222

 Score = 32.0 bits (71), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 36/179 (20%), Positives = 70/179 (39%), Gaps = 9/179 (5%)

Query: 515 KFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKL 574
           + +P  KL H        +I  + ++PD +YL        VK+  +++     SL     
Sbjct: 46  QLIPNRKLLHSIDNADEQEITGISLTPDGKYLIYVSQSQLVKIVNVETGVITRSLKVSS- 104

Query: 575 PVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPE-SHNFF-- 631
           P   +     S ++     D +I +  ++ G    S   H  +I S+KF  E   N +  
Sbjct: 105 PSYVMTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGELGTNIWLL 164

Query: 632 -SCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIS----TDGSFVVSSSHDHSIRIWE 685
            S   + + K WD    +C   +  H S +  +  +     D   +++   D+ + +W 
Sbjct: 165 GSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVLNLWR 223

>TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8.435
           YLR222C
          Length = 835

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 105/238 (44%), Gaps = 10/238 (4%)

Query: 488 LVTGSADKTVKFWDFQVEKTLVPGTKDKF---VPMLKLNHDTTLELNDDILSVRISPDDR 544
           L+T S D TVK W        VP   D+F   +  +  +  T      DI  + ISP+D 
Sbjct: 471 LITASNDLTVKKWK-------VPKPTDRFDIEIYSISSSEYTRRAHEKDINMLSISPNDS 523

Query: 545 YLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDF 604
             A +  D T K++ L++ +   +L  HK  +  +      K I T+S DK +KIW LD 
Sbjct: 524 IFATASYDKTCKIWDLETGELKATLNNHKRGLWDVSFCQYDKFIATASGDKTVKIWSLDT 583

Query: 605 GDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALA 664
               K+L  H +++    F  +     S   D +VK WD    ECI  L  H + +WAL 
Sbjct: 584 FTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIWALN 643

Query: 665 ISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
           +  DG  V+++  D   + W++  ++             +   TL   +  G+  +AF
Sbjct: 644 VIKDGDIVITADADGVFQFWKDRTEEAREEDIEKEKLKVEQMQTLENYISSGDWTNAF 701

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 72/157 (45%), Gaps = 5/157 (3%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           L +  + ++ A    D   K+WDL +  +    N HK  +  + F      + + S D  
Sbjct: 516 LSISPNDSIFATASYDKTCKIWDLETGELKATLNNHKRGLWDVSFCQYDKFIATASGDKT 575

Query: 145 IIVWDLVGEVGLYKLRSHKDAI--TGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIA 202
           + +W L     +  L  H +A+    F+ + +  LVST  DGL+K+WD  T +CI T   
Sbjct: 576 VKIWSLDTFTVVKTLEGHSNAVQRCSFFNK-QKQLVSTGADGLVKLWDCSTGECINTLDG 634

Query: 203 HTGECWGL-AVKD-DLLITTSTDSQVKIWKLNMENEK 237
           H    W L  +KD D++IT   D   + WK   E  +
Sbjct: 635 HDNRIWALNVIKDGDIVITADADGVFQFWKDRTEEAR 671

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 58/107 (54%), Gaps = 4/107 (3%)

Query: 403 NKLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALTCKFLPGGLLVILGTRSGELQLFDL 459
           +K +ATAS + ++KIW++ T   ++T E        C F      ++     G ++L+D 
Sbjct: 564 DKFIATASGDKTVKIWSLDTFTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDC 623

Query: 460 ASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEK 506
           ++   ++T+ D HD  IW+L++  DG  ++T  AD   +FW  + E+
Sbjct: 624 STGECINTL-DGHDNRIWALNVIKDGDIVITADADGVFQFWKDRTEE 669

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 60/120 (50%), Gaps = 12/120 (10%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQF---DSTGTRLI-SGS 140
           LE    + LLA+G  DG + V D+ +  +  +  GH A I+ ++F     T T L+ SG 
Sbjct: 120 LETDPTSTLLAIGGTDGSVTVIDIENGYITHSLKGHGATISSLKFYGEQHTNTWLLSSGD 179

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQ------GED--WLVSTSKDGLIKIWDLK 192
            +  + +WDLV    ++ L+ H  A+ G   +       ED   L++ ++D +I  W+ K
Sbjct: 180 TNGMVKIWDLVSRKAIHTLQEHNSAVRGIDFKLIEKKNSEDSLQLITGARDDVINHWEFK 239

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 66/152 (43%), Gaps = 13/152 (8%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           IWD++TG+L  TL++    G  D      + C Y         +A    D  +K+W L +
Sbjct: 536 IWDLETGELKATLNNH-KRGLWDV-----SFCQY------DKFIATASGDKTVKIWSLDT 583

Query: 111 KTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGF- 169
            TV+    GH  A+    F +   +L+S   D  + +WD      +  L  H + I    
Sbjct: 584 FTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIWALN 643

Query: 170 WCQGEDWLVSTSKDGLIKIWDLKTQQCIETHI 201
             +  D +++   DG+ + W  +T++  E  I
Sbjct: 644 VIKDGDIVITADADGVFQFWKDRTEEAREEDI 675

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 70/169 (41%), Gaps = 15/169 (8%)

Query: 531 NDD---ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM 587
           NDD   I ++ ++PD +YL        +K+F L + K   S+     P   ++    S +
Sbjct: 70  NDDEQEITALALTPDAQYLCYVSQAQLLKIFKLSTGKIVKSMKISS-PSYVLETDPTSTL 128

Query: 588 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN----FFSCSKDAVVKYWD 643
           +     D ++ +  ++ G    SL  H  +I S+KF  E H       S   + +VK WD
Sbjct: 129 LAIGGTDGSVTVIDIENGYITHSLKGHGATISSLKFYGEQHTNTWLLSSGDTNGMVKIWD 188

Query: 644 GEKFECIQKLYAHQSEVWALAI-------STDGSFVVSSSHDHSIRIWE 685
               + I  L  H S V  +         S D   +++ + D  I  WE
Sbjct: 189 LVSRKAIHTLQEHNSAVRGIDFKLIEKKNSEDSLQLITGARDDVINHWE 237

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 7/74 (9%)

Query: 84  YLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQF-------DSTGTRL 136
           Y E H +T LL+ G  +G++K+WDLVS+  +     H +A+  + F            +L
Sbjct: 165 YGEQHTNTWLLSSGDTNGMVKIWDLVSRKAIHTLQEHNSAVRGIDFKLIEKKNSEDSLQL 224

Query: 137 ISGSKDSNIIVWDL 150
           I+G++D  I  W+ 
Sbjct: 225 ITGARDDVINHWEF 238

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 36/63 (57%), Gaps = 8/63 (12%)

Query: 448 GTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDL-------TSDGKRLVTGSADKTVKFW 500
           G  +G ++++DL S   + T+++ H++A+  +D        + D  +L+TG+ D  +  W
Sbjct: 178 GDTNGMVKIWDLVSRKAIHTLQE-HNSAVRGIDFKLIEKKNSEDSLQLITGARDDVINHW 236

Query: 501 DFQ 503
           +F+
Sbjct: 237 EFK 239

 Score = 33.1 bits (74), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 80/194 (41%), Gaps = 28/194 (14%)

Query: 461 SSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPML 520
           +S +L  IE+  +  I +L LT D + L   S  + +K +           +  K V  +
Sbjct: 61  ASQILHKIENDDEQEITALALTPDAQYLCYVSQAQLLKIFKL---------STGKIVKSM 111

Query: 521 KLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSID 580
           K++  + +        +   P    LAI   D +V V  +++     SL GH   + S+ 
Sbjct: 112 KISSPSYV--------LETDPTSTLLAIGGTDGSVTVIDIENGYITHSLKGHGATISSLK 163

Query: 581 ISFD--SKMIITSSADKN--IKIWGLDFGDCHKSLFAHQDSIMSVKF-LPESHN------ 629
              +  +   + SS D N  +KIW L       +L  H  ++  + F L E  N      
Sbjct: 164 FYGEQHTNTWLLSSGDTNGMVKIWDLVSRKAIHTLQEHNSAVRGIDFKLIEKKNSEDSLQ 223

Query: 630 FFSCSKDAVVKYWD 643
             + ++D V+ +W+
Sbjct: 224 LITGARDDVINHWE 237

>KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363
           YCR084C
          Length = 655

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 89/383 (23%), Positives = 161/383 (42%), Gaps = 77/383 (20%)

Query: 362 IEYYSIPYEKRDPT-------SPAPLKTHTIELQG---QRTDVRSIDVSDDNKLLATASN 411
           ++Y  +P   R  T       +PA  +T  +EL       + V  +  S+D + LAT  N
Sbjct: 276 LDYKQVPENLRKKTEEYDVLYNPALPRTLEVELHKSLEHTSVVCCVKFSNDGQYLATGCN 335

Query: 412 GSLKIWNVKTHKCIR--------TFECG-----------YALTCKFLPGGLLVILGTRSG 452
            + +++ V   + +         + + G           Y  +  F P G  +  G    
Sbjct: 336 KTTQVFRVSDGELVARLSDDNAPSIQNGGNGSDSGSTDLYIRSVCFSPDGKFLATGAEDR 395

Query: 453 ELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGT 512
            ++++DLA   ++  ++  HD  ++SLD    G +LV+GS D+TV+ WD +  +  +   
Sbjct: 396 LIRIWDLAQQKIVMVLQ-GHDQDVYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCSL--- 451

Query: 513 KDKFVPMLKLNHDTTLELNDDILSVRISP-DDRYLAISLLDNTVKV------FFLDSMKF 565
                         TL + D + +V +SP D +Y+A   LD  V+V      F ++ +  
Sbjct: 452 --------------TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDS 497

Query: 566 YLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL-------DFGD---------CH 608
              L  GH+  V S+  + D   +++SS D+++K+W L       +  D         C 
Sbjct: 498 ENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLRGYNEKENAADNNKSQSSVVCE 557

Query: 609 KSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTD 668
            +   H+D ++SV          S SKD  V +WD      +  L  H++ V ++A++  
Sbjct: 558 VTYIGHKDFVLSVTTTANDEFVLSGSKDRGVLFWDTNTGNPLLMLQGHRNSVISVAVANG 617

Query: 669 GSF------VVSSSHDHSIRIWE 685
                      + S D   RIW+
Sbjct: 618 HPLGPEYQVFATGSGDCRARIWK 640

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 95/214 (44%), Gaps = 19/214 (8%)

Query: 41  LITSALENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQ-----DTNLLA 95
           L T   +   ++ +  G+LV  LSD   P   +      +  T L +       D   LA
Sbjct: 330 LATGCNKTTQVFRVSDGELVARLSDDNAPSIQNGGNGSDSGSTDLYIRSVCFSPDGKFLA 389

Query: 96  VGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDL-VGEV 154
            G  D +I++WDL  + +++   GH   +  + +  +G +L+SGS D  + +WDL  G+ 
Sbjct: 390 TGAEDRLIRIWDLAQQKIVMVLQGHDQDVYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQC 449

Query: 155 GLYKLRSHKDAITGFWCQGED--WLVSTSKDGLIKIWDLKTQQCIET-------HIAHTG 205
            L    S +D +T       D  ++ + S D  +++WD +T   +E           H  
Sbjct: 450 SL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHRD 507

Query: 206 ECWGLAVKDD--LLITTSTDSQVKIWKLNMENEK 237
             + +    D   ++++S D  VK+W L   NEK
Sbjct: 508 SVYSVVFTRDGNKVVSSSLDRSVKLWNLRGYNEK 541

 Score = 32.7 bits (73), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 66/165 (40%), Gaps = 30/165 (18%)

Query: 49  VNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVH-QDTNLLAVGYADGVIKVWD 107
           V +WD +TG LV  L       + +  G+   +  Y  V  +D N +     D  +K+W+
Sbjct: 481 VRVWDSETGFLVERLD------SENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWN 534

Query: 108 L----------------VSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLV 151
           L                 S    + + GHK  +  +   +    ++SGSKD  ++ WD  
Sbjct: 535 LRGYNEKENAADNNKSQSSVVCEVTYIGHKDFVLSVTTTANDEFVLSGSKDRGVLFWDTN 594

Query: 152 GEVGLYKLRSHKDAITGFWCQ-----GEDWLV--STSKDGLIKIW 189
               L  L+ H++++           G ++ V  + S D   +IW
Sbjct: 595 TGNPLLMLQGHRNSVISVAVANGHPLGPEYQVFATGSGDCRARIW 639

>KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {ON}
           Anc_8.544 YBR198C
          Length = 817

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 133/295 (45%), Gaps = 40/295 (13%)

Query: 393 DVRSIDVSDDNKLLATASNGS-LKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRS 451
           D+ S++ SDD++L A     S +K+W++           G +L    +P         + 
Sbjct: 484 DMTSLEFSDDSRLAAAGFQDSYIKLWSLD----------GSSLISNKIPS-------YKR 526

Query: 452 GELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPG 511
            E++  D A+S+L+      H  +++S   + D + L++GS DKTV+ W       LV  
Sbjct: 527 KEMETTDPATSTLI-----GHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALV-- 579

Query: 512 TKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYG 571
                         +    N  +  V+ SP   Y A +  D T +++  D +       G
Sbjct: 580 --------------SYKGHNHPVWDVKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAG 625

Query: 572 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF 631
           H   V ++    +   + T S+DK  ++W +  GD  +  + H   I+S    P+     
Sbjct: 626 HLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWLC 685

Query: 632 SCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           + S D ++  WD    + I+++  H ++ V +L ++ +G+ ++S   DHS+R+W+
Sbjct: 686 TGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWD 740

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 74/174 (42%), Gaps = 19/174 (10%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYL-------------------SLYG 571
           N D+ S+  S D R  A    D+ +K++ LD                         +L G
Sbjct: 482 NRDMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDPATSTLIG 541

Query: 572 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF 631
           H   V S   S DS+ +++ S DK +++W LD      S   H   +  VKF P  H F 
Sbjct: 542 HSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGHYFA 601

Query: 632 SCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           + S D   + W  +    ++    H S+V  ++   +G +V + S D + R+W+
Sbjct: 602 TASHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWD 655

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 61/160 (38%), Gaps = 24/160 (15%)

Query: 94  LAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH + +  + F   G  + +GS D    +WD+   
Sbjct: 600 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDI--- 656

Query: 154 VGLYKLRSHKDAITGFWCQGED-----------WLVSTSKDGLIKIWDLKTQQCIETHIA 202
                  S  D++  FW                WL + S DGLI +WD+ T + I+    
Sbjct: 657 -------STGDSVRYFWVHTAPILSTVVTPDGRWLCTGSDDGLINLWDIGTGKRIKQMRG 709

Query: 203 HTGEC---WGLAVKDDLLITTSTDSQVKIWKLNMENEKMG 239
           H         L  + ++L++   D  V++W L     + G
Sbjct: 710 HGKNAVHSLTLNKEGNVLLSGGADHSVRVWDLKKATNEPG 749

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 71/151 (47%), Gaps = 5/151 (3%)

Query: 387 LQGQRTDVRSIDVSDDNKLLAT-ASNGSLKIWNVKTHKCIRTF--ECGYALTCKFLPGGL 443
             G  +DV ++    +   + T +S+ + ++W++ T   +R F       L+    P G 
Sbjct: 623 FAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGR 682

Query: 444 LVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQ 503
            +  G+  G + L+D+ +   +  +      A+ SL L  +G  L++G AD +V+ WD +
Sbjct: 683 WLCTGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDLK 742

Query: 504 VEKTLVPGTKDKFVPMLKLNHDTTLELNDDI 534
            + T  PG + +  P +    D T  +N D+
Sbjct: 743 -KATNEPGLEPE-QPFIGHIGDVTASINQDV 771

 Score = 45.1 bits (105), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 65/175 (37%), Gaps = 24/175 (13%)

Query: 81  ECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLN-------------------FNGHK 121
           + T LE   D+ L A G+ D  IK+W L   +++ N                     GH 
Sbjct: 484 DMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDPATSTLIGHS 543

Query: 122 AAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAI--TGFWCQGEDWLVS 179
            ++    F      L+SGS+D  + +W L     L   + H   +    F   G  +  +
Sbjct: 544 GSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGH-YFAT 602

Query: 180 TSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDD--LLITTSTDSQVKIWKLN 232
            S D   ++W       +     H  +   ++   +   + T S+D   ++W ++
Sbjct: 603 ASHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDIS 657

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 46/108 (42%), Gaps = 13/108 (12%)

Query: 44  SALENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVI 103
           S+ +   +WDI TGD V        P  S              V  D   L  G  DG+I
Sbjct: 646 SSDKTCRMWDISTGDSVRYFWVHTAPILSTV------------VTPDGRWLCTGSDDGLI 693

Query: 104 KVWDLVSKTVLLNFNGH-KAAITLMQFDSTGTRLISGSKDSNIIVWDL 150
            +WD+ +   +    GH K A+  +  +  G  L+SG  D ++ VWDL
Sbjct: 694 NLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDL 741

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 51/110 (46%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           +  H +   +  G +D   ++WD+ +   +  F  H A I        G  L +GS D  
Sbjct: 633 VSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWLCTGSDDGL 692

Query: 145 IIVWDLVGEVGLYKLRSH-KDAITGFWCQGE-DWLVSTSKDGLIKIWDLK 192
           I +WD+     + ++R H K+A+       E + L+S   D  +++WDLK
Sbjct: 693 INLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDLK 742

>YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}
           TUP1General repressor of transcription, forms complex
           with Cyc8p, involved in the establishment of repressive
           chromatin structure through interactions with histones
           H3 and H4, appears to enhance expression of some genes
          Length = 713

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 126/282 (44%), Gaps = 48/282 (17%)

Query: 432 YALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G     ++++D+ +  ++  I   H+  I+SLD    G +LV+G
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIV-MILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 492 SADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDD-RYLAISL 550
           S D+TV+ WD +  +  +                 TL + D + +V +SP D +Y+A   
Sbjct: 504 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 546

Query: 551 LDNTVKVFFLDSMKFYL---------SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWG 601
           LD  V+V+  DS   +L         S  GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 547 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWN 604

Query: 602 L------------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFEC 649
           L            + G C  +   H+D ++SV          S SKD  V +WD +    
Sbjct: 605 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 664

Query: 650 IQKLYAHQSEVWALAISTDGSF------VVSSSHDHSIRIWE 685
           +  L  H++ V ++A++             + S D   RIW+
Sbjct: 665 LLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 706

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 80/172 (46%), Gaps = 14/172 (8%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++WD+ ++ +++   GH+  I  + +  +G +L+SGS D  + +WD
Sbjct: 454 DGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 513

Query: 150 L-VGEVGLYKLRSHKDAITGFWCQGED--WLVSTSKDGLIKIWDLKTQQCI-------ET 199
           L  G+  L    S +D +T       D  ++ + S D  +++WD +T   +       E+
Sbjct: 514 LRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENES 571

Query: 200 HIAHTGECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEMGIFE 249
              H    + +    D   +++ S D  VK+W L   N K   K    G  E
Sbjct: 572 GTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCE 623

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 56/113 (49%), Gaps = 2/113 (1%)

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
           L + S+  S D K + T + D+ I+IW ++       L  H+  I S+ + P      S 
Sbjct: 444 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST-DGSFVVSSSHDHSIRIWE 685
           S D  V+ WD    +C   L + +  V  +A+S  DG ++ + S D ++R+W+
Sbjct: 504 SGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 555

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 98/238 (41%), Gaps = 56/238 (23%)

Query: 25  WIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLVTTLS--DGLPPGASDAKGSKPAEC 82
           + P+  +  +GSG           V IWD++TG    TLS  DG+   A       P + 
Sbjct: 493 YFPSGDKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGVTTVA-----VSPGDG 539

Query: 83  TYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLL---------NFNGHKAAITLMQFDSTG 133
            Y         +A G  D  ++VWD  S+T  L         +  GHK ++  + F   G
Sbjct: 540 KY---------IAAGSLDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDG 588

Query: 134 TRLISGSKDSNIIVWDL----------VGEVGLYKLR--SHKDAITGFW-CQGEDWLVST 180
             ++SGS D ++ +W+L              G  ++    HKD +      Q +++++S 
Sbjct: 589 QSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSG 648

Query: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKD--------DLLITTSTDSQVKIWK 230
           SKD  +  WD K+   +     H      +AV +        ++  T S D + +IWK
Sbjct: 649 SKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 706

>KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON}
           uniprot|P56094 Kluyveromyces lactis KLLA0F10263g TUP1
           Transcriptional repressor TUP1
          Length = 682

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 128/276 (46%), Gaps = 41/276 (14%)

Query: 432 YALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G     ++++DL +  ++ T++  H+  I+SLD    G +LV+G
Sbjct: 408 YIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLK-GHEQDIYSLDYFPSGNKLVSG 466

Query: 492 SADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISP-DDRYLAISL 550
           S D+TV+ WD      L  GT              TL + D + +V +SP + +++A   
Sbjct: 467 SGDRTVRIWD------LTTGT-----------CSLTLSIEDGVTTVAVSPGEGKFIAAGS 509

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603
           LD TV+V      F ++ +     L  GH+  V S+  + D K +++ S D+++K+W L+
Sbjct: 510 LDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLN 569

Query: 604 -------FGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH 656
                    +C  +   H+D ++SV          S SKD  V +WD +    +  L  H
Sbjct: 570 GLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGH 629

Query: 657 QSEVWALAISTD-------GSFVVSSSHDHSIRIWE 685
           ++ V ++ ++         G F   S  D   RIW+
Sbjct: 630 RNSVISVTVANGHPLGPEYGVFATGSG-DCKARIWK 664

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 71/273 (26%), Positives = 125/273 (45%), Gaps = 42/273 (15%)

Query: 394 VRSIDVSDDNKLLATASNGSL-KIWNVKTHKCIRTFECG----YALTCKFLPGGLLVILG 448
           +RS+  S D K LAT +   L +IW+++T K + T +      Y+L   + P G  ++ G
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSL--DYFPSGNKLVSG 466

Query: 449 TRSGELQLFDL--ASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD----F 502
           +    ++++DL   + SL  +IED       S     +GK +  GS D+TV+ WD    F
Sbjct: 467 SGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVS---PGEGKFIAAGSLDRTVRVWDSDTGF 523

Query: 503 QVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS 562
            VE+             L   ++      D + SV  + D + +    LD +VK++ L+ 
Sbjct: 524 LVER-------------LDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNG 570

Query: 563 M-------KFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQ 615
           +       +  ++  GHK  VLS+  + + + I++ S D+ +  W    G+    L  H+
Sbjct: 571 LSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHR 630

Query: 616 DSIMSVKFL------PESHNFFSCSKDAVVKYW 642
           +S++SV         PE   F + S D   + W
Sbjct: 631 NSVISVTVANGHPLGPEYGVFATGSGDCKARIW 663

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 69/153 (45%), Gaps = 10/153 (6%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++WDL +K +++   GH+  I  + +  +G +L+SGS D  + +WD
Sbjct: 417 DGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWD 476

Query: 150 LVGEVGLYKLRSHKDAITGFWCQGED-WLVSTSKDGLIKIWDLKTQQCIET-------HI 201
           L        L       T     GE  ++ + S D  +++WD  T   +E          
Sbjct: 477 LTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGT 536

Query: 202 AHTGECWGLAVKDD--LLITTSTDSQVKIWKLN 232
            H    + +    D   +++ S D  VK+W LN
Sbjct: 537 GHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLN 569

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 105/231 (45%), Gaps = 24/231 (10%)

Query: 385 IELQGQRTDVRSID-VSDDNKLLATASNGSLKIWNVKTHKCIRTFECGYALTCKFL-PG- 441
           + L+G   D+ S+D     NKL++ + + +++IW++ T  C  T      +T   + PG 
Sbjct: 442 MTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGE 501

Query: 442 GLLVILGTRSGELQLFDLASSSLLDTIED------AHDAAIWSLDLTSDGKRLVTGSADK 495
           G  +  G+    ++++D  +  L++ ++        H  +++S+  T DGK +V+GS D+
Sbjct: 502 GKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDR 561

Query: 496 TVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTV 555
           +VK W+       + G K      +     T     D +LSV  + +D Y+     D  V
Sbjct: 562 SVKLWNLNG----LSGQKSHAECEV-----TYTGHKDFVLSVATTQNDEYILSGSKDRGV 612

Query: 556 KVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM------IITSSADKNIKIW 600
             +   S    L L GH+  V+S+ ++    +        T S D   +IW
Sbjct: 613 LFWDTKSGNPLLMLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIW 663

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 57/113 (50%), Gaps = 2/113 (1%)

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
           L + S+  S D K + T + DK I+IW L+      +L  H+  I S+ + P  +   S 
Sbjct: 407 LYIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSG 466

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST-DGSFVVSSSHDHSIRIWE 685
           S D  V+ WD     C   L + +  V  +A+S  +G F+ + S D ++R+W+
Sbjct: 467 SGDRTVRIWDLTTGTCSLTL-SIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWD 518

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 88/210 (41%), Gaps = 31/210 (14%)

Query: 39  GQLITSALEN--VNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAV 96
           G+ + +  E+  + IWD++T  +V TL           KG +  +   L+     N L  
Sbjct: 418 GKFLATGAEDKLIRIWDLETKKIVMTL-----------KGHE-QDIYSLDYFPSGNKLVS 465

Query: 97  GYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGL 156
           G  D  +++WDL + T  L  +      T+      G  + +GS D  + VWD      +
Sbjct: 466 GSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLV 525

Query: 157 YKLRS-------HKDAI-TGFWCQGEDWLVSTSKDGLIKIWDLKT-------QQCIETHI 201
            +L S       H+D++ +  + +    +VS S D  +K+W+L          +C  T+ 
Sbjct: 526 ERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVTYT 585

Query: 202 AHTGECWGLAV--KDDLLITTSTDSQVKIW 229
            H      +A    D+ +++ S D  V  W
Sbjct: 586 GHKDFVLSVATTQNDEYILSGSKDRGVLFW 615

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 40/70 (57%)

Query: 618 IMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSH 677
           I SV F P+     + ++D +++ WD E  + +  L  H+ ++++L     G+ +VS S 
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSG 468

Query: 678 DHSIRIWEET 687
           D ++RIW+ T
Sbjct: 469 DRTVRIWDLT 478

 Score = 36.2 bits (82), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 59/140 (42%), Gaps = 16/140 (11%)

Query: 37  GPGQLITSAL--ENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVH-QDTNL 93
           G G+ I +      V +WD  TG LV  L       + +  G+   +  Y  V  +D   
Sbjct: 500 GEGKFIAAGSLDRTVRVWDSDTGFLVERLD------SENELGTGHRDSVYSVVFTRDGKG 553

Query: 94  LAVGYADGVIKVWDLVSKT-------VLLNFNGHKAAITLMQFDSTGTRLISGSKDSNII 146
           +  G  D  +K+W+L   +         + + GHK  +  +        ++SGSKD  ++
Sbjct: 554 VVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVL 613

Query: 147 VWDLVGEVGLYKLRSHKDAI 166
            WD      L  L+ H++++
Sbjct: 614 FWDTKSGNPLLMLQGHRNSV 633

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 126/282 (44%), Gaps = 45/282 (15%)

Query: 432 YALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G     ++++D+A   ++  ++  H+  I+SLD    G +LV+G
Sbjct: 464 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQ-GHEQDIYSLDYFPSGDKLVSG 522

Query: 492 SADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISP-DDRYLAISL 550
           S D+TV+ WD +  +  +                 TL + D + +V +SP D +Y+A   
Sbjct: 523 SGDRTVRIWDLRNGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 565

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603
           LD  V+V      F ++ +     L  GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 566 LDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLR 625

Query: 604 -----------FGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQK 652
                       G C  +   H+D ++SV          S SKD  V +WD +    +  
Sbjct: 626 GDNNQDVKPNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLM 685

Query: 653 LYAHQSEVWALAISTD-------GSFVVSSSHDHSIRIWEET 687
           L  H++ V ++A++         G F   S  D   RIW+ T
Sbjct: 686 LQGHRNSVISVAVANGFPLGPNVGVFATGSG-DCKARIWKYT 726

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 76/160 (47%), Gaps = 14/160 (8%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++WD+  K +++   GH+  I  + +  +G +L+SGS D  + +WD
Sbjct: 473 DGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 532

Query: 150 LV-GEVGLYKLRSHKDAITGFWCQGED--WLVSTSKDGLIKIWDLKTQQCIET------- 199
           L  G+  L    S +D +T       D  ++ + S D  +++WD +T   +E        
Sbjct: 533 LRNGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENEL 590

Query: 200 HIAHTGECWGLAVKDDL--LITTSTDSQVKIWKLNMENEK 237
              H    + +    D   +++ S D  VK+W L  +N +
Sbjct: 591 GTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGDNNQ 630

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 95/235 (40%), Gaps = 51/235 (21%)

Query: 25  WIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLVTTLS--DGLPPGASDAKGSKPAEC 82
           + P+  +  +GSG           V IWD++ G    TLS  DG+               
Sbjct: 512 YFPSGDKLVSGSG--------DRTVRIWDLRNGQCSLTLSIEDGV--------------T 549

Query: 83  TYLEVHQDTNLLAVGYADGVIKVWD-----LVSKTVLLN--FNGHKAAITLMQFDSTGTR 135
           T      D   +A G  D  ++VWD     LV +    N    GHK ++  + F   G  
Sbjct: 550 TVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNN 609

Query: 136 LISGSKDSNIIVWDLVGE---------VGLYKLR--SHKDAITGFWC-QGEDWLVSTSKD 183
           ++SGS D ++ +W+L G+          G  ++    HKD +      Q +++++S SKD
Sbjct: 610 VVSGSLDRSVKLWNLRGDNNQDVKPNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKD 669

Query: 184 GLIKIWDLKTQQCIETHIAHTGECWGLAVKD--------DLLITTSTDSQVKIWK 230
             +  WD K+   +     H      +AV +         +  T S D + +IWK
Sbjct: 670 RGVLFWDTKSGNPLLMLQGHRNSVISVAVANGFPLGPNVGVFATGSGDCKARIWK 724

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 96.7 bits (239), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 127/284 (44%), Gaps = 46/284 (16%)

Query: 432 YALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G     ++++D+A   ++  ++  H+  I+SLD    G +LV+G
Sbjct: 377 YIRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQ-GHEQDIYSLDYFPSGDKLVSG 435

Query: 492 SADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISP-DDRYLAISL 550
           S D+TV+ WD +  +  +                 TL + D + +V +SP D +++A   
Sbjct: 436 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKFIAAGS 478

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL- 602
           LD  V+V      F ++ +     L  GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 479 LDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLR 538

Query: 603 -----------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQ 651
                        G C  +   H+D ++SV          S SKD  V +WD +    + 
Sbjct: 539 GDKNNSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNPLL 598

Query: 652 KLYAHQSEVWALAISTD-------GSFVVSSSHDHSIRIWEETE 688
            L  H++ V ++A++         G F   S  D   RIW+ T+
Sbjct: 599 MLQGHRNSVISVAVANGFPLGPQYGVFATGSG-DCKARIWKYTK 641

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 73/154 (47%), Gaps = 14/154 (9%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++WD+  K +++   GH+  I  + +  +G +L+SGS D  + +WD
Sbjct: 386 DGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 445

Query: 150 L-VGEVGLYKLRSHKDAITGFWCQGED--WLVSTSKDGLIKIWDLKTQQCIET------- 199
           L  G+  L    S +D +T       D  ++ + S D  +++WD +T   +E        
Sbjct: 446 LRTGQCSL--TLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSENEL 503

Query: 200 HIAHTGECWGLAVKDD--LLITTSTDSQVKIWKL 231
              H    + +    D   +++ S D  VK+W L
Sbjct: 504 GTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNL 537

 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 58/253 (22%), Positives = 102/253 (40%), Gaps = 54/253 (21%)

Query: 25  WIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLVTTLS--DGLPPGASDAKGSKPAEC 82
           + P+  +  +GSG           V IWD++TG    TLS  DG+               
Sbjct: 425 YFPSGDKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGV--------------T 462

Query: 83  TYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFN-------GHKAAITLMQFDSTGTR 135
           T      D   +A G  D  ++VWD  +  ++   +       GHK ++  + F   G  
Sbjct: 463 TVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNG 522

Query: 136 LISGSKDSNIIVWDLVGE----------VGLYKL--RSHKDAITGFW-CQGEDWLVSTSK 182
           ++SGS D ++ +W+L G+           G  ++    HKD +      Q + +++S SK
Sbjct: 523 VVSGSLDRSVKLWNLRGDKNNSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSK 582

Query: 183 DGLIKIWDLKTQQCIETHIAHTGECWGLAVKD--------DLLITTSTDSQVKIWKLNME 234
           D  +  WD ++   +     H      +AV +         +  T S D + +IWK    
Sbjct: 583 DRGVLFWDTQSGNPLLMLQGHRNSVISVAVANGFPLGPQYGVFATGSGDCKARIWKYTKT 642

Query: 235 NEKM--GEKLTEM 245
           +  +  G K+ E+
Sbjct: 643 DAGIDSGSKIKEV 655

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/316 (24%), Positives = 138/316 (43%), Gaps = 48/316 (15%)

Query: 399 VSDDNKLLATASNGSLKIWNVKTHKCIRTFECG--YALTCKFLPGGLLVILGTRSGELQL 456
           +S+D     + ++ S    N K    + T      Y  +  F P G  +  G     +++
Sbjct: 437 LSEDASSAPSGADASATSENAKASPAVATSASSDLYIRSVCFSPDGKFLATGAEDKLIRI 496

Query: 457 FDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKF 516
           +DLA+  ++ T++  H+  I+SLD    G +LV+GS D+TV+ WD +  +  +       
Sbjct: 497 WDLATRRIVMTLQ-GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSL------- 548

Query: 517 VPMLKLNHDTTLELNDDILSVRISP-DDRYLAISLLDNTVKV------FFLDSMKFYLSL 569
                     TL + D + +V +SP D + +A   LD TV++      F ++ +     L
Sbjct: 549 ----------TLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENEL 598

Query: 570 -YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL------------DFGDCHKSLFAHQD 616
             GHK  V S+  + D   +++ S D+++K+W L            +      +   H+D
Sbjct: 599 GTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKD 658

Query: 617 SIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTD-------G 669
            ++SV          S SKD  V +WD      +  L  H++ V ++A++ D       G
Sbjct: 659 FVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYG 718

Query: 670 SFVVSSSHDHSIRIWE 685
            F   S  D   RIW+
Sbjct: 719 VFATGSG-DCKARIWK 733

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 100/229 (43%), Gaps = 31/229 (13%)

Query: 41  LITSALENVNIWDIKTGDLVTTLSD---GLPPGA-----SDAKGSKPAECT------YLE 86
           L T   +   ++ + TG+L+  LS+     P GA     S+   + PA  T      Y+ 
Sbjct: 415 LATGCNKTTQVYKVSTGELIARLSEDASSAPSGADASATSENAKASPAVATSASSDLYIR 474

Query: 87  ---VHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDS 143
                 D   LA G  D +I++WDL ++ +++   GH+  I  + +  +G +L+SGS D 
Sbjct: 475 SVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDR 534

Query: 144 NIIVWDL-VGEVGLYKLRSHKDAITGFWCQGED--WLVSTSKDGLIKIWDLKTQQCIET- 199
            + +WDL  G+  L    S +D +T       D   + + S D  ++IWD +T   +E  
Sbjct: 535 TVRIWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERL 592

Query: 200 ------HIAHTGECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGE 240
                    H    + +    D   +++ S D  VK+W L   N    E
Sbjct: 593 DSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAE 641

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 99/251 (39%), Gaps = 52/251 (20%)

Query: 25  WIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLVTTLS--DGLPPGASDAKGSKPAEC 82
           + P+  +  +GSG           V IWD++TG    TLS  DG+               
Sbjct: 520 YFPSGDKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGV--------------T 557

Query: 83  TYLEVHQDTNLLAVGYADGVIKVWD-----LVSKTVLLN--FNGHKAAITLMQFDSTGTR 135
           T      D  L+A G  D  +++WD     LV +    N    GHK ++  + F   G  
Sbjct: 558 TVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHG 617

Query: 136 LISGSKDSNIIVWDLVGEVG------------LYKLRSHKDAITGFW-CQGEDWLVSTSK 182
           ++SGS D ++ +W+L    G                  HKD +      Q +++++S SK
Sbjct: 618 VVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSK 677

Query: 183 DGLIKIWDLKTQQCIETHIAHTGECWGLAVKDD--------LLITTSTDSQVKIWKLNME 234
           D  +  WD  +   +     H      +AV +D        +  T S D + +IWK + +
Sbjct: 678 DRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWKYSKQ 737

Query: 235 NEKMGEKLTEM 245
                 KL E+
Sbjct: 738 TSNAEPKLREV 748

>Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON}
           YCR084C (REAL)
          Length = 713

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 125/282 (44%), Gaps = 48/282 (17%)

Query: 432 YALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G     ++++D+ +  ++  I   H+  I+SLD    G +LV+G
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIV-MILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 492 SADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDD-RYLAISL 550
           S D+TV+ WD +  +  +                 TL + D + +V +SP D +Y+A   
Sbjct: 504 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 546

Query: 551 LDNTVKVFFLDSMKFYL---------SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWG 601
           LD  V+V+  DS   +L         S  GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 547 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWN 604

Query: 602 L------------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFEC 649
           L            + G C  +   H+D ++SV          S SKD  V +WD      
Sbjct: 605 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKTSGNP 664

Query: 650 IQKLYAHQSEVWALAISTDGSF------VVSSSHDHSIRIWE 685
           +  L  H++ V ++A++             + S D   RIW+
Sbjct: 665 LLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 706

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 80/172 (46%), Gaps = 14/172 (8%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++WD+ ++ +++   GH+  I  + +  +G +L+SGS D  + +WD
Sbjct: 454 DGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 513

Query: 150 L-VGEVGLYKLRSHKDAITGFWCQGED--WLVSTSKDGLIKIWDLKTQQCI-------ET 199
           L  G+  L    S +D +T       D  ++ + S D  +++WD +T   +       E+
Sbjct: 514 LRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENES 571

Query: 200 HIAHTGECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEMGIFE 249
              H    + +    D   +++ S D  VK+W L   N K   K    G  E
Sbjct: 572 GTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCE 623

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 107/229 (46%), Gaps = 19/229 (8%)

Query: 387 LQGQRTDVRSID-VSDDNKLLATASNGSLKIWNVKTHKCIRTFECGYALTCKFL-PG-GL 443
           LQG   D+ S+D     +KL++ + + +++IW+++T +C  T      +T   + PG G 
Sbjct: 481 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK 540

Query: 444 LVILGTRSGELQLFDLASSSLLDTIED------AHDAAIWSLDLTSDGKRLVTGSADKTV 497
            +  G+    ++++D  +  L++ ++        H  +++S+  T DG+ +V+GS D++V
Sbjct: 541 YIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSV 600

Query: 498 KFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKV 557
           K W+ Q          D   P       T +   D +LSV  + +D Y+     D  V  
Sbjct: 601 KLWNLQNANN----KSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLF 656

Query: 558 FFLDSMKFYLSLYGHKLPVLSIDISFDSKM------IITSSADKNIKIW 600
           +   S    L L GH+  V+S+ ++  S +        T S D   +IW
Sbjct: 657 WDKTSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 56/113 (49%), Gaps = 2/113 (1%)

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
           L + S+  S D K + T + D+ I+IW ++       L  H+  I S+ + P      S 
Sbjct: 444 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST-DGSFVVSSSHDHSIRIWE 685
           S D  V+ WD    +C   L + +  V  +A+S  DG ++ + S D ++R+W+
Sbjct: 504 SGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 555

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 97/238 (40%), Gaps = 56/238 (23%)

Query: 25  WIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLVTTLS--DGLPPGASDAKGSKPAEC 82
           + P+  +  +GSG           V IWD++TG    TLS  DG+   A       P + 
Sbjct: 493 YFPSGDKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGVTTVA-----VSPGDG 539

Query: 83  TYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLL---------NFNGHKAAITLMQFDSTG 133
            Y         +A G  D  ++VWD  S+T  L         +  GHK ++  + F   G
Sbjct: 540 KY---------IAAGSLDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDG 588

Query: 134 TRLISGSKDSNIIVWDL----------VGEVGLYKLR--SHKDAITGFW-CQGEDWLVST 180
             ++SGS D ++ +W+L              G  ++    HKD +      Q +++++S 
Sbjct: 589 QSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSG 648

Query: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKD--------DLLITTSTDSQVKIWK 230
           SKD  +  WD  +   +     H      +AV +        ++  T S D + +IWK
Sbjct: 649 SKDRGVLFWDKTSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 706

>Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON}
           YCR084C (REAL)
          Length = 709

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 124/282 (43%), Gaps = 48/282 (17%)

Query: 432 YALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G     ++++D+    ++  I   H+  I+SLD    G +LV+G
Sbjct: 441 YIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIV-MILQGHEQDIYSLDYFPSGDKLVSG 499

Query: 492 SADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISP-DDRYLAISL 550
           S D+TV+ WD +  +  +                 TL + D + +V +SP D +Y+A   
Sbjct: 500 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 542

Query: 551 LDNTVKVFFLDSMKFYL---------SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWG 601
           LD  V+V+  DS   +L         S  GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 543 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWN 600

Query: 602 L------------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFEC 649
           L            + G C  +   H+D ++SV          S SKD  V +WD +    
Sbjct: 601 LQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 660

Query: 650 IQKLYAHQSEVWALAISTDGSF------VVSSSHDHSIRIWE 685
           +  L  H++ V ++A++             + S D   RIW+
Sbjct: 661 LLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 702

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 79/172 (45%), Gaps = 14/172 (8%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++WD+  + +++   GH+  I  + +  +G +L+SGS D  + +WD
Sbjct: 450 DGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 509

Query: 150 L-VGEVGLYKLRSHKDAITGFWCQGED--WLVSTSKDGLIKIWDLKTQQCI-------ET 199
           L  G+  L    S +D +T       D  ++ + S D  +++WD +T   +       E+
Sbjct: 510 LRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENES 567

Query: 200 HIAHTGECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEMGIFE 249
              H    + +    D   +++ S D  VK+W L   N K   K    G  E
Sbjct: 568 GTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNANNKSDSKAPNSGTCE 619

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 124/283 (43%), Gaps = 47/283 (16%)

Query: 394 VRSIDVSDDNKLLATASNGSL-KIWNVKTHKCIRTFECG----YALTCKFLPGGLLVILG 448
           +RS+  S D K LAT +   L +IW+++  K +   +      Y+L   + P G  ++ G
Sbjct: 442 IRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSL--DYFPSGDKLVSG 499

Query: 449 TRSGELQLFDLASS--SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD----F 502
           +    ++++DL +   SL  +IED       S     DGK +  GS D+ V+ WD    F
Sbjct: 500 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVS---PGDGKYIAAGSLDRAVRVWDSETGF 556

Query: 503 QVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFL-- 560
            VE+             L   +++     D + SV  + D   +    LD +VK++ L  
Sbjct: 557 LVER-------------LDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQN 603

Query: 561 ----------DSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKS 610
                     +S    ++  GHK  VLS+  + + + I++ S D+ +  W    G+    
Sbjct: 604 ANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLM 663

Query: 611 LFAHQDSIMSVKFL------PESHNFFSCSKDAVVKYWDGEKF 647
           L  H++S++SV         PE + F + S D   + W  +K 
Sbjct: 664 LQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYKKI 706

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 56/113 (49%), Gaps = 2/113 (1%)

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
           L + S+  S D K + T + D+ I+IW ++       L  H+  I S+ + P      S 
Sbjct: 440 LYIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPSGDKLVSG 499

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST-DGSFVVSSSHDHSIRIWE 685
           S D  V+ WD    +C   L + +  V  +A+S  DG ++ + S D ++R+W+
Sbjct: 500 SGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 551

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 98/238 (41%), Gaps = 56/238 (23%)

Query: 25  WIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLVTTLS--DGLPPGASDAKGSKPAEC 82
           + P+  +  +GSG           V IWD++TG    TLS  DG+   A       P + 
Sbjct: 489 YFPSGDKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGVTTVA-----VSPGDG 535

Query: 83  TYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLL---------NFNGHKAAITLMQFDSTG 133
            Y         +A G  D  ++VWD  S+T  L         +  GHK ++  + F   G
Sbjct: 536 KY---------IAAGSLDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDG 584

Query: 134 TRLISGSKDSNIIVWDL----------VGEVGLYKLR--SHKDAITGFW-CQGEDWLVST 180
             ++SGS D ++ +W+L              G  ++    HKD +      Q +++++S 
Sbjct: 585 HSVVSGSLDRSVKLWNLQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSG 644

Query: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKD--------DLLITTSTDSQVKIWK 230
           SKD  +  WD K+   +     H      +AV +        ++  T S D + +IWK
Sbjct: 645 SKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 702

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 69/287 (24%), Positives = 132/287 (45%), Gaps = 45/287 (15%)

Query: 432 YALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G     ++++DL++  ++ T++  H+  I+SLD    G +LV+G
Sbjct: 380 YIRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQ-GHEQDIYSLDYFPSGDKLVSG 438

Query: 492 SADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISP-DDRYLAISL 550
           S D+TV+ WD +  +  +                 TL + D + +V +SP + +++A   
Sbjct: 439 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGEGKFIAAGS 481

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603
           LD T++V      F ++ +     L  GHK  V S+  + D + +++ S D+++K+W L 
Sbjct: 482 LDRTLRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLH 541

Query: 604 -------------FGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
                           C  +   H+D ++SV          S SKD  V +WD +    +
Sbjct: 542 NTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGNPL 601

Query: 651 QKLYAHQSEVWALAIST------DGSFVVSSSHDHSIRIWEETEDQV 691
             L  H++ V ++A++       D     + S D   RIW+ ++++ 
Sbjct: 602 LMLQGHRNSVISVAVANGFPLGPDYGVFATGSGDCKARIWKYSKNKA 648

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 122/279 (43%), Gaps = 48/279 (17%)

Query: 394 VRSIDVSDDNKLLATASNGSL-KIWNVKTHKCIRTFECG----YALTCKFLPGGLLVILG 448
           +RS+  S D K LAT +   L +IW++ T + + T +      Y+L   + P G  ++ G
Sbjct: 381 IRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQGHEQDIYSL--DYFPSGDKLVSG 438

Query: 449 TRSGELQLFDLASS--SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD----F 502
           +    ++++DL +   SL  +IED       S     +GK +  GS D+T++ WD    F
Sbjct: 439 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVS---PGEGKFIAAGSLDRTLRVWDSETGF 495

Query: 503 QVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLD- 561
            VE+             L   ++      D + SV  + D + +    LD +VK++ L  
Sbjct: 496 LVER-------------LDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLHN 542

Query: 562 ------------SMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK 609
                       +    ++  GHK  VLS+  + + K I++ S D+ +  W    G+   
Sbjct: 543 TGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGNPLL 602

Query: 610 SLFAHQDSIMSVKFL------PESHNFFSCSKDAVVKYW 642
            L  H++S++SV         P+   F + S D   + W
Sbjct: 603 MLQGHRNSVISVAVANGFPLGPDYGVFATGSGDCKARIW 641

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 76/155 (49%), Gaps = 14/155 (9%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++WDL +K +++   GH+  I  + +  +G +L+SGS D  + +WD
Sbjct: 389 DGKFLATGAEDKLIRIWDLSTKRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 448

Query: 150 L-VGEVGLYKLRSHKDAITGFWCQ-GE-DWLVSTSKDGLIKIWDLKTQQCIET------- 199
           L  G+  L    S +D +T      GE  ++ + S D  +++WD +T   +E        
Sbjct: 449 LRTGQCSL--TLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWDSETGFLVERLDSENEL 506

Query: 200 HIAHTGECWGLAVKDD--LLITTSTDSQVKIWKLN 232
              H    + +    D   +++ S D  VK+W L+
Sbjct: 507 GTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLH 541

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 95/247 (38%), Gaps = 53/247 (21%)

Query: 25  WIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLVTTLS--DGLPPGASDAKGSKPAEC 82
           + P+  +  +GSG           V IWD++TG    TLS  DG+           P E 
Sbjct: 428 YFPSGDKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGV-----TTVAVSPGEG 474

Query: 83  TYLEVHQDTNLLAVGYADGVIKVWD-----LVSKTVLLN--FNGHKAAITLMQFDSTGTR 135
            +         +A G  D  ++VWD     LV +    N    GHK ++  + F   G  
Sbjct: 475 KF---------IAAGSLDRTLRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQG 525

Query: 136 LISGSKDSNIIVWDLVGEVGLYKLRS-------------HKDAITGFW-CQGEDWLVSTS 181
           ++SGS D ++ +W+L       K  S             HKD +      Q + +++S S
Sbjct: 526 VVSGSLDRSVKLWNLHNTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGS 585

Query: 182 KDGLIKIWDLKTQQCIETHIAHTGECWGLAVKD--------DLLITTSTDSQVKIWKLNM 233
           KD  +  WD ++   +     H      +AV +         +  T S D + +IWK + 
Sbjct: 586 KDRGVLFWDTQSGNPLLMLQGHRNSVISVAVANGFPLGPDYGVFATGSGDCKARIWKYSK 645

Query: 234 ENEKMGE 240
                 E
Sbjct: 646 NKANASE 652

>AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR198C
           (TAF5)
          Length = 815

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 130/294 (44%), Gaps = 34/294 (11%)

Query: 410 SNGSLKIWNVKTHK---CIRTFE-CGYALTC-KFLPGGLLVILGTRSGELQLFDLAS--- 461
           S  ++K+ N++T     C+ TF      +TC +F     LV  G +   ++L+ L     
Sbjct: 462 SRDAIKMDNLQTSAPSVCMYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPL 521

Query: 462 -SSLLDTIEDA--------HDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGT 512
            S L    +DA        H   ++S+  + D + LV+ S DKTV+ W       LV   
Sbjct: 522 ESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLV--- 578

Query: 513 KDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGH 572
                        +    N  +  V+ SP   Y A    D T +++  D +       GH
Sbjct: 579 -------------SYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDHIYPLRIFAGH 625

Query: 573 KLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFS 632
              V  +    +   ++T S+DK  ++W +  GD  +    H  S++SV   P+     +
Sbjct: 626 LNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTT 685

Query: 633 CSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
            S+D V+  WD    + I+++  H +S V++L+ + +G+ +VS   D S+R+W+
Sbjct: 686 GSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWD 739

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 85/175 (48%), Gaps = 14/175 (8%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKF-------------YLSLYGHKLPVL 577
           N ++  +R S D R +A    D+ +K++ LD                  ++L GH  PV 
Sbjct: 487 NREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGPVY 546

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDA 637
           S+  S D++ ++++S DK +++W LD   C  S   H   +  VKF P  H F + S D 
Sbjct: 547 SVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQ 606

Query: 638 VVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE-ETEDQV 691
             + W  +    ++    H ++V  +    +G++V++ S D + R+W+ +T D V
Sbjct: 607 TARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSV 661

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 115/240 (47%), Gaps = 24/240 (10%)

Query: 368 PYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIR 426
           P E + P S A   ++T+ L G    V S+  S DN+ L +AS + ++++W++ T+ C+ 
Sbjct: 520 PLESQLP-SKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLV 578

Query: 427 TFECGYALTC---KFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTS 483
           +++ G+       KF P G     G+     +L+       L  I   H   +  +    
Sbjct: 579 SYK-GHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDHIYPL-RIFAGHLNDVDCVTFHP 636

Query: 484 DGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDD 543
           +G  ++TGS+DKT + WD Q   ++           L L H  +      ++SV +SPD 
Sbjct: 637 NGTYVLTGSSDKTCRMWDIQTGDSV----------RLFLGHTAS------VVSVAVSPDG 680

Query: 544 RYLAISLLDNTVKVFFLDSMKFYLSLYGH-KLPVLSIDISFDSKMIITSSADKNIKIWGL 602
           R+L     D  + V+ + + K    + GH K  V S+  + +  ++++  AD+++++W L
Sbjct: 681 RWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDL 740

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 63/142 (44%), Gaps = 4/142 (2%)

Query: 94  LAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGE 153
            A G  D   ++W       L  F GH   +  + F   GT +++GS D    +WD+   
Sbjct: 599 FATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTG 658

Query: 154 VGLYKLRSHKDAITGFWCQGED-WLVSTSKDGLIKIWDLKTQQCIETHIAH-TGECWGLA 211
             +     H  ++       +  WL + S+DG+I +WD+ T + I+    H     + L+
Sbjct: 659 DSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLS 718

Query: 212 V--KDDLLITTSTDSQVKIWKL 231
              + ++L++   D  V++W L
Sbjct: 719 FNKEGNILVSGGADQSVRVWDL 740

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 2/107 (1%)

Query: 88  HQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIV 147
           H +   +  G +D   ++WD+ +   +  F GH A++  +     G  L +GS+D  IIV
Sbjct: 635 HPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIV 694

Query: 148 WDLVGEVGLYKLRSH-KDAITGFWCQGE-DWLVSTSKDGLIKIWDLK 192
           WD+     + ++R H K A+       E + LVS   D  +++WDLK
Sbjct: 695 WDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLK 741

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 77/196 (39%), Gaps = 19/196 (9%)

Query: 61  TTLSDGLPPGASDAKGS-----KPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLL 115
           T L   LP  A DA  +            +    D   L     D  +++W L + T L+
Sbjct: 519 TPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLV 578

Query: 116 NFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWC---- 171
           ++ GH   +  ++F   G    +GS D    +W       +Y LR     +    C    
Sbjct: 579 SYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSC---DHIYPLRIFAGHLNDVDCVTFH 635

Query: 172 QGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDD--LLITTSTDSQVKIW 229
               ++++ S D   ++WD++T   +   + HT     +AV  D   L T S D  + +W
Sbjct: 636 PNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVW 695

Query: 230 KLNMENEKMGEKLTEM 245
            +       G+++ +M
Sbjct: 696 DIG-----TGKRIKQM 706

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 50/111 (45%), Gaps = 13/111 (11%)

Query: 41  LITSALENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYAD 100
           L  S+ +   +WDI+TGD V                   A    + V  D   L  G  D
Sbjct: 642 LTGSSDKTCRMWDIQTGDSVRLFL------------GHTASVVSVAVSPDGRWLTTGSED 689

Query: 101 GVIKVWDLVSKTVLLNFNGH-KAAITLMQFDSTGTRLISGSKDSNIIVWDL 150
           GVI VWD+ +   +    GH K+A+  + F+  G  L+SG  D ++ VWDL
Sbjct: 690 GVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDL 740

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 57/111 (51%), Gaps = 5/111 (4%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTF--ECGYALTCKFLPGGLLVILGTRSGELQLFDLASS 462
           +L  +S+ + ++W+++T   +R F       ++    P G  +  G+  G + ++D+ + 
Sbjct: 641 VLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTG 700

Query: 463 SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD---FQVEKTLVP 510
             +  +     +A++SL    +G  LV+G AD++V+ WD   F  E +L P
Sbjct: 701 KRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLKKFTNEPSLEP 751

 Score = 40.0 bits (92), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 52/132 (39%), Gaps = 16/132 (12%)

Query: 114 LLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSH-KDAITGFWCQ 172
           +  F+     +T ++F      + +G +DS I +W L G     +L S  KDA       
Sbjct: 480 MYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLI 539

Query: 173 GED-------------WLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKD--DLL 217
           G               +LVS S+D  +++W L T  C+ ++  H    W +         
Sbjct: 540 GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYF 599

Query: 218 ITTSTDSQVKIW 229
            T S D   ++W
Sbjct: 600 ATGSHDQTARLW 611

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 80/315 (25%), Positives = 135/315 (42%), Gaps = 83/315 (26%)

Query: 394 VRSIDVSDDNKLLATASNGSL-KIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRSG 452
           +RSI  S D + LAT +   L +IWN+K  K +                  +V+ G    
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWNIKERKIV------------------MVLKG---- 381

Query: 453 ELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGT 512
                              H+  I+SLD   DG++LV+GS D++++ WD +  +  +   
Sbjct: 382 -------------------HEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLKTGQCSL--- 419

Query: 513 KDKFVPMLKLNHDTTLELNDDILSVRISPDD-RYLAISLLDNTVKVFFLDSMKFYL---- 567
                         TL + D + +V +SP++ + +A   LD +V+++  DS   +L    
Sbjct: 420 --------------TLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIW--DSSTGFLVERL 463

Query: 568 -----SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD-----FGDCHKSLFAHQDS 617
                S  GH+  V S+  + D + +++ S D+ +K+W L       G C  +   H+D 
Sbjct: 464 DSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDF 523

Query: 618 IMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST----DG---S 670
           ++SV    +    FS SKD  V  WD +    I  L  H++ V ++A       DG    
Sbjct: 524 VLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGHRNSVISVATVNSNVDDGKNYK 583

Query: 671 FVVSSSHDHSIRIWE 685
              + S D   RIW+
Sbjct: 584 LFATGSGDCKARIWK 598

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 108/235 (45%), Gaps = 31/235 (13%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLEL 530
            HD+ +  +  + DGK L TG  ++T + +D          T + +V +L    +T +  
Sbjct: 277 PHDSVVCCVKFSQDGKYLATG-CNRTTQIFDV--------ATGELYVKLLDDTVNTAIVT 327

Query: 531 NDD-------------ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVL 577
                           I S+  SPD  +LA    D  ++++ +   K  + L GH+  + 
Sbjct: 328 TTTENNETVTTTADLYIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIY 387

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC-SKD 636
           S+D   D + +++ S D++I+IW L  G C  +L + +D + +V   P      +  S D
Sbjct: 388 SLDYFPDGQKLVSGSGDRSIRIWDLKTGQCSLTL-SIEDGVTTVAVSPNEGKLIAAGSLD 446

Query: 637 AVVKYWDGEKFECIQKL-------YAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
             V+ WD      +++L         HQ  V+++A + DG  VVS S D ++++W
Sbjct: 447 RSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLW 501

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 73/154 (47%), Gaps = 14/154 (9%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++W++  + +++   GH+  I  + +   G +L+SGS D +I +WD
Sbjct: 352 DGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWD 411

Query: 150 L-VGEVGLYKLRSHKDAITGFWCQGED--WLVSTSKDGLIKIWDLKTQQCI-------ET 199
           L  G+  L    S +D +T       +   + + S D  ++IWD  T   +       E+
Sbjct: 412 LKTGQCSL--TLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNES 469

Query: 200 HIAHTGECWGLAVKDD--LLITTSTDSQVKIWKL 231
              H    + +A   D   +++ S D  VK+W L
Sbjct: 470 GNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNL 503

 Score = 57.8 bits (138), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 81/188 (43%), Gaps = 30/188 (15%)

Query: 522 LNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHK-------- 573
           L HD+       +  V+ S D +YLA    + T ++F + + + Y+ L            
Sbjct: 276 LPHDSV------VCCVKFSQDGKYLATGC-NRTTQIFDVATGELYVKLLDDTVNTAIVTT 328

Query: 574 -------------LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMS 620
                        L + SI  S D + + T + DK I+IW +        L  H+  I S
Sbjct: 329 TTENNETVTTTADLYIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYS 388

Query: 621 VKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIS-TDGSFVVSSSHDH 679
           + + P+     S S D  ++ WD +  +C   L + +  V  +A+S  +G  + + S D 
Sbjct: 389 LDYFPDGQKLVSGSGDRSIRIWDLKTGQCSLTL-SIEDGVTTVAVSPNEGKLIAAGSLDR 447

Query: 680 SIRIWEET 687
           S+RIW+ +
Sbjct: 448 SVRIWDSS 455

 Score = 39.3 bits (90), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 61/136 (44%), Gaps = 14/136 (10%)

Query: 39  GQLITSAL--ENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTY-LEVHQDTNLLA 95
           G+LI +     +V IWD  TG LV  L       + +  G+   +  Y +   +D   + 
Sbjct: 437 GKLIAAGSLDRSVRIWDSSTGFLVERLD------SDNESGNGHQDSVYSVAFTKDGQHVV 490

Query: 96  VGYADGVIKVWDLV-----SKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDL 150
            G  D  +K+W+L      +    + + GHK  +  +   +    + SGSKD  +I+WD 
Sbjct: 491 SGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDK 550

Query: 151 VGEVGLYKLRSHKDAI 166
                +  L+ H++++
Sbjct: 551 DSGNPILMLQGHRNSV 566

>Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON}
           YCR084C (REAL)
          Length = 700

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 119/257 (46%), Gaps = 42/257 (16%)

Query: 432 YALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G     ++++D+ +  ++  I   H+  I+SLD    G +LV+G
Sbjct: 449 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIV-MILQGHEQDIYSLDYFPSGDKLVSG 507

Query: 492 SADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISP-DDRYLAISL 550
           S D+TV+ WD +  +  +                 TL + D + +V +SP D +Y+A   
Sbjct: 508 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 550

Query: 551 LDNTVKVFFLDSMKFYL---------SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWG 601
           LD  V+V+  DS   +L         S  GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 551 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWN 608

Query: 602 L------------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFEC 649
           L            + G C  +   H+D ++SV          S SKD  V +WD +    
Sbjct: 609 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 668

Query: 650 IQKLYAHQSEVWALAIS 666
           +  L  H++ V ++A++
Sbjct: 669 LLMLQGHRNSVISVAVA 685

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 82/159 (51%), Gaps = 9/159 (5%)

Query: 534 ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSA 593
           I SV  SPD ++LA    D  ++++ +++ K  + L GH+  + S+D       +++ S 
Sbjct: 450 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 509

Query: 594 DKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC-SKDAVVKYWDGEKFECIQK 652
           D+ ++IW L  G C  +L + +D + +V   P    + +  S D  V+ WD E    +++
Sbjct: 510 DRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVER 568

Query: 653 L-------YAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
           L         H+  V+++  + DG  VVS S D S+++W
Sbjct: 569 LDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLW 607

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 80/172 (46%), Gaps = 14/172 (8%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++WD+ ++ +++   GH+  I  + +  +G +L+SGS D  + +WD
Sbjct: 458 DGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 517

Query: 150 L-VGEVGLYKLRSHKDAITGFWCQGED--WLVSTSKDGLIKIWDLKTQQCI-------ET 199
           L  G+  L    S +D +T       D  ++ + S D  +++WD +T   +       E+
Sbjct: 518 LRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENES 575

Query: 200 HIAHTGECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEMGIFE 249
              H    + +    D   +++ S D  VK+W L   N K   K    G  E
Sbjct: 576 GTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCE 627

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 101/210 (48%), Gaps = 13/210 (6%)

Query: 387 LQGQRTDVRSID-VSDDNKLLATASNGSLKIWNVKTHKCIRTFECGYALTCKFL-PG-GL 443
           LQG   D+ S+D     +KL++ + + +++IW+++T +C  T      +T   + PG G 
Sbjct: 485 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK 544

Query: 444 LVILGTRSGELQLFDLASSSLLDTIED------AHDAAIWSLDLTSDGKRLVTGSADKTV 497
            +  G+    ++++D  +  L++ ++        H  +++S+  T DG+ +V+GS D++V
Sbjct: 545 YIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSV 604

Query: 498 KFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKV 557
           K W+ Q          D   P       T +   D +LSV  + +D Y+     D  V  
Sbjct: 605 KLWNLQNANN----KSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLF 660

Query: 558 FFLDSMKFYLSLYGHKLPVLSIDISFDSKM 587
           +   S    L L GH+  V+S+ ++  S +
Sbjct: 661 WDKKSGNPLLMLQGHRNSVISVAVANGSPL 690

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 113/251 (45%), Gaps = 41/251 (16%)

Query: 394 VRSIDVSDDNKLLATASNGSL-KIWNVKTHKCIRTFECG----YALTCKFLPGGLLVILG 448
           +RS+  S D K LAT +   L +IW+++  K +   +      Y+L   + P G  ++ G
Sbjct: 450 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSL--DYFPSGDKLVSG 507

Query: 449 TRSGELQLFDLASS--SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD----F 502
           +    ++++DL +   SL  +IED       S     DGK +  GS D+ V+ WD    F
Sbjct: 508 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVS---PGDGKYIAAGSLDRAVRVWDSETGF 564

Query: 503 QVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFL-- 560
            VE+             L   +++     D + SV  + D   +    LD +VK++ L  
Sbjct: 565 LVER-------------LDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWNLQN 611

Query: 561 ----------DSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKS 610
                     +S    ++  GHK  VLS+  + + + I++ S D+ +  W    G+    
Sbjct: 612 ANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLM 671

Query: 611 LFAHQDSIMSV 621
           L  H++S++SV
Sbjct: 672 LQGHRNSVISV 682

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 56/113 (49%), Gaps = 2/113 (1%)

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
           L + S+  S D K + T + D+ I+IW ++       L  H+  I S+ + P      S 
Sbjct: 448 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 507

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST-DGSFVVSSSHDHSIRIWE 685
           S D  V+ WD    +C   L + +  V  +A+S  DG ++ + S D ++R+W+
Sbjct: 508 SGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 559

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 88/214 (41%), Gaps = 48/214 (22%)

Query: 25  WIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLVTTLS--DGLPPGASDAKGSKPAEC 82
           + P+  +  +GSG           V IWD++TG    TLS  DG+   A       P + 
Sbjct: 497 YFPSGDKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGVTTVA-----VSPGDG 543

Query: 83  TYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLL---------NFNGHKAAITLMQFDSTG 133
            Y         +A G  D  ++VWD  S+T  L         +  GHK ++  + F   G
Sbjct: 544 KY---------IAAGSLDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDG 592

Query: 134 TRLISGSKDSNIIVWDL----------VGEVGLYKLR--SHKDAITGFW-CQGEDWLVST 180
             ++SGS D ++ +W+L              G  ++    HKD +      Q +++++S 
Sbjct: 593 ESVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSG 652

Query: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKD 214
           SKD  +  WD K+   +     H      +AV +
Sbjct: 653 SKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVAN 686

>NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score = 94.7 bits (234), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 103/229 (44%), Gaps = 17/229 (7%)

Query: 458 DLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFV 517
           D  S    +T    H  A++S   + D K L++GS DKTV+ W      TLV        
Sbjct: 571 DKYSKDFTNTTLIGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLV-------- 622

Query: 518 PMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVL 577
                   +    N  +  V+ SP   Y A +  D T +++  D +       GH   V 
Sbjct: 623 --------SYKGHNHPVWDVKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVD 674

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDA 637
            +    +   + T S+DK  ++W +  GD  +    H   ++S    P+     + S+D 
Sbjct: 675 CVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDG 734

Query: 638 VVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           ++  WD    + ++ +  H ++ +++L+ S +G+ +VSS  DHS+R+W+
Sbjct: 735 IINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWD 783

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 90/219 (41%), Gaps = 13/219 (5%)

Query: 478 SLDLTSDGKRLVTGSADKTVKFW-----------DFQVEKTLVPGTKDKFVPMLKLNHDT 526
           SLD + D +    G  D  +K W           D     +    T DK+       + T
Sbjct: 524 SLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGDVSSSPSPSATTADKY--SKDFTNTT 581

Query: 527 TLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
            +  +  + S   SPD++YL     D TV+++ LD+    +S  GH  PV  +  S    
Sbjct: 582 LIGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPLGH 641

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEK 646
              T+S D+  ++W  D     +    H   +  V F P     F+ S D   + WD   
Sbjct: 642 YFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVST 701

Query: 647 FECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
            + ++    H + V + A+S DG ++ + S D  I +W+
Sbjct: 702 GDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWD 740

 Score = 74.3 bits (181), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 78/180 (43%), Gaps = 25/180 (13%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLD--SMKFY---------------------- 566
           N D+ S+  S D R  A    D+ +K++ LD  S+K Y                      
Sbjct: 519 NRDMTSLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGDVSSSPSPSATTADKYSKDFT 578

Query: 567 -LSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP 625
             +L GH   V S   S D+K +I+ S DK +++W LD      S   H   +  VKF P
Sbjct: 579 NTTLIGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSP 638

Query: 626 ESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
             H F + S D   + W  +    ++    H S+V  ++   +G +V + S D + R+W+
Sbjct: 639 LGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWD 698

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 60/148 (40%), Gaps = 9/148 (6%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   L  G  D  +++W L + T L+++ GH   +  ++F   G    + S D    +W 
Sbjct: 597 DNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPLGHYFATASHDQTARLWS 656

Query: 150 LVGEVGLYKLRSHKDAITGFWC----QGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG 205
                 +Y LR     ++   C        ++ + S D   ++WD+ T   +   + HT 
Sbjct: 657 C---DHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTA 713

Query: 206 ECWGLAVKDD--LLITTSTDSQVKIWKL 231
                AV  D   L T S D  + +W +
Sbjct: 714 PVISTAVSPDGRWLSTGSEDGIINVWDI 741

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 62/143 (43%), Gaps = 6/143 (4%)

Query: 94  LAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH + +  + F   G  + +GS D    +WD+   
Sbjct: 643 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 702

Query: 154 VGLYKLRSHKDAI--TGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAH-TGECWGL 210
             +     H   +  T     G  WL + S+DG+I +WD+ T + ++    H     + L
Sbjct: 703 DSVRLFLGHTAPVISTAVSPDGR-WLSTGSEDGIINVWDIGTGKRLKLMRGHGKNAIYSL 761

Query: 211 AV--KDDLLITTSTDSQVKIWKL 231
           +   + ++L+++  D  V++W L
Sbjct: 762 SYSKEGNVLVSSGADHSVRVWDL 784

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 54/110 (49%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH A +        G  L +GS+D  
Sbjct: 676 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGI 735

Query: 145 IIVWDLVGEVGLYKLRSH-KDAITGF-WCQGEDWLVSTSKDGLIKIWDLK 192
           I VWD+     L  +R H K+AI    + +  + LVS+  D  +++WDLK
Sbjct: 736 INVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWDLK 785

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 44/101 (43%), Gaps = 13/101 (12%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           +WD+ TGD V        P  S A            V  D   L+ G  DG+I VWD+ +
Sbjct: 696 MWDVSTGDSVRLFLGHTAPVISTA------------VSPDGRWLSTGSEDGIINVWDIGT 743

Query: 111 KTVLLNFNGH-KAAITLMQFDSTGTRLISGSKDSNIIVWDL 150
              L    GH K AI  + +   G  L+S   D ++ VWDL
Sbjct: 744 GKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWDL 784

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 62/181 (34%), Gaps = 36/181 (19%)

Query: 81  ECTYLEVHQDTNLLAVGYADGVIKVWDL----------------------------VSKT 112
           + T L+  +D+ L A G+ D  IK+W L                             + T
Sbjct: 521 DMTSLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGDVSSSPSPSATTADKYSKDFTNT 580

Query: 113 VLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAI--TGFW 170
            L+   GH  A+    F      LISGS+D  + +W L     L   + H   +    F 
Sbjct: 581 TLI---GHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFS 637

Query: 171 CQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG--ECWGLAVKDDLLITTSTDSQVKI 228
             G  +  + S D   ++W       +     H    +C         + T S+D   ++
Sbjct: 638 PLGH-YFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRM 696

Query: 229 W 229
           W
Sbjct: 697 W 697

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 128/295 (43%), Gaps = 39/295 (13%)

Query: 393 DVRSIDVSDDNKLLATASNGS-LKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRS 451
           D+  ++ SDD +L AT    S +KIW++           G +L    LP         + 
Sbjct: 481 DMSCLEFSDDCRLAATGFQDSFIKIWSLD----------GSSLVTNKLPS-------YKK 523

Query: 452 GELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPG 511
            E+      +SSLL      H  A++S   + D K L++GS DKTV+ W      TLV  
Sbjct: 524 EEILTTGDETSSLLI----GHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLV-- 577

Query: 512 TKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYG 571
                         +    N  +  V+ SP   Y A +  D T +++  D +       G
Sbjct: 578 --------------SYKGHNHPVWDVKFSPMGHYFATASHDQTARLWSCDHIYPLRIFAG 623

Query: 572 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF 631
           H   V ++    +   + T SADK  ++W +  GD  +    H   +++    P+     
Sbjct: 624 HLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTPDGRWLC 683

Query: 632 SCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           +  +D V+  WD    + ++++  H ++ + + + + +G+ ++S   DHS+R+W+
Sbjct: 684 TGGEDGVINVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWD 738

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 73/175 (41%), Gaps = 20/175 (11%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLS--------------------LY 570
           N D+  +  S D R  A    D+ +K++ LD      +                    L 
Sbjct: 479 NKDMSCLEFSDDCRLAATGFQDSFIKIWSLDGSSLVTNKLPSYKKEEILTTGDETSSLLI 538

Query: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNF 630
           GH   V S   S D+K +++ S DK +++W +D      S   H   +  VKF P  H F
Sbjct: 539 GHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVWDVKFSPMGHYF 598

Query: 631 FSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
            + S D   + W  +    ++    H ++V  ++   +G +V + S D + R+W+
Sbjct: 599 ATASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWD 653

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 47/108 (43%), Gaps = 13/108 (12%)

Query: 44  SALENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVI 103
           SA +   +WDI TGD V        P  + A            V  D   L  G  DGVI
Sbjct: 644 SADKTCRMWDISTGDSVRLFLGHTAPVLTTA------------VTPDGRWLCTGGEDGVI 691

Query: 104 KVWDLVSKTVLLNFNGH-KAAITLMQFDSTGTRLISGSKDSNIIVWDL 150
            VWD+ +   L    GH K AI    F+  G  LISG  D ++ VWDL
Sbjct: 692 NVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWDL 739

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 52/107 (48%), Gaps = 2/107 (1%)

Query: 88  HQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIV 147
           H +   +  G AD   ++WD+ +   +  F GH A +        G  L +G +D  I V
Sbjct: 634 HPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTPDGRWLCTGGEDGVINV 693

Query: 148 WDLVGEVGLYKLRSH-KDAITGFWCQGE-DWLVSTSKDGLIKIWDLK 192
           WD+     L ++R H K+AI  F    E + L+S   D  +++WDLK
Sbjct: 694 WDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWDLK 740

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 63/159 (39%), Gaps = 8/159 (5%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   L  G  D  +++W + + T L+++ GH   +  ++F   G    + S D    +W 
Sbjct: 552 DNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVWDVKFSPMGHYFATASHDQTARLWS 611

Query: 150 LVGEVGLYKLRSH-KDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECW 208
                 L     H  D  T  +     ++ + S D   ++WD+ T   +   + HT    
Sbjct: 612 CDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVL 671

Query: 209 GLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEM 245
             AV  D   L T   D  + +W +       G++L +M
Sbjct: 672 TTAVTPDGRWLCTGGEDGVINVWDIG-----TGKRLKQM 705

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 57/143 (39%), Gaps = 6/143 (4%)

Query: 94  LAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   G  + +GS D    +WD+   
Sbjct: 598 FATASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTG 657

Query: 154 VGLYKLRSHKDAI--TGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGEC---W 208
             +     H   +  T     G  WL +  +DG+I +WD+ T + ++    H       +
Sbjct: 658 DSVRLFLGHTAPVLTTAVTPDGR-WLCTGGEDGVINVWDIGTGKRLKQMRGHGKNAIHSF 716

Query: 209 GLAVKDDLLITTSTDSQVKIWKL 231
               + ++LI+   D  V++W L
Sbjct: 717 SFNKEGNILISGGADHSVRVWDL 739

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/191 (19%), Positives = 66/191 (34%), Gaps = 36/191 (18%)

Query: 77  SKPAECTY-----------LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLN--------- 116
           S P+ C Y           LE   D  L A G+ D  IK+W L   +++ N         
Sbjct: 466 SLPSVCMYTFHNTNKDMSCLEFSDDCRLAATGFQDSFIKIWSLDGSSLVTNKLPSYKKEE 525

Query: 117 -----------FNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDA 165
                        GH  A+    F      L+SGS+D  + +W +     L   + H   
Sbjct: 526 ILTTGDETSSLLIGHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHP 585

Query: 166 I--TGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDD--LLITTS 221
           +    F   G  +  + S D   ++W       +     H  +   ++   +   + T S
Sbjct: 586 VWDVKFSPMGH-YFATASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGS 644

Query: 222 TDSQVKIWKLN 232
            D   ++W ++
Sbjct: 645 ADKTCRMWDIS 655

>CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some
           similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084c TUP1
          Length = 836

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 79/340 (23%), Positives = 142/340 (41%), Gaps = 69/340 (20%)

Query: 397 IDVSDDNKLLATASNGSLKIWNVKTHKCIRTFECGYALTCK------------------- 437
           +  S+D + LAT  N + +I+ V   + +  F    A T K                   
Sbjct: 497 VKFSNDGEFLATGCNKTTQIYRVSDGELVARFSDENAHTDKADGNDNAEAETSAGATTDL 556

Query: 438 ------FLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
                 F P G  +  G     ++++D+    ++  ++  H+  I+SLD    G +LV+G
Sbjct: 557 YIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLK-GHEQDIYSLDYFPSGDKLVSG 615

Query: 492 SADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDD-RYLAISL 550
           S D+TV+ WD +  +  +                 TL + D + +V +SP D +++A   
Sbjct: 616 SGDRTVRIWDLKTGQCTL-----------------TLSIEDGVTTVAVSPGDGKFIAAGS 658

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL- 602
           LD  V+V      F ++ +     L  GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 659 LDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLR 718

Query: 603 -----------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQ 651
                        G C  +   H+D ++SV    +     S SKD  V +WD      + 
Sbjct: 719 NVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLL 778

Query: 652 KLYAHQSEVWALAIS------TDGSFVVSSSHDHSIRIWE 685
            L  H++ V ++A++       +     + S D   RIW+
Sbjct: 779 MLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIWK 818

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 108/229 (47%), Gaps = 19/229 (8%)

Query: 472 HDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELN 531
           H + +  +  ++DG+ L TG  +KT + +    +  LV    D+     K + +   E  
Sbjct: 490 HTSVVCCVKFSNDGEFLATG-CNKTTQIYRVS-DGELVARFSDENAHTDKADGNDNAEAE 547

Query: 532 DD--------ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISF 583
                     I SV  SPD ++LA    D  ++++ ++  K  + L GH+  + S+D   
Sbjct: 548 TSAGATTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFP 607

Query: 584 DSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC-SKDAVVKYW 642
               +++ S D+ ++IW L  G C  +L + +D + +V   P    F +  S D  V+ W
Sbjct: 608 SGDKLVSGSGDRTVRIWDLKTGQCTLTL-SIEDGVTTVAVSPGDGKFIAAGSLDRAVRVW 666

Query: 643 DGEKFECIQKL-------YAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
           D +    +++L         H+  V+++  + DG+ VVS S D S+++W
Sbjct: 667 DSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLW 715

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 96/232 (41%), Gaps = 25/232 (10%)

Query: 41  LITSALENVNIWDIKTGDLVTTLSD-----GLPPGASDAKGSKPAECT---YLE---VHQ 89
           L T   +   I+ +  G+LV   SD         G  +A+    A  T   Y+       
Sbjct: 506 LATGCNKTTQIYRVSDGELVARFSDENAHTDKADGNDNAEAETSAGATTDLYIRSVCFSP 565

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++WD+  K +++   GH+  I  + +  +G +L+SGS D  + +WD
Sbjct: 566 DGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 625

Query: 150 L-VGEVGLYKLRSHKDAITGFWCQGED--WLVSTSKDGLIKIWDLKTQQCIET------- 199
           L  G+  L    S +D +T       D  ++ + S D  +++WD  T   +E        
Sbjct: 626 LKTGQCTL--TLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENEL 683

Query: 200 HIAHTGECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEMGIFE 249
              H    + +    D   +++ S D  VK+W L   N    +     G  E
Sbjct: 684 GTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCE 735

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 88/236 (37%), Gaps = 52/236 (22%)

Query: 25  WIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLVTTLS--DGLPPGASDAKGSKPAEC 82
           + P+  +  +GSG           V IWD+KTG    TLS  DG+               
Sbjct: 605 YFPSGDKLVSGSGD--------RTVRIWDLKTGQCTLTLSIEDGV--------------T 642

Query: 83  TYLEVHQDTNLLAVGYADGVIKVWD-----LVSKTVLLN--FNGHKAAITLMQFDSTGTR 135
           T      D   +A G  D  ++VWD     LV +    N    GHK ++  + F   G  
Sbjct: 643 TVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNG 702

Query: 136 LISGSKDSNIIVWDL------------VGEVGLYKLRSHKDAITGFWCQGED-WLVSTSK 182
           ++SGS D ++ +W+L                       HKD +       +D +++S SK
Sbjct: 703 VVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSK 762

Query: 183 DGLIKIWDLKTQQCIETHIAHTGECWGLAVKDD--------LLITTSTDSQVKIWK 230
           D  +  WD  +   +     H      +AV           +  T S D + +IWK
Sbjct: 763 DRGVLFWDKVSGNPLLMLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIWK 818

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 127/284 (44%), Gaps = 46/284 (16%)

Query: 432 YALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G     ++++DL +  ++ T++  H+  I+SLD    G +LV+G
Sbjct: 450 YIRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQ-GHEQDIYSLDYFPSGDKLVSG 508

Query: 492 SADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISP-DDRYLAISL 550
           S D+TV+ WD +  +  +                 TL + D + +V +SP D + +A   
Sbjct: 509 SGDRTVRIWDLRAGQCSL-----------------TLSIEDGVTTVAVSPGDGKLIAAGS 551

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL- 602
           LD TV++      F ++ +     L  GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 552 LDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLR 611

Query: 603 -----------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQ 651
                      +      +   H+D ++SV          S SKD  V +WD      + 
Sbjct: 612 SANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLL 671

Query: 652 KLYAHQSEVWALAISTD-------GSFVVSSSHDHSIRIWEETE 688
            L  H++ V ++A++ D       G F   S  D   RIW+ T+
Sbjct: 672 MLQGHRNSVISVAVANDHPLGPEYGVFATGSG-DCKARIWKYTK 714

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 100/226 (44%), Gaps = 33/226 (14%)

Query: 41  LITSALENVNIWDIKTGDLVTTLSD---GLPPGASD--AKGSKPAECT-----------Y 84
           L T   +   ++ + TG+LV  LS+     P G S   A G++ AE T           Y
Sbjct: 391 LATGCNKTTQVYKVSTGELVARLSEDAASAPSGNSGDGASGAENAEQTPAVSTSASSDLY 450

Query: 85  LE---VHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSK 141
           +       D   LA G  D +I++WDL ++ +++   GH+  I  + +  +G +L+SGS 
Sbjct: 451 IRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 510

Query: 142 DSNIIVWDL-VGEVGLYKLRSHKDAITGFWCQGED--WLVSTSKDGLIKIWDLKTQQCIE 198
           D  + +WDL  G+  L    S +D +T       D   + + S D  ++IWD +T   +E
Sbjct: 511 DRTVRIWDLRAGQCSL--TLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVE 568

Query: 199 T-------HIAHTGECWGLAVKDD--LLITTSTDSQVKIWKLNMEN 235
                      H    + +    D   +++ S D  VK+W L   N
Sbjct: 569 RLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSAN 614

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 95/242 (39%), Gaps = 52/242 (21%)

Query: 25  WIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLVTTLS--DGLPPGASDAKGSKPAEC 82
           + P+  +  +GSG           V IWD++ G    TLS  DG+               
Sbjct: 498 YFPSGDKLVSGSGD--------RTVRIWDLRAGQCSLTLSIEDGV--------------T 535

Query: 83  TYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFN-------GHKAAITLMQFDSTGTR 135
           T      D  L+A G  D  +++WD  +  ++   +       GHK ++  + F   G  
Sbjct: 536 TVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHG 595

Query: 136 LISGSKDSNIIVWDLVGEVG------------LYKLRSHKDAITGFW-CQGEDWLVSTSK 182
           ++SGS D ++ +W+L    G                  HKD +      Q +++++S SK
Sbjct: 596 VVSGSLDRSVKLWNLRSANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSK 655

Query: 183 DGLIKIWDLKTQQCIETHIAHTGECWGLAVKDD--------LLITTSTDSQVKIWKLNME 234
           D  +  WD  +   +     H      +AV +D        +  T S D + +IWK   +
Sbjct: 656 DRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWKYTKK 715

Query: 235 NE 236
           +E
Sbjct: 716 SE 717

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 137/298 (45%), Gaps = 24/298 (8%)

Query: 394 VRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGYALTCKFL---PGGLLVILGT 449
           V  + +S D+ ++AT S  G LKI + +T + I+ F+  +      +   P G  ++ G 
Sbjct: 185 VSQVAISSDDSMVATCSWGGDLKILSTETLEIIKAFDTAHDSKIGGVDWNPDGTALVTGA 244

Query: 450 RSGELQLFDLA--SSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKT 507
            +GE+++++L   S S   T+   H+  +  +     GK + + S D T + WD  VEK 
Sbjct: 245 ANGEIRIWNLNNDSESPAGTLT-GHENRVARVRFHPSGKYVASASFDMTWRLWD--VEKQ 301

Query: 508 LVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYL 567
           +           L+L      E    +  V    D   L  + LD+   V+ L S K  +
Sbjct: 302 I----------ELQLQEGHAKE----VYCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSIM 347

Query: 568 SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF-LPE 626
           +L GH  P+  +D S +   I T SAD  I++W +       +L AH   +  VKF    
Sbjct: 348 ALEGHIKPIYGLDWSPNGYDIATGSADGTIRLWDVRKVGILGALPAHNSIVSEVKFDKAN 407

Query: 627 SHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
            H   S S D  +  + G+ +  +  +  H  ++ ++ ISTDGS + SS  D S++ W
Sbjct: 408 GHYLVSSSYDKTLNIYSGDNWTKLSVIQGHTDKILSVDISTDGSHLFSSGWDRSLKQW 465

 Score = 61.6 bits (148), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 122/283 (43%), Gaps = 36/283 (12%)

Query: 325 ILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNNTIEYYSIPYEKRDPTSPAPLKTHT 384
           I+  F T     KI    W    ++   LV   +N  I  +++     D  SPA      
Sbjct: 216 IIKAFDTAHD-SKIGGVDWNPDGTA---LVTGAANGEIRIWNL---NNDSESPAGT---- 264

Query: 385 IELQGQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGYA--LTCKFLP- 440
             L G    V  +      K +A+AS + + ++W+V+    ++  E G+A  + C     
Sbjct: 265 --LTGHENRVARVRFHPSGKYVASASFDMTWRLWDVEKQIELQLQE-GHAKEVYCVAFQK 321

Query: 441 -GGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
            G LL   G  S  L ++DL S   +  +E  H   I+ LD + +G  + TGSAD T++ 
Sbjct: 322 DGSLLCSTGLDSVGL-VWDLRSGKSIMALE-GHIKPIYGLDWSPNGYDIATGSADGTIRL 379

Query: 500 WDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFF 559
           WD  V K  + G        L  ++    E+  D        +  YL  S  D T+ ++ 
Sbjct: 380 WD--VRKVGILGA-------LPAHNSIVSEVKFD------KANGHYLVSSSYDKTLNIYS 424

Query: 560 LDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGL 602
            D+      + GH   +LS+DIS D   + +S  D+++K W L
Sbjct: 425 GDNWTKLSVIQGHTDKILSVDISTDGSHLFSSGWDRSLKQWSL 467

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 69/152 (45%), Gaps = 3/152 (1%)

Query: 537 VRISPDDRYLAISLLDNTVKVFFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADK 595
           V IS DD  +A       +K+   ++++   +    H   +  +D + D   ++T +A+ 
Sbjct: 188 VAISSDDSMVATCSWGGDLKILSTETLEIIKAFDTAHDSKIGGVDWNPDGTALVTGAANG 247

Query: 596 NIKIWGL--DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKL 653
            I+IW L  D      +L  H++ +  V+F P      S S D   + WD EK   +Q  
Sbjct: 248 EIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGKYVASASFDMTWRLWDVEKQIELQLQ 307

Query: 654 YAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
             H  EV+ +A   DGS + S+  D    +W+
Sbjct: 308 EGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWD 339

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 54/137 (39%), Gaps = 4/137 (2%)

Query: 68  PPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLM 127
           P G      ++ A   +   H     +A    D   ++WD+  +  L    GH   +  +
Sbjct: 261 PAGTLTGHENRVARVRF---HPSGKYVASASFDMTWRLWDVEKQIELQLQEGHAKEVYCV 317

Query: 128 QFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGF-WCQGEDWLVSTSKDGLI 186
            F   G+ L S   DS  +VWDL     +  L  H   I G  W      + + S DG I
Sbjct: 318 AFQKDGSLLCSTGLDSVGLVWDLRSGKSIMALEGHIKPIYGLDWSPNGYDIATGSADGTI 377

Query: 187 KIWDLKTQQCIETHIAH 203
           ++WD++    +    AH
Sbjct: 378 RLWDVRKVGILGALPAH 394

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 68/158 (43%), Gaps = 6/158 (3%)

Query: 81  ECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGS 140
           E   +   +D +LL     D V  VWDL S   ++   GH   I  + +   G  + +GS
Sbjct: 313 EVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSIMALEGHIKPIYGLDWSPNGYDIATGS 372

Query: 141 KDSNIIVWDLVGEVG-LYKLRSHKDAIT--GFWCQGEDWLVSTSKDGLIKIWDLKTQQCI 197
            D  I +WD V +VG L  L +H   ++   F      +LVS+S D  + I+       +
Sbjct: 373 ADGTIRLWD-VRKVGILGALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNIYSGDNWTKL 431

Query: 198 ETHIAHTGECWGLAVKDD--LLITTSTDSQVKIWKLNM 233
                HT +   + +  D   L ++  D  +K W L +
Sbjct: 432 SVIQGHTDKILSVDISTDGSHLFSSGWDRSLKQWSLKI 469

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 53/243 (21%), Positives = 100/243 (41%), Gaps = 43/243 (17%)

Query: 575 PVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSL-FAHQDSIMSVKFLPESHNFFSC 633
           PV  + IS D  M+ T S   ++KI   +  +  K+   AH   I  V + P+     + 
Sbjct: 184 PVSQVAISSDDSMVATCSWGGDLKILSTETLEIIKAFDTAHDSKIGGVDWNPDGTALVTG 243

Query: 634 SKDAVVKYWD--GEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQV 691
           + +  ++ W+   +       L  H++ V  +     G +V S+S D + R+W+      
Sbjct: 244 AANGEIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGKYVASASFDMTWRLWD------ 297

Query: 692 FXXXXXXXXXXXQYEDTLLTSLEEGNGDD----AFKGDATGENVEDEASGVHKQTLE-SL 746
                         E  +   L+EG+  +    AF+ D +       ++G+    L   L
Sbjct: 298 -------------VEKQIELQLQEGHAKEVYCVAFQKDGSLLC----STGLDSVGLVWDL 340

Query: 747 KAGEKLMEALDLGIAEIEGME-----------MYNKDMKLWQRKKLGEAPMKPQGNSVLI 795
           ++G+ +M AL+  I  I G++             +  ++LW  +K+G     P  NS++ 
Sbjct: 341 RSGKSIM-ALEGHIKPIYGLDWSPNGYDIATGSADGTIRLWDVRKVGILGALPAHNSIVS 399

Query: 796 AVK 798
            VK
Sbjct: 400 EVK 402

 Score = 33.1 bits (74), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 60/124 (48%), Gaps = 5/124 (4%)

Query: 385 IELQGQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGYALT--CKF-LP 440
           + L+G    +  +D S +   +AT S +G++++W+V+    +       ++    KF   
Sbjct: 347 MALEGHIKPIYGLDWSPNGYDIATGSADGTIRLWDVRKVGILGALPAHNSIVSEVKFDKA 406

Query: 441 GGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
            G  ++  +    L ++   + + L  I+  H   I S+D+++DG  L +   D+++K W
Sbjct: 407 NGHYLVSSSYDKTLNIYSGDNWTKLSVIQ-GHTDKILSVDISTDGSHLFSSGWDRSLKQW 465

Query: 501 DFQV 504
             ++
Sbjct: 466 SLKI 469

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 102/219 (46%), Gaps = 19/219 (8%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLEL 530
            H  AI+S   + D K LV+ S DKT++ W      TLV                T    
Sbjct: 551 GHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLV----------------TYKGH 594

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLY-GHKLPVLSIDISFDSKMII 589
           N  +  V+ SP   Y A +  D T +++  D + F L ++ GH   V  +    +   I 
Sbjct: 595 NHPVWDVQFSPVGHYFATASHDQTARLWSCDHI-FPLRIFSGHISDVDCVTFHPNGCYIF 653

Query: 590 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFEC 649
           T S+DK  ++W +  G+  +    H   I+SV   P+     + S+D V+  WD    + 
Sbjct: 654 TGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKS 713

Query: 650 IQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWEET 687
           ++KL  H +S V +L+ + + + +VS   D+S+RIW+ T
Sbjct: 714 LKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDLT 752

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 84/180 (46%), Gaps = 8/180 (4%)

Query: 511 GTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISL-LDNTV--KVFFLDSMKFYL 567
           G KD ++ +  L+  TTLE      + +I P     A+   LDN +  K    ++    +
Sbjct: 493 GFKDSYIKVWSLD-GTTLESK----ATKIQPSKSQAALRAGLDNKINEKTRSQETPITTV 547

Query: 568 SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPES 627
            L GH   + S   S D+K+++++S DK I++W +D      +   H   +  V+F P  
Sbjct: 548 KLVGHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPVG 607

Query: 628 HNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEET 687
           H F + S D   + W  +    ++    H S+V  +    +G ++ + S D + R+W+ T
Sbjct: 608 HYFATASHDQTARLWSCDHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDIT 667

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 103/224 (45%), Gaps = 23/224 (10%)

Query: 384 TIELQGQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGY---ALTCKFL 439
           T++L G    + S   S DNKLL +AS + ++++W++ T   + T++ G+       +F 
Sbjct: 546 TVKLVGHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLVTYK-GHNHPVWDVQFS 604

Query: 440 PGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
           P G      +     +L+       L  I   H + +  +    +G  + TGS+DKT + 
Sbjct: 605 PVGHYFATASHDQTARLWSCDHIFPL-RIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRM 663

Query: 500 WDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFF 559
           WD    +++           L + H         ILSV ++PD   LA    D  + ++ 
Sbjct: 664 WDITTGESV----------RLFIGHTAP------ILSVAVAPDGLRLATGSEDGVIHIWD 707

Query: 560 LDSMKFYLSLYGH-KLPVLSIDISFDSKMIITSSADKNIKIWGL 602
           + + K    L GH K  V S+  + +S ++++  +D +++IW L
Sbjct: 708 IGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDL 751

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 62/148 (41%), Gaps = 9/148 (6%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D  LL     D  I++W + ++T L+ + GH   +  +QF   G    + S D    +W 
Sbjct: 564 DNKLLVSASEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTARLWS 623

Query: 150 LVGEVGLYKLRSHKDAITGFWC----QGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG 205
                 ++ LR     I+   C        ++ + S D   ++WD+ T + +   I HT 
Sbjct: 624 C---DHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTA 680

Query: 206 ECWGLAVKDD--LLITTSTDSQVKIWKL 231
               +AV  D   L T S D  + IW +
Sbjct: 681 PILSVAVAPDGLRLATGSEDGVIHIWDI 708

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 52/106 (49%), Gaps = 2/106 (1%)

Query: 88  HQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIV 147
           H +   +  G +D   ++WD+ +   +  F GH A I  +     G RL +GS+D  I +
Sbjct: 646 HPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHI 705

Query: 148 WDLVGEVGLYKLRSH-KDAITGF-WCQGEDWLVSTSKDGLIKIWDL 191
           WD+     L KL  H K A+    + +  + LVS   D  ++IWDL
Sbjct: 706 WDIGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDL 751

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 62/144 (43%), Gaps = 4/144 (2%)

Query: 94  LAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F+GH + +  + F   G  + +GS D    +WD+   
Sbjct: 610 FATASHDQTARLWSCDHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTG 669

Query: 154 VGLYKLRSHKDAITGFWCQGEDWLVST-SKDGLIKIWDLKTQQCIETHIAHTGEC---WG 209
             +     H   I       +   ++T S+DG+I IWD+ T + ++  I H         
Sbjct: 670 ESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKSLKKLIGHGKSAVNSLS 729

Query: 210 LAVKDDLLITTSTDSQVKIWKLNM 233
              + ++L++  +D+ V+IW L +
Sbjct: 730 YNKESNILVSGGSDNSVRIWDLTV 753

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 50/102 (49%), Gaps = 2/102 (1%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTF--ECGYALTCKFLPGGLLVILGTRSGELQLFDLASS 462
           +   +S+ + ++W++ T + +R F       L+    P GL +  G+  G + ++D+ + 
Sbjct: 652 IFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTG 711

Query: 463 SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQV 504
             L  +     +A+ SL    +   LV+G +D +V+ WD  V
Sbjct: 712 KSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDLTV 753

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 67/181 (37%), Gaps = 40/181 (22%)

Query: 73  DAKGSKPAECTY-----------LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHK 121
           D K + P+ C +           L    D  L A G+ D  IKVW L   T+       +
Sbjct: 458 DLKTALPSVCMFTFLNTNNEMLSLSYSNDCRLAAAGFKDSYIKVWSLDGTTL-------E 510

Query: 122 AAITLMQFDSTGTRLISG----------SKDSNIIVWDLVGEVG-LYKLRSHKDAITGFW 170
           +  T +Q   +   L +G          S+++ I    LVG  G +Y      D      
Sbjct: 511 SKATKIQPSKSQAALRAGLDNKINEKTRSQETPITTVKLVGHSGAIYSTSFSPD------ 564

Query: 171 CQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKD--DLLITTSTDSQVKI 228
                 LVS S+D  I++W + T+  + T+  H    W +          T S D   ++
Sbjct: 565 ---NKLLVSASEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTARL 621

Query: 229 W 229
           W
Sbjct: 622 W 622

>TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.544
           YBR198C
          Length = 812

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 131/299 (43%), Gaps = 39/299 (13%)

Query: 393 DVRSIDVSDDNKLLATASNGS-LKIWNVKTHKCIRTFECGYALTCKFLPGGL---LVILG 448
           D+ S++ SDD +L +T    S +KIW++           G +L  KF         + + 
Sbjct: 457 DMTSLEFSDDCRLASTGFQDSYIKIWSLD----------GTSLNTKFTQANKDRNRITIT 506

Query: 449 TRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTL 508
            RS  L   D   S+ L      H   ++S   + D + L++GS DKTV+ W       L
Sbjct: 507 DRS--LTHMDNELSATLI----GHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTAL 560

Query: 509 VPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLS 568
           V                +    N  I  V+ SP   Y A +  D T +++  D + F L 
Sbjct: 561 V----------------SYKGHNHPIWDVQFSPLGHYFATASHDQTARLWSCDHI-FPLR 603

Query: 569 LY-GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPES 627
           ++ GH   V  +    +   + T S+DK  ++W +  GD  +    H  +++S    P+ 
Sbjct: 604 IFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLGHTSAVVSTAVSPDG 663

Query: 628 HNFFSCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
               + S D  +  WD    + ++ L  H ++ V++L  S +G+ +VSS  D S+R+W+
Sbjct: 664 RWLTTGSDDGTINVWDIGSGKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWD 722

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 77/183 (42%), Gaps = 28/183 (15%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLD----SMKFY-------------------- 566
           N D+ S+  S D R  +    D+ +K++ LD    + KF                     
Sbjct: 455 NQDMTSLEFSDDCRLASTGFQDSYIKIWSLDGTSLNTKFTQANKDRNRITITDRSLTHMD 514

Query: 567 ----LSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVK 622
                +L GH   V S   S D++ +I+ S DK +++W LD      S   H   I  V+
Sbjct: 515 NELSATLIGHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVSYKGHNHPIWDVQ 574

Query: 623 FLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIR 682
           F P  H F + S D   + W  +    ++    H ++V  ++   +G +V + S D + R
Sbjct: 575 FSPLGHYFATASHDQTARLWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCR 634

Query: 683 IWE 685
           +W+
Sbjct: 635 MWD 637

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 101/221 (45%), Gaps = 23/221 (10%)

Query: 387 LQGQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGYALT---CKFLPGG 442
           L G    V S   S DN+ L + S + ++++W++ TH  + +++ G+       +F P G
Sbjct: 521 LIGHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVSYK-GHNHPIWDVQFSPLG 579

Query: 443 LLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
                 +     +L+       L  I   H   +  +    +G  + TGS+DKT + WD 
Sbjct: 580 HYFATASHDQTARLWSCDHIFPL-RIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDI 638

Query: 503 QVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS 562
               ++           L L H +       ++S  +SPD R+L     D T+ V+ + S
Sbjct: 639 STGDSV----------RLFLGHTSA------VVSTAVSPDGRWLTTGSDDGTINVWDIGS 682

Query: 563 MKFYLSLYGH-KLPVLSIDISFDSKMIITSSADKNIKIWGL 602
            K   SL GH K  V S+  S +  ++++S AD+++++W L
Sbjct: 683 GKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 59/146 (40%), Gaps = 5/146 (3%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   L  G  D  +++W L + T L+++ GH   I  +QF   G    + S D    +W 
Sbjct: 536 DNRYLISGSEDKTVRLWSLDTHTALVSYKGHNHPIWDVQFSPLGHYFATASHDQTARLWS 595

Query: 150 LVGEVGLYKLRSHKDAI--TGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGEC 207
                 L     H + +    F   G  ++ + S D   ++WD+ T   +   + HT   
Sbjct: 596 CDHIFPLRIFAGHLNDVDCVSFHPNGY-YVFTGSSDKTCRMWDISTGDSVRLFLGHTSAV 654

Query: 208 WGLAVKDD--LLITTSTDSQVKIWKL 231
              AV  D   L T S D  + +W +
Sbjct: 655 VSTAVSPDGRWLTTGSDDGTINVWDI 680

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 53/109 (48%), Gaps = 2/109 (1%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH +A+        G  L +GS D  
Sbjct: 615 VSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLGHTSAVVSTAVSPDGRWLTTGSDDGT 674

Query: 145 IIVWDLVGEVGLYKLRSH-KDAITGF-WCQGEDWLVSTSKDGLIKIWDL 191
           I VWD+     L  LR H K+A+    + +  + LVS+  D  +++WDL
Sbjct: 675 INVWDIGSGKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 60/143 (41%), Gaps = 6/143 (4%)

Query: 94  LAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   G  + +GS D    +WD+   
Sbjct: 582 FATASHDQTARLWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDISTG 641

Query: 154 VGLYKLRSHKDAI--TGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAH-TGECWGL 210
             +     H  A+  T     G  WL + S DG I +WD+ + + +++   H     + L
Sbjct: 642 DSVRLFLGHTSAVVSTAVSPDGR-WLTTGSDDGTINVWDIGSGKRLKSLRGHGKNAVYSL 700

Query: 211 AV--KDDLLITTSTDSQVKIWKL 231
               + +LL+++  D  V++W L
Sbjct: 701 TYSKEGNLLVSSGADQSVRVWDL 723

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 42/101 (41%), Gaps = 13/101 (12%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           +WDI TGD V           S A            V  D   L  G  DG I VWD+ S
Sbjct: 635 MWDISTGDSVRLFLGHTSAVVSTA------------VSPDGRWLTTGSDDGTINVWDIGS 682

Query: 111 KTVLLNFNGH-KAAITLMQFDSTGTRLISGSKDSNIIVWDL 150
              L +  GH K A+  + +   G  L+S   D ++ VWDL
Sbjct: 683 GKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/183 (20%), Positives = 59/183 (32%), Gaps = 33/183 (18%)

Query: 81  ECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFN---------------------- 118
           + T LE   D  L + G+ D  IK+W L   ++   F                       
Sbjct: 457 DMTSLEFSDDCRLASTGFQDSYIKIWSLDGTSLNTKFTQANKDRNRITITDRSLTHMDNE 516

Query: 119 ------GHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAI--TGFW 170
                 GH   +    F      LISGS+D  + +W L     L   + H   I    F 
Sbjct: 517 LSATLIGHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVSYKGHNHPIWDVQFS 576

Query: 171 CQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG--ECWGLAVKDDLLITTSTDSQVKI 228
             G  +  + S D   ++W       +     H    +C         + T S+D   ++
Sbjct: 577 PLGH-YFATASHDQTARLWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRM 635

Query: 229 WKL 231
           W +
Sbjct: 636 WDI 638

>ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 466

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/314 (23%), Positives = 136/314 (43%), Gaps = 25/314 (7%)

Query: 380 LKTHTIELQGQRT----DVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRT---FECG 431
           +KT  IEL G +      V  + +S +  L+A AS  G L I N +T + ++       G
Sbjct: 165 MKTKNIELMGSQVVSTRPVSQVSLSPNGSLVAAASWAGDLTILNSQTLEILQNKPQIHMG 224

Query: 432 YALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIE-DAHDAAIWSLDLTSDGKRLVT 490
                 + P G L+  G   G ++LF   S++L +    + H+  +        G+ + +
Sbjct: 225 KIGGIHWSPTGDLITAGGEEGSVKLFGYKSNTLEEMATLNGHENRVTDSKFHPSGRFIAS 284

Query: 491 GSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISL 550
            S D T + WD + ++ L          +L+  H        ++ S+    D   +    
Sbjct: 285 ASFDMTWRLWDVETQEEL----------LLQEGH------GKELYSLGFQCDGSLVCSGG 328

Query: 551 LDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKS 610
           +D    V+ + S K  +SL GH  P+ S+D S +   + T S D  I+IW L   + +++
Sbjct: 329 IDCKGLVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQT 388

Query: 611 LFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGS 670
           + AH+  +  V F    +   S   D  +  +    +  +  L  H  ++  + IS + S
Sbjct: 389 ILAHKSIVTKVAFEKNGNCLVSSGYDKSINLYGAYNWAQLTTLQGHMDKILCVDISENAS 448

Query: 671 FVVSSSHDHSIRIW 684
            VVS   D S+++W
Sbjct: 449 SVVSCGWDRSVKLW 462

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 51/117 (43%), Gaps = 1/117 (0%)

Query: 88  HQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIV 147
           H     +A    D   ++WD+ ++  LL   GH   +  + F   G+ + SG  D   +V
Sbjct: 276 HPSGRFIASASFDMTWRLWDVETQEELLLQEGHGKELYSLGFQCDGSLVCSGGIDCKGLV 335

Query: 148 WDLVGEVGLYKLRSHKDAITGF-WCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAH 203
           WD+        L  H   I    W      + + S DG I+IWDL+  +  +T +AH
Sbjct: 336 WDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTILAH 392

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 61/146 (41%), Gaps = 19/146 (13%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           +WDI++G    +LS    P  S            L+   +   +A G  DG I++WDL  
Sbjct: 335 VWDIRSGKRAMSLSGHTKPIYS------------LDWSPNGYQVATGSGDGTIRIWDLRK 382

Query: 111 KTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFW 170
                    HK+ +T + F+  G  L+S   D +I ++       L  L+ H D I    
Sbjct: 383 PEEYQTILAHKSIVTKVAFEKNGNCLVSSGYDKSINLYGAYNWAQLTTLQGHMDKIL--- 439

Query: 171 C----QGEDWLVSTSKDGLIKIWDLK 192
           C    +    +VS   D  +K+W ++
Sbjct: 440 CVDISENASSVVSCGWDRSVKLWTMQ 465

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 66/155 (42%), Gaps = 5/155 (3%)

Query: 81  ECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGS 140
           E   L    D +L+  G  D    VWD+ S    ++ +GH   I  + +   G ++ +GS
Sbjct: 311 ELYSLGFQCDGSLVCSGGIDCKGLVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGS 370

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDAIT--GFWCQGEDWLVSTSKDGLIKIWDLKTQQCIE 198
            D  I +WDL        + +HK  +T   F   G + LVS+  D  I ++       + 
Sbjct: 371 GDGTIRIWDLRKPEEYQTILAHKSIVTKVAFEKNG-NCLVSSGYDKSINLYGAYNWAQLT 429

Query: 199 THIAHTGE--CWGLAVKDDLLITTSTDSQVKIWKL 231
           T   H  +  C  ++     +++   D  VK+W +
Sbjct: 430 TLQGHMDKILCVDISENASSVVSCGWDRSVKLWTM 464

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 66/151 (43%), Gaps = 7/151 (4%)

Query: 92  NLLAVGYADGVIKVWDLVSKTV--LLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           +L+  G  +G +K++   S T+  +   NGH+  +T  +F  +G  + S S D    +WD
Sbjct: 236 DLITAGGEEGSVKLFGYKSNTLEEMATLNGHENRVTDSKFHPSGRFIASASFDMTWRLWD 295

Query: 150 LVGEVGLYKLRSHKDAI--TGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGEC 207
           +  +  L     H   +   GF C G   + S   D    +WD+++ +   +   HT   
Sbjct: 296 VETQEELLLQEGHGKELYSLGFQCDG-SLVCSGGIDCKGLVWDIRSGKRAMSLSGHTKPI 354

Query: 208 WGL--AVKDDLLITTSTDSQVKIWKLNMENE 236
           + L  +     + T S D  ++IW L    E
Sbjct: 355 YSLDWSPNGYQVATGSGDGTIRIWDLRKPEE 385

 Score = 40.4 bits (93), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 47/116 (40%), Gaps = 2/116 (1%)

Query: 572 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHN 629
           H   +  I  S    +I     + ++K++G       +  +L  H++ +   KF P    
Sbjct: 222 HMGKIGGIHWSPTGDLITAGGEEGSVKLFGYKSNTLEEMATLNGHENRVTDSKFHPSGRF 281

Query: 630 FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
             S S D   + WD E  E +     H  E+++L    DGS V S   D    +W+
Sbjct: 282 IASASFDMTWRLWDVETQEELLLQEGHGKELYSLGFQCDGSLVCSGGIDCKGLVWD 337

>ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]
           {ON} some similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084C
          Length = 718

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 70/283 (24%), Positives = 124/283 (43%), Gaps = 45/283 (15%)

Query: 432 YALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G     ++++D+A   ++  ++  H+  I+SLD    G +LV+G
Sbjct: 438 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQ-GHEQDIYSLDYFPSGDKLVSG 496

Query: 492 SADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS-PDDRYLAISL 550
           S D+TV+ WD +  +  +                 TL + D + +V +S  D +Y+A   
Sbjct: 497 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSLGDGKYIAAGS 539

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603
           LD  V+V      F ++ +     L  GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 540 LDRAVRVWDAETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLS 599

Query: 604 FGD-------------CHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
            G              C  +   H+D ++SV          S SKD  V +WD +    +
Sbjct: 600 SGQNNTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTKSGNPL 659

Query: 651 QKLYAHQSEVWALAISTDGSF------VVSSSHDHSIRIWEET 687
             L  H++ V ++A++             + S D   RIW+ T
Sbjct: 660 LMLQGHRNSVISVAVANGYPLGPQYCVFATGSGDCKARIWKYT 702

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 82/165 (49%), Gaps = 9/165 (5%)

Query: 534 ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSA 593
           I SV  SPD ++LA    D  ++++ +   K  + L GH+  + S+D       +++ S 
Sbjct: 439 IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 498

Query: 594 DKNIKIWGLDFGDCHKSLFAHQDSIMSVKF-LPESHNFFSCSKDAVVKYWDGEKFECIQK 652
           D+ ++IW L  G C  +L + +D + +V   L +     + S D  V+ WD E    +++
Sbjct: 499 DRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWDAETGFLVER 557

Query: 653 L-------YAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQ 690
           L         H+  V+++  + DG  VVS S D S+++W  +  Q
Sbjct: 558 LDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLSSGQ 602

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 79/173 (45%), Gaps = 15/173 (8%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++WD+  K +++   GH+  I  + +  +G +L+SGS D  + +WD
Sbjct: 447 DGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 506

Query: 150 L-VGEVGLYKLRSHKDAITGFWCQGED--WLVSTSKDGLIKIWDLKTQQCIET------- 199
           L  G+  L    S +D +T       D  ++ + S D  +++WD +T   +E        
Sbjct: 507 LRTGQCSL--TLSIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWDAETGFLVERLDSENEL 564

Query: 200 HIAHTGECWGLAVKDD--LLITTSTDSQVKIWKLNM-ENEKMGEKLTEMGIFE 249
              H    + +    D   +++ S D  VK+W L+  +N    E     G  E
Sbjct: 565 GTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLSSGQNNTNAETKPAPGTCE 617

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 94/237 (39%), Gaps = 53/237 (22%)

Query: 25  WIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLVTTLS--DGLPPGASDAKGSKPAEC 82
           + P+  +  +GSG           V IWD++TG    TLS  DG+               
Sbjct: 486 YFPSGDKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGV--------------T 523

Query: 83  TYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFN-------GHKAAITLMQFDSTGTR 135
           T      D   +A G  D  ++VWD  +  ++   +       GHK ++  + F   G  
Sbjct: 524 TVAVSLGDGKYIAAGSLDRAVRVWDAETGFLVERLDSENELGTGHKDSVYSVVFTRDGHG 583

Query: 136 LISGSKDSNIIVWDLVG-----------EVGLYKLR--SHKDAITGFWC-QGEDWLVSTS 181
           ++SGS D ++ +W+L               G  ++    HKD +      + +++++S S
Sbjct: 584 VVSGSLDRSVKLWNLSSGQNNTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGS 643

Query: 182 KDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDD--------LLITTSTDSQVKIWK 230
           KD  +  WD K+   +     H      +AV +         +  T S D + +IWK
Sbjct: 644 KDRGVLFWDTKSGNPLLMLQGHRNSVISVAVANGYPLGPQYCVFATGSGDCKARIWK 700

>NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {ON}
           Anc_6.363
          Length = 793

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 83/370 (22%), Positives = 150/370 (40%), Gaps = 78/370 (21%)

Query: 376 SPAPLKTHTIELQ---GQRTDVRSIDVSDDNKLLATASNGSLKIWNVKTHKCIRTFECG- 431
           +PA  +T  +EL       + V  +  S D + LAT  N + +++ V T + I       
Sbjct: 425 NPALPRTLDVELHKSLDHSSVVCCVKFSYDGEFLATGCNKTTQVYRVSTGELIAKLSDDN 484

Query: 432 ------------YALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSL 479
                       Y  +  F P G  +  G     ++++D+    ++  ++  H+  ++SL
Sbjct: 485 VKLDSNSTSTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIQEGKIVMVLK-GHEQDVYSL 543

Query: 480 DLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRI 539
           D   DG++LV+GS D+TV+ WD +  +  +                 TL + D + +V +
Sbjct: 544 DYFPDGQKLVSGSGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAV 586

Query: 540 SP-DDRYLAISLLDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITS 591
           SP D R++A   LD  V+V      F ++ +     L  GH+  V S+  + D   +++ 
Sbjct: 587 SPHDGRFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHQDSVYSVVFTRDGNEVVSG 646

Query: 592 SADKNIKIWGLDF------------------------------GDCHKSLFAHQDSIMSV 621
           S DK++K+W L                                  C  +   H+D ++SV
Sbjct: 647 SLDKSVKLWNLGNDVNSNNNGNDSSSNGTNNNNNSNRASNGTSATCEVTYVGHKDFVLSV 706

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSF------VVSS 675
                     S SKD  V +WD +    +  L  H++ V ++A++             + 
Sbjct: 707 TTSQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHKNSVISVAVANGYPLGPKYNVFATG 766

Query: 676 SHDHSIRIWE 685
           S D   RIW+
Sbjct: 767 SGDCKARIWK 776

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 68/143 (47%), Gaps = 10/143 (6%)

Query: 546 LAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG 605
           L   L D+ VK   LDS      LY     + S+  S D K + T + DK I+IW +  G
Sbjct: 476 LIAKLSDDNVK---LDSNSTSTDLY-----IRSVCFSPDGKFLATGAEDKLIRIWDIQEG 527

Query: 606 DCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI 665
                L  H+  + S+ + P+     S S D  V+ WD    +C   L + +  V  +A+
Sbjct: 528 KIVMVLKGHEQDVYSLDYFPDGQKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAV 586

Query: 666 ST-DGSFVVSSSHDHSIRIWEET 687
           S  DG F+ + S D ++R+W+ T
Sbjct: 587 SPHDGRFIAAGSLDRAVRVWDST 609

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 90/208 (43%), Gaps = 25/208 (12%)

Query: 41  LITSALENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQ-----DTNLLA 95
           L T   +   ++ + TG+L+  LSD       + K    +  T L +       D   LA
Sbjct: 458 LATGCNKTTQVYRVSTGELIAKLSD------DNVKLDSNSTSTDLYIRSVCFSPDGKFLA 511

Query: 96  VGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDL-VGEV 154
            G  D +I++WD+    +++   GH+  +  + +   G +L+SGS D  + +WDL  G+ 
Sbjct: 512 TGAEDKLIRIWDIQEGKIVMVLKGHEQDVYSLDYFPDGQKLVSGSGDRTVRIWDLRTGQC 571

Query: 155 GLYKLRSHKDAITGFWCQGED--WLVSTSKDGLIKIWDLKTQQCIET-------HIAHTG 205
            L    S +D +T       D  ++ + S D  +++WD  T   +E           H  
Sbjct: 572 SL--TLSIEDGVTTVAVSPHDGRFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHQD 629

Query: 206 ECWGLAVKDD--LLITTSTDSQVKIWKL 231
             + +    D   +++ S D  VK+W L
Sbjct: 630 SVYSVVFTRDGNEVVSGSLDKSVKLWNL 657

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 87/230 (37%), Gaps = 62/230 (26%)

Query: 49  VNIWDIKTGDLVTTLS--DGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVW 106
           V IWD++TG    TLS  DG+               T      D   +A G  D  ++VW
Sbjct: 561 VRIWDLRTGQCSLTLSIEDGV--------------TTVAVSPHDGRFIAAGSLDRAVRVW 606

Query: 107 DLVSKTVLLNFN-------GHKAAITLMQFDSTGTRLISGSKDSNIIVWDL--------- 150
           D  +  ++   +       GH+ ++  + F   G  ++SGS D ++ +W+L         
Sbjct: 607 DSTTGFLVERLDSENELGTGHQDSVYSVVFTRDGNEVVSGSLDKSVKLWNLGNDVNSNNN 666

Query: 151 -------------------VGEVGLYKLR--SHKDAITGF-WCQGEDWLVSTSKDGLIKI 188
                               G     ++    HKD +      Q +++++S SKD  +  
Sbjct: 667 GNDSSSNGTNNNNNSNRASNGTSATCEVTYVGHKDFVLSVTTSQNDEYILSGSKDRGVLF 726

Query: 189 WDLKTQQCIETHIAHTGECWGLAV--------KDDLLITTSTDSQVKIWK 230
           WD K+   +     H      +AV        K ++  T S D + +IWK
Sbjct: 727 WDKKSGNPLLMLQGHKNSVISVAVANGYPLGPKYNVFATGSGDCKARIWK 776

>NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa]
           {ON} Anc_6.363
          Length = 671

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 77/341 (22%), Positives = 145/341 (42%), Gaps = 67/341 (19%)

Query: 394 VRSIDVSDDNKLLATASNGSLKIWNVKTHKCIRTFE-------------CG-------YA 433
           V  +  S+D + LAT  N + +I+ V   + I                  G       Y 
Sbjct: 331 VCCVKFSNDGQFLATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPSTDLYI 390

Query: 434 LTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSA 493
            +  F P G  +  G     ++++D+    ++  ++  H+  ++SLD   +G++LV+GS 
Sbjct: 391 RSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLK-GHEQDVYSLDYFPNGEKLVSGSG 449

Query: 494 DKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDD-RYLAISLLD 552
           D+TV+ WD +  +  +                 TL +   + +V +SP+D +++A   LD
Sbjct: 450 DRTVRIWDLRTGQCSL-----------------TLSIEYGVTTVAVSPNDGKFIAAGSLD 492

Query: 553 NTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL--- 602
             V+V      F ++ +     L  GH+  V S+  + D   +++ S DK +K+W +   
Sbjct: 493 RAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHS 552

Query: 603 --------DFGD----CHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
                   D G     C  +   H+D ++SV    +     S SKD  + +WD E    +
Sbjct: 553 GNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPL 612

Query: 651 QKLYAHQSEVWALAISTDGSF------VVSSSHDHSIRIWE 685
             L  H++ V ++A++   +         + S D   RIW+
Sbjct: 613 LMLQGHRNSVISVAVANGSALGPKYNVFATGSGDCKARIWK 653

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 106/224 (47%), Gaps = 14/224 (6%)

Query: 472 HDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDT---TL 528
           H + +  +  ++DG+ L TG  +KT + +    +  L+    D  V     +  T   T 
Sbjct: 327 HSSVVCCVKFSNDGQFLATG-CNKTTQIYRVS-DGELIAKLSDDSVTSPDTSSATSGSTP 384

Query: 529 ELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMI 588
             +  I SV  SPD  +LA    D  ++++ +   K  + L GH+  V S+D   + + +
Sbjct: 385 STDLYIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKL 444

Query: 589 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC-SKDAVVKYWDGEKF 647
           ++ S D+ ++IW L  G C  +L + +  + +V   P    F +  S D  V+ WD    
Sbjct: 445 VSGSGDRTVRIWDLRTGQCSLTL-SIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTG 503

Query: 648 ECIQKL-------YAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
             +++L         H+  V+++  + DG+ VVS S D ++++W
Sbjct: 504 FLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLW 547

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 64/271 (23%), Positives = 120/271 (44%), Gaps = 58/271 (21%)

Query: 387 LQGQRTDVRSID-VSDDNKLLATASNGSLKIWNVKTHKCIRTFECGYALTCKFL-PG-GL 443
           L+G   DV S+D   +  KL++ + + +++IW+++T +C  T    Y +T   + P  G 
Sbjct: 425 LKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEYGVTTVAVSPNDGK 484

Query: 444 LVILGTRSGELQLFDLASSSLLDTIED------AHDAAIWSLDLTSDGKRLVTGSADKTV 497
            +  G+    ++++D  +  L++ ++        H  +++S+  T DG  +V+GS DKTV
Sbjct: 485 FIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTV 544

Query: 498 KFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKV 557
           K W+                  ++ + ++  E ND                     T +V
Sbjct: 545 KLWN------------------MRHSGNSNNESNDK---------------GSASATCEV 571

Query: 558 FFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDS 617
            ++          GHK  VLS+  S D K I++ S D+ I  W  + G+    L  H++S
Sbjct: 572 TYV----------GHKDFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLLMLQGHRNS 621

Query: 618 IMSVKFL------PESHNFFSCSKDAVVKYW 642
           ++SV         P+ + F + S D   + W
Sbjct: 622 VISVAVANGSALGPKYNVFATGSGDCKARIW 652

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 91/216 (42%), Gaps = 20/216 (9%)

Query: 41  LITSALENVNIWDIKTGDLVTTLSDGL---PPGASDAKGSKPAECTYLE---VHQDTNLL 94
           L T   +   I+ +  G+L+  LSD     P  +S   GS P+   Y+       D   L
Sbjct: 343 LATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPSTDLYIRSVCFSPDGEFL 402

Query: 95  AVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDL-VGE 153
           A G  D +I++WD+  + +++   GH+  +  + +   G +L+SGS D  + +WDL  G+
Sbjct: 403 ATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQ 462

Query: 154 VGLYKLRSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIET-------HIAHTGE 206
             L     +             ++ + S D  +++WD  T   +E           H   
Sbjct: 463 CSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDS 522

Query: 207 CWGLAVKDD--LLITTSTDSQVKIWKL----NMENE 236
            + +    D   +++ S D  VK+W +    N  NE
Sbjct: 523 VYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNE 558

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 55/113 (48%), Gaps = 2/113 (1%)

Query: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSK 635
           + S+  S D + + T + DK I+IW +        L  H+  + S+ + P      S S 
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSG 449

Query: 636 DAVVKYWDGEKFECIQKLYAHQSEVWALAIS-TDGSFVVSSSHDHSIRIWEET 687
           D  V+ WD    +C   L + +  V  +A+S  DG F+ + S D ++R+W+ T
Sbjct: 450 DRTVRIWDLRTGQCSLTL-SIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDST 501

 Score = 39.7 bits (91), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 56/134 (41%), Gaps = 22/134 (16%)

Query: 49  VNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVH-QDTNLLAVGYADGVIKVWD 107
           V +WD  TG LV  L       + +  G+   +  Y  V  +D N +  G  D  +K+W+
Sbjct: 495 VRVWDSTTGFLVERLD------SENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWN 548

Query: 108 L---------------VSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVG 152
           +                S T  + + GHK  +  +        ++SGSKD  I+ WD   
Sbjct: 549 MRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKES 608

Query: 153 EVGLYKLRSHKDAI 166
              L  L+ H++++
Sbjct: 609 GNPLLMLQGHRNSV 622

>CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa]
           {ON} similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198c Transcription initiation factor TFIID 90
          Length = 806

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 127/297 (42%), Gaps = 45/297 (15%)

Query: 393 DVRSIDVSDDNKLLATASNGS-LKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRS 451
           D+ S++ SDD +L A     S +KIW+                    L G  L+     S
Sbjct: 475 DMTSLEFSDDCRLAAAGFQDSYIKIWS--------------------LDGSSLINPKYSS 514

Query: 452 GELQLF--DLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLV 509
            +   F  D   S+L+      H   ++S   + D   LV+GS DKTVK W       LV
Sbjct: 515 SQFDRFSQDNTCSTLV-----GHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALV 569

Query: 510 PGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSL 569
                        N+      N  +  V+ SP   Y A +  D T +++  D +      
Sbjct: 570 -------------NYKGH---NHPVWDVKFSPLGHYFASASHDQTARLWACDHIYPLRIF 613

Query: 570 YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN 629
            GH   V ++    +   + T S+DK  ++W +  GD  +    H   ++S +  P+   
Sbjct: 614 AGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRW 673

Query: 630 FFSCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
             + S+D V+  WD    + I+++  H ++ V +L+ + +G+ ++S   DHS+R+W+
Sbjct: 674 LATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWD 730

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 74/173 (42%), Gaps = 18/173 (10%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKF----YLS--------------LYGH 572
           N D+ S+  S D R  A    D+ +K++ LD        Y S              L GH
Sbjct: 473 NRDMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGH 532

Query: 573 KLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFS 632
              V S   S D+  +++ S DK +K+W +D      +   H   +  VKF P  H F S
Sbjct: 533 SGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFAS 592

Query: 633 CSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
            S D   + W  +    ++    H ++V  ++   +G +V + S D + R+W+
Sbjct: 593 ASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWD 645

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 98/224 (43%), Gaps = 23/224 (10%)

Query: 387 LQGQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGY---ALTCKFLPGG 442
           L G    V S   S DN  L + S + ++K+W++ TH  +  ++ G+       KF P G
Sbjct: 529 LVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYK-GHNHPVWDVKFSPLG 587

Query: 443 LLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
                 +     +L+       L  I   H   + ++    +G  + TGS+DKT + WD 
Sbjct: 588 HYFASASHDQTARLWACDHIYPL-RIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDV 646

Query: 503 QVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS 562
               ++           L L H         +LS ++SPD R+LA    D  + ++ + +
Sbjct: 647 STGDSV----------RLFLGHTAP------VLSTQVSPDGRWLATGSEDGVICLWDIGT 690

Query: 563 MKFYLSLYGH-KLPVLSIDISFDSKMIITSSADKNIKIWGLDFG 605
            K    + GH K  V S+  + +  ++I+  AD ++++W +  G
Sbjct: 691 GKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHG 734

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 67/160 (41%), Gaps = 10/160 (6%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVW- 148
           D   L  G  D  +K+W + + T L+N+ GH   +  ++F   G    S S D    +W 
Sbjct: 544 DNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLWA 603

Query: 149 -DLVGEVGLYKLRSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGEC 207
            D +  + ++   ++      F   G  ++ + S D   ++WD+ T   +   + HT   
Sbjct: 604 CDHIYPLRIFAGHTNDVDTVSFHPNGC-YVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPV 662

Query: 208 WGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEM 245
               V  D   L T S D  + +W +       G+++ +M
Sbjct: 663 LSTQVSPDGRWLATGSEDGVICLWDIG-----TGKRIKQM 697

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 49/108 (45%), Gaps = 13/108 (12%)

Query: 44  SALENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVI 103
           S+ +   +WD+ TGD V        P  S             +V  D   LA G  DGVI
Sbjct: 636 SSDKTCRMWDVSTGDSVRLFLGHTAPVLS------------TQVSPDGRWLATGSEDGVI 683

Query: 104 KVWDLVSKTVLLNFNGH-KAAITLMQFDSTGTRLISGSKDSNIIVWDL 150
            +WD+ +   +    GH K A+  + F+  G  LISG  D ++ VWD+
Sbjct: 684 CLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDV 731

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 62/130 (47%), Gaps = 8/130 (6%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH A +   Q    G  L +GS+D  
Sbjct: 623 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGV 682

Query: 145 IIVWDLVGEVGLYKLRSH-KDAITGFWCQGE-DWLVSTSKDGLIKIWDLK---TQQCIET 199
           I +WD+     + ++R H K+A+       E + L+S   D  +++WD+K   T+Q  E 
Sbjct: 683 ICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHGTTEQGPEP 742

Query: 200 HI---AHTGE 206
                AH G+
Sbjct: 743 EQPFNAHVGD 752

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 58/150 (38%), Gaps = 4/150 (2%)

Query: 94  LAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   G  + +GS D    +WD+   
Sbjct: 590 FASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTG 649

Query: 154 VGLYKLRSHKDAITGFWCQGED-WLVSTSKDGLIKIWDLKTQQCIETHIAHTGEC---WG 209
             +     H   +       +  WL + S+DG+I +WD+ T + I+    H         
Sbjct: 650 DSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLS 709

Query: 210 LAVKDDLLITTSTDSQVKIWKLNMENEKMG 239
              + ++LI+   D  V++W +     + G
Sbjct: 710 FNKEGNVLISGGADHSVRVWDVKHGTTEQG 739

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 64/174 (36%), Gaps = 23/174 (13%)

Query: 81  ECTYLEVHQDTNLLAVGYADGVIKVWDL---------VSKTVLLNFN---------GHKA 122
           + T LE   D  L A G+ D  IK+W L          S +    F+         GH  
Sbjct: 475 DMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSG 534

Query: 123 AITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAI--TGFWCQGEDWLVST 180
            +    F      L+SGS+D  + +W +     L   + H   +    F   G  +  S 
Sbjct: 535 TVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGH-YFASA 593

Query: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDD--LLITTSTDSQVKIWKLN 232
           S D   ++W       +     HT +   ++   +   + T S+D   ++W ++
Sbjct: 594 SHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVS 647

>ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 824

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 77/323 (23%), Positives = 138/323 (42%), Gaps = 40/323 (12%)

Query: 377 PAPLKTH-TIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVKTHKCIRTFECGYALT 435
           P P KT   I+L+ QR       +  DN  LA  S       N  T++ + + E  ++  
Sbjct: 452 PLPPKTTLDIKLEVQRVKESRDAIKLDNLQLALPSVCMYTFHN--TNRDMTSLE--FSDD 507

Query: 436 CKFLPGGLLVILGTRSGELQLFDLASSSL-----LDTIEDA-------HDAAIWSLDLTS 483
           C+      L   G +  +++LF L  S L      D  EDA       H   ++S   + 
Sbjct: 508 CR------LAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATSKTLVGHSGTVYSTSFSP 561

Query: 484 DGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDD 543
           D + LV+ S DKTV+ W       LV                +    N  +  V+ SP  
Sbjct: 562 DNRYLVSSSEDKTVRLWSLDTHSALV----------------SYKGHNHPVWDVKFSPLG 605

Query: 544 RYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603
            Y A +  D+T +++  D +       GH   V  +    +   + T S+DK  ++W + 
Sbjct: 606 HYFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIA 665

Query: 604 FGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH-QSEVWA 662
            GDC +        ++S    P+     + S+D ++  WD    + ++++  H ++ +++
Sbjct: 666 TGDCVRLFLGLTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYS 725

Query: 663 LAISTDGSFVVSSSHDHSIRIWE 685
           LA   +G+ ++S   DHS+R+W+
Sbjct: 726 LAYCKEGNALISGGADHSVRVWD 748

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 54/110 (49%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           +  H +   L  G +D   ++WD+ +   +  F G  A +        G  L +GS+D  
Sbjct: 641 VSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLGLTAPVISTCVSPDGRWLSTGSEDGI 700

Query: 145 IIVWDLVGEVGLYKLRSH-KDAITGF-WCQGEDWLVSTSKDGLIKIWDLK 192
           I VWD+     L ++R H K+AI    +C+  + L+S   D  +++WDLK
Sbjct: 701 INVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNALISGGADHSVRVWDLK 750

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 47/108 (43%), Gaps = 13/108 (12%)

Query: 44  SALENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVI 103
           S+ +   +WDI TGD V        P  S              V  D   L+ G  DG+I
Sbjct: 654 SSDKTCRMWDIATGDCVRLFLGLTAPVISTC------------VSPDGRWLSTGSEDGII 701

Query: 104 KVWDLVSKTVLLNFNGH-KAAITLMQFDSTGTRLISGSKDSNIIVWDL 150
            VWD+ +   L    GH K AI  + +   G  LISG  D ++ VWDL
Sbjct: 702 NVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNALISGGADHSVRVWDL 749

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 62/152 (40%), Gaps = 4/152 (2%)

Query: 94  LAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLV-G 152
            A    D   ++W       L  F GH   +  + F   G  L +GS D    +WD+  G
Sbjct: 608 FATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATG 667

Query: 153 EVGLYKLRSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAH-TGECWGLA 211
           +     L      I+        WL + S+DG+I +WD+ T + ++    H     + LA
Sbjct: 668 DCVRLFLGLTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLA 727

Query: 212 V--KDDLLITTSTDSQVKIWKLNMENEKMGEK 241
              + + LI+   D  V++W L     + G +
Sbjct: 728 YCKEGNALISGGADHSVRVWDLKKATTESGPE 759

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 63/162 (38%), Gaps = 14/162 (8%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   L     D  +++W L + + L+++ GH   +  ++F   G    + S D    +W 
Sbjct: 562 DNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPLGHYFATASHDHTARLWS 621

Query: 150 LVGEVGLYKLRSHKDAITGFWC----QGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG 205
                 +Y LR     +    C        +L + S D   ++WD+ T  C+   +  T 
Sbjct: 622 C---DHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLGLTA 678

Query: 206 ECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEM 245
                 V  D   L T S D  + +W +       G++L +M
Sbjct: 679 PVISTCVSPDGRWLSTGSEDGIINVWDIG-----TGKRLKQM 715

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 60/172 (34%), Gaps = 26/172 (15%)

Query: 81  ECTYLEVHQDTNLLAVGYADGVIKVW-----------------DLVSKTVLLNFNGHKAA 123
           + T LE   D  L A G+ D  IK++                 D  SKT++    GH   
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATSKTLV----GHSGT 553

Query: 124 ITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAI--TGFWCQGEDWLVSTS 181
           +    F      L+S S+D  + +W L     L   + H   +    F   G  +  + S
Sbjct: 554 VYSTSFSPDNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPLGH-YFATAS 612

Query: 182 KDGLIKIWDLKTQQCIETHIAHTG--ECWGLAVKDDLLITTSTDSQVKIWKL 231
            D   ++W       +     H    +C         L T S+D   ++W +
Sbjct: 613 HDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDI 664

>Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/309 (22%), Positives = 123/309 (39%), Gaps = 56/309 (18%)

Query: 387 LQGQRTDVRSIDVSDDNKLLATASNGS-LKIWNV-----KTHKCIRTFECGYA---LTCK 437
            Q    D+  +D SDD ++ A     S +KIW++          +   E  Y     TCK
Sbjct: 462 FQNTNKDMSCLDFSDDCRVAAAGFQDSYIKIWSLDGSSLNNPNIVLNNETNYKDDDPTCK 521

Query: 438 FLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTV 497
            L G                              H   ++S   + D K L++GS DKTV
Sbjct: 522 TLVG------------------------------HSGTVYSTSFSPDNKYLLSGSEDKTV 551

Query: 498 KFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKV 557
           + W       LV                +    N  +  V  SP   Y A +  D T ++
Sbjct: 552 RLWSMDTHTALV----------------SYKGHNHPVWDVNFSPLGHYFATASHDQTARL 595

Query: 558 FFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDS 617
           +  D +       GH   V  +    +   + T S+DK  ++W +  GD  +    H   
Sbjct: 596 WSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAP 655

Query: 618 IMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSS 676
           ++S+   P+     + S+D ++  WD    + ++++  H ++ +++L+ S +G+ ++S  
Sbjct: 656 VISIAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGG 715

Query: 677 HDHSIRIWE 685
            DHS+R+W+
Sbjct: 716 ADHSVRVWD 724

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 113/283 (39%), Gaps = 73/283 (25%)

Query: 369 YEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNK-LLATASNGSLKIWNVKTHKCIRT 427
           Y+  DPT     KT    L G    V S   S DNK LL+ + + ++++W++ TH  + +
Sbjct: 513 YKDDDPT----CKT----LVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVS 564

Query: 428 FECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKR 487
           ++                                          H+  +W ++ +  G  
Sbjct: 565 YK-----------------------------------------GHNHPVWDVNFSPLGHY 583

Query: 488 LVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLA 547
             T S D+T + W           + D   P+          LN D+  V   P+  YL 
Sbjct: 584 FATASHDQTARLW-----------SCDHIYPLRIF----AGHLN-DVDCVSFHPNGCYLF 627

Query: 548 ISLLDNTVKVFFL---DSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDF 604
               D T +++ +   DS++ +L   GH  PV+SI +S D + + T S D  I +W +  
Sbjct: 628 TGSSDKTCRMWNVSTGDSVRLFL---GHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGT 684

Query: 605 GDCHKSLFAH-QDSIMSVKFLPESHNFFSCSKDAVVKYWDGEK 646
           G   K +  H +++I S+ +  E +   S   D  V+ WD +K
Sbjct: 685 GKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLKK 727

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 45/101 (44%), Gaps = 13/101 (12%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           +W++ TGD V        P  S            + V  D   L+ G  DG+I VWD+ +
Sbjct: 637 MWNVSTGDSVRLFLGHTAPVIS------------IAVSPDGRWLSTGSEDGIINVWDIGT 684

Query: 111 KTVLLNFNGH-KAAITLMQFDSTGTRLISGSKDSNIIVWDL 150
              L    GH K AI  + +   G  LISG  D ++ VWDL
Sbjct: 685 GKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 725

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 65/162 (40%), Gaps = 14/162 (8%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   L  G  D  +++W + + T L+++ GH   +  + F   G    + S D    +W 
Sbjct: 538 DNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWS 597

Query: 150 LVGEVGLYKLRSHKDAITGFWC----QGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG 205
                 +Y LR     +    C        +L + S D   ++W++ T   +   + HT 
Sbjct: 598 C---DHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTA 654

Query: 206 ECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEM 245
               +AV  D   L T S D  + +W +       G++L +M
Sbjct: 655 PVISIAVSPDGRWLSTGSEDGIINVWDIG-----TGKRLKQM 691

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 55/110 (50%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           +  H +   L  G +D   ++W++ +   +  F GH A +  +     G  L +GS+D  
Sbjct: 617 VSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGI 676

Query: 145 IIVWDLVGEVGLYKLRSH-KDAITGF-WCQGEDWLVSTSKDGLIKIWDLK 192
           I VWD+     L ++R H K+AI    + +  + L+S   D  +++WDLK
Sbjct: 677 INVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 726

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 57/142 (40%), Gaps = 4/142 (2%)

Query: 94  LAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   G  L +GS D    +W++   
Sbjct: 584 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTG 643

Query: 154 VGLYKLRSHKDAITGFWCQGED-WLVSTSKDGLIKIWDLKTQQCIETHIAHTGEC---WG 209
             +     H   +       +  WL + S+DG+I +WD+ T + ++    H         
Sbjct: 644 DSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLS 703

Query: 210 LAVKDDLLITTSTDSQVKIWKL 231
            + + ++LI+   D  V++W L
Sbjct: 704 YSKEGNVLISGGADHSVRVWDL 725

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/187 (19%), Positives = 63/187 (33%), Gaps = 35/187 (18%)

Query: 79  PAECTY-----------LEVHQDTNLLAVGYADGVIKVWDL-----VSKTVLLN------ 116
           P+ C Y           L+   D  + A G+ D  IK+W L      +  ++LN      
Sbjct: 455 PSVCMYTFQNTNKDMSCLDFSDDCRVAAAGFQDSYIKIWSLDGSSLNNPNIVLNNETNYK 514

Query: 117 --------FNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAI-- 166
                     GH   +    F      L+SGS+D  + +W +     L   + H   +  
Sbjct: 515 DDDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWD 574

Query: 167 TGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG--ECWGLAVKDDLLITTSTDS 224
             F   G  +  + S D   ++W       +     H    +C         L T S+D 
Sbjct: 575 VNFSPLGH-YFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDK 633

Query: 225 QVKIWKL 231
             ++W +
Sbjct: 634 TCRMWNV 640

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 86/175 (49%), Gaps = 14/175 (8%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKF-------------YLSLYGHKLPVL 577
           N D+ S++ S D R +A    D+ +K++ LD                   +L GH  PV 
Sbjct: 472 NRDMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNTTTLIGHSGPVY 531

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDA 637
           S+  S D++ ++++S DK +++W LD   C  S   H   +  VKF P  H F + S D 
Sbjct: 532 SVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYFATVSHDQ 591

Query: 638 VVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE-ETEDQV 691
             + W  +    ++    H ++V  +A   +G++V++ S D + R+W+ +T D V
Sbjct: 592 TARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSV 646

 Score = 87.4 bits (215), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 130/295 (44%), Gaps = 46/295 (15%)

Query: 393 DVRSIDVSDDNKLLATA-SNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRS 451
           D+ S+  S+D++L+A    +  +KIW++           G  L  K         L ++S
Sbjct: 474 DMTSLQFSEDSRLVAAGFQDSHIKIWSLD----------GTPLESK---------LPSKS 514

Query: 452 GELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPG 511
            E       +++L+      H   ++S+  + D + LV+ S DKTV+ W           
Sbjct: 515 KEAS----NTTTLI-----GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSL--------- 556

Query: 512 TKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYG 571
             D F  ++          N  +  V+ SP   Y A    D T +++  D +       G
Sbjct: 557 --DTFTCLVSYKGH-----NHPVWDVKFSPLGHYFATVSHDQTARLWSCDHIYPLRIFAG 609

Query: 572 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF 631
           H   V  +    +   ++T S+DK  ++W +  GD  +    H  S++SV   P+     
Sbjct: 610 HLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLT 669

Query: 632 SCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           + S+D V+  WD    + I+++  H +S V +L+ + +G+ +VS   D S+R+W+
Sbjct: 670 TGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWD 724

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 112/240 (46%), Gaps = 24/240 (10%)

Query: 368 PYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIR 426
           P E + P S +   ++T  L G    V S+  S DN+ L +AS + ++++W++ T  C+ 
Sbjct: 505 PLESKLP-SKSKEASNTTTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLV 563

Query: 427 TFECGYALTC---KFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTS 483
           +++ G+       KF P G      +     +L+       L  I   H   +  +    
Sbjct: 564 SYK-GHNHPVWDVKFSPLGHYFATVSHDQTARLWSCDHIYPL-RIFAGHLNDVDCVAFHP 621

Query: 484 DGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDD 543
           +G  ++TGS+DKT + WD Q   ++           L L H  +      ++SV +SPD 
Sbjct: 622 NGTYVLTGSSDKTCRMWDIQTGDSV----------RLFLGHTAS------VVSVAVSPDG 665

Query: 544 RYLAISLLDNTVKVFFLDSMKFYLSLYGH-KLPVLSIDISFDSKMIITSSADKNIKIWGL 602
           R+L     D  + V+ + + K    + GH K  V S+  + +  ++++  AD+++++W L
Sbjct: 666 RWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDL 725

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 60/123 (48%), Gaps = 5/123 (4%)

Query: 88  HQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIV 147
           H +   +  G +D   ++WD+ +   +  F GH A++  +     G  L +GS+D  IIV
Sbjct: 620 HPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIV 679

Query: 148 WDLVGEVGLYKLRSH-KDAITGFWCQGE-DWLVSTSKDGLIKIWDLK---TQQCIETHIA 202
           WD+     + ++R H K A+       E + LVS   D  +++WDLK    +  +E    
Sbjct: 680 WDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDLKKFTNEPALEPEQP 739

Query: 203 HTG 205
           ++G
Sbjct: 740 YSG 742

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 50/111 (45%), Gaps = 13/111 (11%)

Query: 41  LITSALENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYAD 100
           L  S+ +   +WDI+TGD V                   A    + V  D   L  G  D
Sbjct: 627 LTGSSDKTCRMWDIQTGDSVRLFL------------GHTASVVSVAVSPDGRWLTTGSED 674

Query: 101 GVIKVWDLVSKTVLLNFNGH-KAAITLMQFDSTGTRLISGSKDSNIIVWDL 150
           GVI VWD+ +   +    GH K+A+  + F+  G  L+SG  D ++ VWDL
Sbjct: 675 GVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDL 725

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 58/136 (42%), Gaps = 4/136 (2%)

Query: 100 DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D   ++W       L  F GH   +  + F   GT +++GS D    +WD+     +   
Sbjct: 590 DQTARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLF 649

Query: 160 RSHKDAITGFWCQGED-WLVSTSKDGLIKIWDLKTQQCIETHIAHTGEC---WGLAVKDD 215
             H  ++       +  WL + S+DG+I +WD+ T + I+    H            + +
Sbjct: 650 LGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGN 709

Query: 216 LLITTSTDSQVKIWKL 231
           +L++   D  V++W L
Sbjct: 710 ILVSGGADQSVRVWDL 725

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 55/111 (49%), Gaps = 5/111 (4%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTF--ECGYALTCKFLPGGLLVILGTRSGELQLFDLASS 462
           +L  +S+ + ++W+++T   +R F       ++    P G  +  G+  G + ++D+ + 
Sbjct: 626 VLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTG 685

Query: 463 SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD---FQVEKTLVP 510
             +  +     +A+ SL    +G  LV+G AD++V+ WD   F  E  L P
Sbjct: 686 KRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDLKKFTNEPALEP 736

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 67/160 (41%), Gaps = 10/160 (6%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   L     D  +++W L + T L+++ GH   +  ++F   G    + S D    +W 
Sbjct: 538 DNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYFATVSHDQTARLWS 597

Query: 150 LVGEVGLYKLRSHKDAI--TGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGEC 207
                 L     H + +    F   G  ++++ S D   ++WD++T   +   + HT   
Sbjct: 598 CDHIYPLRIFAGHLNDVDCVAFHPNGT-YVLTGSSDKTCRMWDIQTGDSVRLFLGHTASV 656

Query: 208 WGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEM 245
             +AV  D   L T S D  + +W +       G+++ +M
Sbjct: 657 VSVAVSPDGRWLTTGSEDGVIIVWDIG-----TGKRIKQM 691

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/185 (21%), Positives = 66/185 (35%), Gaps = 33/185 (17%)

Query: 77  SKPAECTY-----------LEVHQDTNLLAVGYADGVIKVWDL---------------VS 110
           S P+ C Y           L+  +D+ L+A G+ D  IK+W L                S
Sbjct: 459 SAPSVCMYTFHNTNRDMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEAS 518

Query: 111 KTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAI--TG 168
            T  L   GH   +  + F      L+S S+D  + +W L     L   + H   +    
Sbjct: 519 NTTTL--IGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVK 576

Query: 169 FWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG--ECWGLAVKDDLLITTSTDSQV 226
           F   G  +  + S D   ++W       +     H    +C         ++T S+D   
Sbjct: 577 FSPLGH-YFATVSHDQTARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTC 635

Query: 227 KIWKL 231
           ++W +
Sbjct: 636 RMWDI 640

>YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}
           TAF5Subunit (90 kDa) of TFIID and SAGA complexes,
           involved in RNA polymerase II transcription initiation
           and in chromatin modification
          Length = 798

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 97/216 (44%), Gaps = 17/216 (7%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLEL 530
            H   ++S   + D K L++GS DKTV+ W       LV                +    
Sbjct: 523 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALV----------------SYKGH 566

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
           N  +  V  SP   Y A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 567 NHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFT 626

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
            S+DK  ++W +  GD  +    H   ++S+   P+     + S+D ++  WD    + +
Sbjct: 627 GSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRL 686

Query: 651 QKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           +++  H ++ +++L+ S +G+ ++S   DH++R+W+
Sbjct: 687 KQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWD 722

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 72/172 (41%), Gaps = 17/172 (9%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYL-----------------SLYGHK 573
           N D+  +  S D R  A    D+ +K++ LD                       +L GH 
Sbjct: 466 NKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHS 525

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
             V S   S D+K +++ S DK +++W +D      S   H   +  V F P  H F + 
Sbjct: 526 GTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATA 585

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           S D   + W  +    ++    H ++V  ++   +G +V + S D + R+W+
Sbjct: 586 SHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWD 637

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 104/265 (39%), Gaps = 65/265 (24%)

Query: 387 LQGQRTDVRSIDVSDDNK-LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLV 445
           L G    V S   S DNK LL+ + + ++++W++ TH  + +++                
Sbjct: 521 LVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYK---------------- 564

Query: 446 ILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVE 505
                                     H+  +W +  +  G    T S D+T + W     
Sbjct: 565 -------------------------GHNHPVWDVSFSPLGHYFATASHDQTARLW----- 594

Query: 506 KTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFL---DS 562
                 + D   P+          LN D+  V   P+  Y+     D T +++ +   DS
Sbjct: 595 ------SCDHIYPLRIF----AGHLN-DVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDS 643

Query: 563 MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAH-QDSIMSV 621
           ++ +L   GH  PV+SI +  D + + T S D  I +W +  G   K +  H +++I S+
Sbjct: 644 VRLFL---GHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSL 700

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEK 646
            +  E +   S   D  V+ WD +K
Sbjct: 701 SYSKEGNVLISGGADHTVRVWDLKK 725

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 61/132 (46%), Gaps = 4/132 (3%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTF--ECGYALTCKFLPGGLLVILGTRSGELQLFDLASS 462
           +   +S+ + ++W+V T   +R F       ++    P G  +  G+  G + ++D+ + 
Sbjct: 624 VFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTG 683

Query: 463 SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKL 522
             L  +      AI+SL  + +G  L++G AD TV+ WD +   T      D+  P +  
Sbjct: 684 KRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLKKATTEPSAEPDE--PFIGY 741

Query: 523 NHDTTLELNDDI 534
             D T  +N DI
Sbjct: 742 LGDVTASINQDI 753

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 44/101 (43%), Gaps = 13/101 (12%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           +WD+ TGD V        P  S            + V  D   L+ G  DG+I VWD+ +
Sbjct: 635 MWDVSTGDSVRLFLGHTAPVIS------------IAVCPDGRWLSTGSEDGIINVWDIGT 682

Query: 111 KTVLLNFNGH-KAAITLMQFDSTGTRLISGSKDSNIIVWDL 150
              L    GH K AI  + +   G  LISG  D  + VWDL
Sbjct: 683 GKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDL 723

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 65/162 (40%), Gaps = 14/162 (8%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   L  G  D  +++W + + T L+++ GH   +  + F   G    + S D    +W 
Sbjct: 536 DNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWS 595

Query: 150 LVGEVGLYKLRSHKDAITGFWC----QGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG 205
                 +Y LR     +    C        ++ + S D   ++WD+ T   +   + HT 
Sbjct: 596 C---DHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTA 652

Query: 206 ECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEM 245
               +AV  D   L T S D  + +W +       G++L +M
Sbjct: 653 PVISIAVCPDGRWLSTGSEDGIINVWDIG-----TGKRLKQM 689

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 55/110 (50%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH A +  +     G  L +GS+D  
Sbjct: 615 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGI 674

Query: 145 IIVWDLVGEVGLYKLRSH-KDAITGF-WCQGEDWLVSTSKDGLIKIWDLK 192
           I VWD+     L ++R H K+AI    + +  + L+S   D  +++WDLK
Sbjct: 675 INVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/183 (18%), Positives = 59/183 (32%), Gaps = 33/183 (18%)

Query: 79  PAECTY-----------LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFN--------- 118
           P+ C Y           L+   D  + A G+ D  IK+W L   ++              
Sbjct: 455 PSVCMYTFQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDE 514

Query: 119 --------GHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAI--TG 168
                   GH   +    F      L+SGS+D  + +W +     L   + H   +    
Sbjct: 515 DPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVS 574

Query: 169 FWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG--ECWGLAVKDDLLITTSTDSQV 226
           F   G  +  + S D   ++W       +     H    +C         + T S+D   
Sbjct: 575 FSPLGH-YFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTC 633

Query: 227 KIW 229
           ++W
Sbjct: 634 RMW 636

>KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 aa]
           {ON} highly similar to uniprot|P38011 Saccharomyces
           cerevisiae YMR116C ASC1 WD repeat protein (G-beta like
           protein) involved in translation regulation required for
           repression of Gcn4p activity in the absence of
           amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 85.9 bits (211), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 90/201 (44%), Gaps = 18/201 (8%)

Query: 508 LVPGTKDKFVPMLKLNHDTTLELNDDILSVR----------ISPDDRYLAISLLDNTVKV 557
           L+ G++DK +   KL  D   +    + S R          ++PD  Y   +  D TV++
Sbjct: 33  LLSGSRDKSLITWKLTGDDQ-QYGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDKTVRL 91

Query: 558 FFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDS 617
           + L S K      GHK  VLS+ I   +  I+++S DK +K+W    G+C  +L  H D 
Sbjct: 92  WELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNT-LGECMVTLLGHNDW 150

Query: 618 IMSVKFLP------ESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSF 671
           +  V+  P      E+    S   D VVK W+   F+       H + V  +  S DG+ 
Sbjct: 151 VSQVRVAPNETPEDETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTL 210

Query: 672 VVSSSHDHSIRIWEETEDQVF 692
           V S+  D  I +W  TE +  
Sbjct: 211 VASAGKDGQIMLWNLTEKEAL 231

 Score = 69.7 bits (169), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 78/322 (24%), Positives = 140/322 (43%), Gaps = 43/322 (13%)

Query: 387 LQGQRTDVRSIDVS--DDNKLLATASNGSLKIWNV-----KTHKCIRTFECGYALT--CK 437
           L+G    V S+  S    N LL+ + + SL  W +     +    +R+F     +   C 
Sbjct: 13  LEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCT 72

Query: 438 FLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTV 497
             P G   +  +    ++L++LAS   +      H + + S+ +     ++V+ S DKTV
Sbjct: 73  VTPDGEYALSASWDKTVRLWELASGKCIQRFV-GHKSDVLSVTIDRRASQIVSASRDKTV 131

Query: 498 KFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISP-----DDRYLAISL-L 551
           K W+   E  +                 T L  ND +  VR++P     D+    IS  +
Sbjct: 132 KVWNTLGECMV-----------------TLLGHNDWVSQVRVAPNETPEDETVTVISAGM 174

Query: 552 DNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSL 611
           D  VKV+ L S +      GH   V ++  S D  ++ ++  D  I +W L   +   +L
Sbjct: 175 DKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLWNLTEKEALYTL 234

Query: 612 FAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKL------YAHQSEVWA--L 663
            A QD + +V F P  + + + +  + +K ++ E+ + + +L      Y   +E  A  L
Sbjct: 235 NA-QDEVFAVAFSPNRY-WLTAATSSGIKIFNLEERKVVDELKPEFAGYTKAAEPHAISL 292

Query: 664 AISTDGSFVVSSSHDHSIRIWE 685
           A S DG  + +   D+ IR+W+
Sbjct: 293 AWSADGQTLFAGYTDNVIRVWQ 314

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 59/123 (47%), Gaps = 6/123 (4%)

Query: 568 SLYGHKLPVLSIDIS-FDSKMIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMSV 621
           +L GH   V S+  S     ++++ S DK++  W L      +G   +S   H   +   
Sbjct: 12  TLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDC 71

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSI 681
              P+     S S D  V+ W+    +CIQ+   H+S+V ++ I    S +VS+S D ++
Sbjct: 72  TVTPDGEYALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTV 131

Query: 682 RIW 684
           ++W
Sbjct: 132 KVW 134

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 65/141 (46%), Gaps = 10/141 (7%)

Query: 100 DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D  +++W+L S   +  F GHK+ +  +  D   ++++S S+D  + VW+ +GE  +  L
Sbjct: 86  DKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNTLGEC-MVTL 144

Query: 160 RSHKDAITGFWCQGED-------WLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAV 212
             H D ++       +        ++S   D ++K+W+L + Q     I H      +  
Sbjct: 145 LGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTA 204

Query: 213 KDD--LLITTSTDSQVKIWKL 231
             D  L+ +   D Q+ +W L
Sbjct: 205 SPDGTLVASAGKDGQIMLWNL 225

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 100/227 (44%), Gaps = 25/227 (11%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLEL 530
            H   +    +T DG+  ++ S DKTV+ W+    K +      +FV      H +    
Sbjct: 63  GHSHIVQDCTVTPDGEYALSASWDKTVRLWELASGKCI-----QRFV-----GHKS---- 108

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFD------ 584
             D+LSV I      +  +  D TVKV+     +  ++L GH   V  + ++ +      
Sbjct: 109 --DVLSVTIDRRASQIVSASRDKTVKVWNTLG-ECMVTLLGHNDWVSQVRVAPNETPEDE 165

Query: 585 SKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDG 644
           +  +I++  DK +K+W L           H + + +V   P+     S  KD  +  W+ 
Sbjct: 166 TVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLWNL 225

Query: 645 EKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQV 691
            + E +  L A Q EV+A+A S +  + ++++    I+I+   E +V
Sbjct: 226 TEKEALYTLNA-QDEVFAVAFSPN-RYWLTAATSSGIKIFNLEERKV 270

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 51/99 (51%), Gaps = 1/99 (1%)

Query: 100 DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D V+KVW+L S  +  +F GH   +  +     GT + S  KD  I++W+L  +  LY L
Sbjct: 175 DKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLWNLTEKEALYTL 234

Query: 160 RSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIE 198
            +  +     +     WL + +  G IKI++L+ ++ ++
Sbjct: 235 NAQDEVFAVAFSPNRYWLTAATSSG-IKIFNLEERKVVD 272

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 58/122 (47%), Gaps = 9/122 (7%)

Query: 117 FNGHKAAIT-LMQFDSTGTRLISGSKDSNIIVWDLVGE-----VGLYKLRSHKDAITGFW 170
             GH   +T L    +    L+SGS+D ++I W L G+     V +   R H   +    
Sbjct: 13  LEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCT 72

Query: 171 CQGE-DWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAV--KDDLLITTSTDSQVK 227
              + ++ +S S D  +++W+L + +CI+  + H  +   + +  +   +++ S D  VK
Sbjct: 73  VTPDGEYALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVK 132

Query: 228 IW 229
           +W
Sbjct: 133 VW 134

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 62/155 (40%), Gaps = 15/155 (9%)

Query: 92  NLLAVGYADGVIKVWDLVSK-----TVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNII 146
           NLL  G  D  +  W L          + +F GH   +        G   +S S D  + 
Sbjct: 31  NLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDKTVR 90

Query: 147 VWDLVGEVGLYKLRSHK-DAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG 205
           +W+L     + +   HK D ++    +    +VS S+D  +K+W+    +C+ T + H  
Sbjct: 91  LWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWN-TLGECMVTLLGHND 149

Query: 206 ECWGLAVKDD--------LLITTSTDSQVKIWKLN 232
               + V  +         +I+   D  VK+W L+
Sbjct: 150 WVSQVRVAPNETPEDETVTVISAGMDKVVKVWNLH 184

>Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON}
           YBR198C (REAL)
          Length = 802

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/301 (21%), Positives = 127/301 (42%), Gaps = 39/301 (12%)

Query: 387 LQGQRTDVRSIDVSDDNKLLATASNGS-LKIWNVKTHKCIRTFECGYALTCKFLPGGLLV 445
            Q    D+  ++ SDD ++ A     S +KIW++           G +L          +
Sbjct: 463 FQNTNKDMSCLNFSDDCRIAAAGFQDSYIKIWSLD----------GSSLNNPN------I 506

Query: 446 ILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVE 505
           +L + +   +  D    +L+      H   ++S   + D K L++GS DKTV+ W     
Sbjct: 507 MLNSANNNYRDDDPTCKTLV-----GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTH 561

Query: 506 KTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKF 565
             LV                +    N  +  V  SP   Y A +  D T +++  D +  
Sbjct: 562 TALV----------------SYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYP 605

Query: 566 YLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP 625
                GH   V  +    +   + T S+DK  ++W +  GD  +    H   ++ +   P
Sbjct: 606 LRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSP 665

Query: 626 ESHNFFSCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIW 684
           +     + S+D ++  WD    + ++++  H ++ +++L+ S +G+ ++S   DHS+R+W
Sbjct: 666 DGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVW 725

Query: 685 E 685
           +
Sbjct: 726 D 726

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/283 (22%), Positives = 111/283 (39%), Gaps = 73/283 (25%)

Query: 369 YEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNK-LLATASNGSLKIWNVKTHKCIRT 427
           Y   DPT     KT    L G    V S   S DNK LL+ + + ++++W++ TH  + +
Sbjct: 515 YRDDDPT----CKT----LVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVS 566

Query: 428 FECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKR 487
           ++                                          H+  +W ++ +  G  
Sbjct: 567 YK-----------------------------------------GHNHPVWDVNFSPLGHY 585

Query: 488 LVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLA 547
             T S D+T + W           + D   P+          LN D+  V   P+  Y+ 
Sbjct: 586 FATASHDQTARLW-----------SCDHIYPLRIF----AGHLN-DVDCVSFHPNGCYVF 629

Query: 548 ISLLDNTVKVFFL---DSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDF 604
               D T +++ +   DS++ +L   GH  PV+ I +S D + + T S D  I IW +  
Sbjct: 630 TGSSDKTCRMWDVSTGDSVRLFL---GHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGT 686

Query: 605 GDCHKSLFAH-QDSIMSVKFLPESHNFFSCSKDAVVKYWDGEK 646
           G   K +  H +++I S+ +  E +   S   D  V+ WD +K
Sbjct: 687 GKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLKK 729

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 46/101 (45%), Gaps = 13/101 (12%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           +WD+ TGD V                + P  C  + V  D   L+ G  DG+I +WD+ +
Sbjct: 639 MWDVSTGDSVRLF----------LGHTAPVIC--IAVSPDGRWLSTGSEDGIINIWDIGT 686

Query: 111 KTVLLNFNGH-KAAITLMQFDSTGTRLISGSKDSNIIVWDL 150
              L    GH K AI  + +   G  LISG  D ++ VWDL
Sbjct: 687 GKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 727

 Score = 52.4 bits (124), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 65/162 (40%), Gaps = 14/162 (8%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   L  G  D  +++W + + T L+++ GH   +  + F   G    + S D    +W 
Sbjct: 540 DNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWS 599

Query: 150 LVGEVGLYKLRSHKDAITGFWC----QGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG 205
                 +Y LR     +    C        ++ + S D   ++WD+ T   +   + HT 
Sbjct: 600 C---DHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTA 656

Query: 206 ECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEM 245
               +AV  D   L T S D  + IW +       G++L +M
Sbjct: 657 PVICIAVSPDGRWLSTGSEDGIINIWDIG-----TGKRLKQM 693

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH A +  +     G  L +GS+D  
Sbjct: 619 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGI 678

Query: 145 IIVWDLVGEVGLYKLRSH-KDAITGF-WCQGEDWLVSTSKDGLIKIWDLK 192
           I +WD+     L ++R H K+AI    + +  + L+S   D  +++WDLK
Sbjct: 679 INIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 728

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 57/142 (40%), Gaps = 4/142 (2%)

Query: 94  LAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   G  + +GS D    +WD+   
Sbjct: 586 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 645

Query: 154 VGLYKLRSHKDAITGFWCQGED-WLVSTSKDGLIKIWDLKTQQCIETHIAHTGEC---WG 209
             +     H   +       +  WL + S+DG+I IWD+ T + ++    H         
Sbjct: 646 DSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLS 705

Query: 210 LAVKDDLLITTSTDSQVKIWKL 231
            + + ++LI+   D  V++W L
Sbjct: 706 YSKEGNVLISGGADHSVRVWDL 727

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/188 (19%), Positives = 62/188 (32%), Gaps = 36/188 (19%)

Query: 79  PAECTY-----------LEVHQDTNLLAVGYADGVIKVWDL-----VSKTVLLN------ 116
           P+ C Y           L    D  + A G+ D  IK+W L      +  ++LN      
Sbjct: 456 PSVCMYTFQNTNKDMSCLNFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMLNSANNNY 515

Query: 117 ---------FNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAI- 166
                      GH   +    F      L+SGS+D  + +W +     L   + H   + 
Sbjct: 516 RDDDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVW 575

Query: 167 -TGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG--ECWGLAVKDDLLITTSTD 223
              F   G  +  + S D   ++W       +     H    +C         + T S+D
Sbjct: 576 DVNFSPLGH-YFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSD 634

Query: 224 SQVKIWKL 231
              ++W +
Sbjct: 635 KTCRMWDV 642

>TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {ON}
           Anc_8.544 YBR198C
          Length = 831

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 131/295 (44%), Gaps = 39/295 (13%)

Query: 393 DVRSIDVSDDNKLLATA-SNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRS 451
           D+ S++ SDD +L A    +  +KI+++           G +L  K      L     ++
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKIFSLD----------GSSLNSK------LTESNKKT 541

Query: 452 GELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPG 511
            +L   D ++S+L+      H   ++S   + D + LV+GS DKTV+ W      +LV  
Sbjct: 542 NKLLNNDESTSTLI-----GHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLV-- 594

Query: 512 TKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYG 571
                         +    N  +  V  SP   Y A +  D+T +++  D +       G
Sbjct: 595 --------------SYKGHNHPVWDVEFSPLGHYFATASHDHTARLWSCDHIYPLRIFAG 640

Query: 572 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF 631
           H   V  +    +   + T S+DK  ++W +  GD  +        +MS    P+     
Sbjct: 641 HLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWLS 700

Query: 632 SCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           + S+D V+  WD    + ++++  H ++ +++L+ + +G+ ++S   DHS+R+W+
Sbjct: 701 TGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWD 755

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 77/175 (44%), Gaps = 20/175 (11%)

Query: 533 DILSVRISPDDRYLAISLLDNTVKVFFLD--SMKFYLS------------------LYGH 572
           D+ S+  S D R  A    D+ +K+F LD  S+   L+                  L GH
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKLLNNDESTSTLIGH 557

Query: 573 KLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFS 632
              V S   S D++ +++ S DK +++W +D      S   H   +  V+F P  H F +
Sbjct: 558 SGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFAT 617

Query: 633 CSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEET 687
            S D   + W  +    ++    H ++V  ++   +G ++ + S D + R+W+ T
Sbjct: 618 ASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIT 672

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 58/268 (21%), Positives = 103/268 (38%), Gaps = 65/268 (24%)

Query: 384 TIELQGQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGYALTCKFLPGG 442
           T  L G    V S   S DN+ L + S + ++++W++ TH  + +++             
Sbjct: 551 TSTLIGHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYK------------- 597

Query: 443 LLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
                                        H+  +W ++ +  G    T S D T + W  
Sbjct: 598 ----------------------------GHNHPVWDVEFSPLGHYFATASHDHTARLW-- 627

Query: 503 QVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFL-- 560
                    + D   P+          LN D+  V   P+  YL     D T +++ +  
Sbjct: 628 ---------SCDHIYPLRIF----AGHLN-DVDCVSFHPNGCYLFTGSSDKTCRMWDITT 673

Query: 561 -DSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAH-QDSI 618
            DS++ +L L     PV+S  +S D + + T S D  I +W +  G   K +  H +++I
Sbjct: 674 GDSVRLFLGLTA---PVMSTSVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAI 730

Query: 619 MSVKFLPESHNFFSCSKDAVVKYWDGEK 646
            S+ +  E +   S   D  V+ WD +K
Sbjct: 731 YSLSYNKEGNVLISGGADHSVRVWDLKK 758

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 49/101 (48%), Gaps = 13/101 (12%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           +WDI TGD V  L  GL         + P   T   V  D   L+ G  DGVI VWD+ +
Sbjct: 668 MWDITTGDSVR-LFLGL---------TAPVMST--SVSPDGRWLSTGSEDGVINVWDIGT 715

Query: 111 KTVLLNFNGH-KAAITLMQFDSTGTRLISGSKDSNIIVWDL 150
              L    GH K AI  + ++  G  LISG  D ++ VWDL
Sbjct: 716 GKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDL 756

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 65/156 (41%), Gaps = 6/156 (3%)

Query: 94  LAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLV-- 151
            A    D   ++W       L  F GH   +  + F   G  L +GS D    +WD+   
Sbjct: 615 FATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTG 674

Query: 152 GEVGLYKLRSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAH-TGECWGL 210
             V L+   +     T     G  WL + S+DG+I +WD+ T + ++    H     + L
Sbjct: 675 DSVRLFLGLTAPVMSTSVSPDGR-WLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSL 733

Query: 211 AV--KDDLLITTSTDSQVKIWKLNMENEKMGEKLTE 244
           +   + ++LI+   D  V++W L     + G +  E
Sbjct: 734 SYNKEGNVLISGGADHSVRVWDLKKATTESGAEPEE 769

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 52/110 (47%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           +  H +   L  G +D   ++WD+ +   +  F G  A +        G  L +GS+D  
Sbjct: 648 VSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWLSTGSEDGV 707

Query: 145 IIVWDLVGEVGLYKLRSH-KDAITGFWCQGE-DWLVSTSKDGLIKIWDLK 192
           I VWD+     L ++R H K+AI       E + L+S   D  +++WDLK
Sbjct: 708 INVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDLK 757

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 64/162 (39%), Gaps = 14/162 (8%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   L  G  D  +++W + + T L+++ GH   +  ++F   G    + S D    +W 
Sbjct: 569 DNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFATASHDHTARLWS 628

Query: 150 LVGEVGLYKLRSHKDAITGFWC----QGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG 205
                 +Y LR     +    C        +L + S D   ++WD+ T   +   +  T 
Sbjct: 629 C---DHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTA 685

Query: 206 ECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEM 245
                +V  D   L T S D  + +W +       G++L +M
Sbjct: 686 PVMSTSVSPDGRWLSTGSEDGVINVWDIG-----TGKRLKQM 722

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 62/175 (35%), Gaps = 25/175 (14%)

Query: 81  ECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTV-------------LLNFN-------GH 120
           + T LE   D  L A G+ D  IK++ L   ++             LLN +       GH
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKLLNNDESTSTLIGH 557

Query: 121 KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAI--TGFWCQGEDWLV 178
              +    F      L+SGS+D  + +W +     L   + H   +    F   G  +  
Sbjct: 558 SGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGH-YFA 616

Query: 179 STSKDGLIKIWDLKTQQCIETHIAHTG--ECWGLAVKDDLLITTSTDSQVKIWKL 231
           + S D   ++W       +     H    +C         L T S+D   ++W +
Sbjct: 617 TASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDI 671

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 87.0 bits (214), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 114/269 (42%), Gaps = 26/269 (9%)

Query: 442 GLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD 501
           G  +  G   G +++    +  +  +I+ AH+  I  LD   DG  L++G  D  VK WD
Sbjct: 184 GQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSGGGDNLVKLWD 243

Query: 502 F------QVEKTLVPGTKDKFVPMLKLNHDTTLEL-------------------NDDILS 536
                  ++       ++ K  P  +L    + +L                   +  + +
Sbjct: 244 MTSNSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHSKAVYT 303

Query: 537 VRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKN 596
           +    D   LA + LD    ++ L S +  + L GH   +  +D S +   + T+ AD  
Sbjct: 304 IAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGT 363

Query: 597 IKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF-SCSKDAVVKYWDGEKFECIQKLYA 655
           +++W +       +L AHQ + + VKF   +  F  SC  D +V  ++ + ++ +  L  
Sbjct: 364 VRVWDIRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEG 423

Query: 656 HQSEVWALAISTDGSFVVSSSHDHSIRIW 684
           H   V+ + I+ DGS + S   D S++ W
Sbjct: 424 HTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 69/151 (45%), Gaps = 4/151 (2%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           L+ H D N L  G  D ++K+WD+ S +      GH   ++ ++   +G    S S D  
Sbjct: 221 LDWHPDGNHLLSGGGDNLVKLWDMTSNS-FEELRGHAGRVSRVKVHPSGRLAASASFDLT 279

Query: 145 IIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVSTSK-DGLIKIWDLKTQQCIETHIAH 203
            I+WDL  +V L     H  A+     Q +  L++++  D +  IWDL++ + I     H
Sbjct: 280 WILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGH 339

Query: 204 TGECWGL--AVKDDLLITTSTDSQVKIWKLN 232
            G   G+  +     L T   D  V++W + 
Sbjct: 340 AGAISGVDWSPNGYQLATAGADGTVRVWDIR 370

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 53/125 (42%), Gaps = 1/125 (0%)

Query: 80  AECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISG 139
              + ++VH    L A    D    +WDL  K  L    GH  A+  + F S G  L S 
Sbjct: 257 GRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASA 316

Query: 140 SKDSNIIVWDLVGEVGLYKLRSHKDAITGF-WCQGEDWLVSTSKDGLIKIWDLKTQQCIE 198
             D+   +WDL     + KL  H  AI+G  W      L +   DG +++WD++      
Sbjct: 317 GLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTES 376

Query: 199 THIAH 203
             +AH
Sbjct: 377 ALLAH 381

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/273 (22%), Positives = 105/273 (38%), Gaps = 34/273 (12%)

Query: 425 IRTFECGYALTCKFLPG---------GLLVILGTRSGE---LQLFDLASSSLLDTIEDAH 472
           +R F  GY+L C              G+   L  R  E   L  F+L  S L   + D H
Sbjct: 118 VRKFLVGYSLDCAARRLAAQRARQGLGVKAYLQQRRAEGKRLATFELVGSQL---VADKH 174

Query: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELND 532
              +  + +  DG++L TG    ++K         +V          +   H+       
Sbjct: 175 ---VSQVAVHRDGQQLATGCWGGSIK---------VVSCETLGIAKSIDAAHEGK----- 217

Query: 533 DILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSS 592
            I  +   PD  +L     DN VK++ + S  F   L GH   V  + +    ++  ++S
Sbjct: 218 -IGGLDWHPDGNHLLSGGGDNLVKLWDMTSNSFE-ELRGHAGRVSRVKVHPSGRLAASAS 275

Query: 593 ADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQK 652
            D    +W L+     +    H  ++ ++ F  +     S   DAV   WD    E I K
Sbjct: 276 FDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMK 335

Query: 653 LYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           L  H   +  +  S +G  + ++  D ++R+W+
Sbjct: 336 LEGHAGAISGVDWSPNGYQLATAGADGTVRVWD 368

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 62/144 (43%), Gaps = 4/144 (2%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D  LLA    D V  +WDL S   ++   GH  AI+ + +   G +L +   D  + VWD
Sbjct: 309 DGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWD 368

Query: 150 LVGEVGLYKLRSHKDAI--TGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGEC 207
           +        L +H+ A     F      +LVS   D L+ I++    Q + +   HT   
Sbjct: 369 IRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEGHTDRV 428

Query: 208 WGLAVKDD--LLITTSTDSQVKIW 229
           + + + +D   + +   D  +K W
Sbjct: 429 FTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 87/215 (40%), Gaps = 30/215 (13%)

Query: 83  TYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNG-HKAAITLMQFDSTGTRLISGSK 141
           + + VH+D   LA G   G IKV    +  +  + +  H+  I  + +   G  L+SG  
Sbjct: 176 SQVAVHRDGQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSGGG 235

Query: 142 DSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVSTSKDGLIKI-WDLKTQQCIETH 200
           D+ + +WD+       +LR H   ++         L +++   L  I WDL+ +  ++  
Sbjct: 236 DNLVKLWDMTSN-SFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQ 294

Query: 201 IAHTGECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEMGIFEKQSKQRGLK 258
             H+   + +A + D  LL +   D+   IW L     + GE +              +K
Sbjct: 295 EGHSKAVYTIAFQSDGALLASAGLDAVCAIWDL-----RSGEPI--------------MK 335

Query: 259 IEFITNASDGVSF------FYIQNADKTIETYRIR 287
           +E    A  GV +           AD T+  + IR
Sbjct: 336 LEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIR 370

>Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON}
           complement(37021..37932) [912 nt, 304 aa]
          Length = 303

 Score = 84.3 bits (207), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 67/285 (23%), Positives = 131/285 (45%), Gaps = 29/285 (10%)

Query: 345 TVTSSKLELVVTTSNNTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNK 404
           T+T+ K +L+    +  ++ Y I     + T+P P+ +     +G R +V S+   +DN+
Sbjct: 39  TITNDK-KLLAAAGHQNVKLYDI-----NTTNPNPVAS----FEGHRGNVTSLSFQNDNR 88

Query: 405 LLATAS-NGSLKIWNVKTHKCIRTFECGYALT-CKFLPGGLLVILGTRSGELQLFDLASS 462
            + T+S +G++K+W+V++    RT++    +      P    +I   R G ++++DL  +
Sbjct: 89  WMVTSSEDGTIKVWDVRSPSVPRTYKHNAPVNEVAIHPNQGELISCDRDGNIRIWDLGEN 148

Query: 463 SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKD--KFVPML 520
                +    D  + SL L +DG  LV  ++      W+       +P   D     P+ 
Sbjct: 149 QCTHQLTPEDDTPVQSLSLATDGSMLVAANSKGNCYVWE-------MPNRTDASNLKPVT 201

Query: 521 KLN-HDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLD-SMKFYLSLYGHKLPVLS 578
           K   HD        I  + +S D ++LA    D+T +++ +D +   + +L GH+  V  
Sbjct: 202 KFRAHDAY------ITRILLSSDVKFLATCSADHTARIWSIDDNFNLHTTLDGHQRWVWD 255

Query: 579 IDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623
              S DS  +IT+S+D  +++W L   +  +    H    + V  
Sbjct: 256 CAFSADSAYLITASSDHYVRLWDLSTREIVRQYSGHHKGAVCVAL 300

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/292 (22%), Positives = 120/292 (41%), Gaps = 29/292 (9%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGG---LLVILGTRSGELQLFDLAS 461
           L++   + +++ W   T  C RT +   +   +        LL   G ++ +L   +  +
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLTITNDKKLLAAAGHQNVKLYDINTTN 64

Query: 462 SSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLK 521
            + + + E  H   + SL   +D + +VT S D T+K WD  V    VP T     P   
Sbjct: 65  PNPVASFE-GHRGNVTSLSFQNDNRWMVTSSEDGTIKVWD--VRSPSVPRTYKHNAP--- 118

Query: 522 LNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHK-LPVLSID 580
                       +  V I P+   L     D  ++++ L   +    L      PV S+ 
Sbjct: 119 ------------VNEVAIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPVQSLS 166

Query: 581 ISFDSKMIITSSADKNIKIWGLDFGDCHKSL-----FAHQDSIMSVKFLPESHNFFS-CS 634
           ++ D  M++ +++  N  +W +       +L     F   D+ ++   L     F + CS
Sbjct: 167 LATDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRAHDAYITRILLSSDVKFLATCS 226

Query: 635 KDAVVKYWD-GEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
            D   + W   + F     L  HQ  VW  A S D ++++++S DH +R+W+
Sbjct: 227 ADHTARIWSIDDNFNLHTTLDGHQRWVWDCAFSADSAYLITASSDHYVRLWD 278

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 88/214 (41%), Gaps = 17/214 (7%)

Query: 80  AECTYLEVHQDTNLLAVGYADGVIKVWDL--VSKTVLLNFNGHKAAITLMQFDSTGTRLI 137
           ++   L +  D  LLA      V K++D+   +   + +F GH+  +T + F +    ++
Sbjct: 33  SQVNRLTITNDKKLLAAAGHQNV-KLYDINTTNPNPVASFEGHRGNVTSLSFQNDNRWMV 91

Query: 138 SGSKDSNIIVWDLVGE--VGLYKLRSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQ 195
           + S+D  I VWD+        YK  +  + +     QGE  L+S  +DG I+IWDL   Q
Sbjct: 92  TSSEDGTIKVWDVRSPSVPRTYKHNAPVNEVAIHPNQGE--LISCDRDGNIRIWDLGENQ 149

Query: 196 CIETHIAHTG---ECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGEKLTEMGIFEKQS 252
           C            +   LA    +L+  ++     +W+  M N      L  +  F    
Sbjct: 150 CTHQLTPEDDTPVQSLSLATDGSMLVAANSKGNCYVWE--MPNRTDASNLKPVTKFRAHD 207

Query: 253 KQRGLKIEFITNASDGVSFFYIQNADKTIETYRI 286
                 I  I  +SD V F    +AD T   + I
Sbjct: 208 AY----ITRILLSSD-VKFLATCSADHTARIWSI 236

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 58/110 (52%), Gaps = 3/110 (2%)

Query: 584 DSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSCSKDAVVKY 641
           + K ++ ++  +N+K++ ++  + +   S   H+ ++ S+ F  ++    + S+D  +K 
Sbjct: 42  NDKKLLAAAGHQNVKLYDINTTNPNPVASFEGHRGNVTSLSFQNDNRWMVTSSEDGTIKV 101

Query: 642 WDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQV 691
           WD  +   + + Y H + V  +AI  +   ++S   D +IRIW+  E+Q 
Sbjct: 102 WD-VRSPSVPRTYKHNAPVNEVAIHPNQGELISCDRDGNIRIWDLGENQC 150

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 78/203 (38%), Gaps = 25/203 (12%)

Query: 41  LITSALEN-VNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYA 99
           ++TS+ +  + +WD+++  +  T     P                + +H +   L     
Sbjct: 90  MVTSSEDGTIKVWDVRSPSVPRTYKHNAP-------------VNEVAIHPNQGELISCDR 136

Query: 100 DGVIKVWDLVSKTVLLNFNGHK-AAITLMQFDSTGTRLISGSKDSNIIVWDLVGEV---- 154
           DG I++WDL                +  +   + G+ L++ +   N  VW++        
Sbjct: 137 DGNIRIWDLGENQCTHQLTPEDDTPVQSLSLATDGSMLVAANSKGNCYVWEMPNRTDASN 196

Query: 155 --GLYKLRSHKDAITGFWCQGE-DWLVSTSKDGLIKIWDLKTQQCIETHI-AHTGECWGL 210
              + K R+H   IT      +  +L + S D   +IW +     + T +  H    W  
Sbjct: 197 LKPVTKFRAHDAYITRILLSSDVKFLATCSADHTARIWSIDDNFNLHTTLDGHQRWVWDC 256

Query: 211 AVKDD--LLITTSTDSQVKIWKL 231
           A   D   LIT S+D  V++W L
Sbjct: 257 AFSADSAYLITASSDHYVRLWDL 279

>SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {ON}
           similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198C TAF5 Subunit (90 kDa) of TFIID and SAGA
           complexes involved in RNA polymerase II transcription
           initiation and in chromatin modification
          Length = 749

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 62/277 (22%), Positives = 115/277 (41%), Gaps = 31/277 (11%)

Query: 424 CIRTFE-CGYALTC-KFLPGGLLVILGTRSGELQLFDLASSSLLDTIED----------- 470
           C+ TF      +TC +F     L   G +   ++L+ L  + L   +             
Sbjct: 413 CMYTFHNTNRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTL 472

Query: 471 -AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLE 529
             H   ++S   + D K L++ S DKTV+ W      +LV                +   
Sbjct: 473 IGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLV----------------SYKG 516

Query: 530 LNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMII 589
            N  +  V  SP   Y A +  D T +++  D +       GH   V  +    +   + 
Sbjct: 517 HNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVF 576

Query: 590 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFEC 649
           T S DK  ++W +  GD  +    H   ++S    P+     + S+D ++  WD    + 
Sbjct: 577 TGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKR 636

Query: 650 IQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           ++++  H ++ V++L+ S +G+ +VS   DHS+R+W+
Sbjct: 637 LKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWD 673

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 46/101 (45%), Gaps = 13/101 (12%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           +WDI TGD V        P  S A            V  D   L+ G  DG+I VWD+ +
Sbjct: 586 MWDIGTGDSVRLFLGHTAPVISTA------------VSPDGRWLSTGSEDGIINVWDIGT 633

Query: 111 KTVLLNFNGH-KAAITLMQFDSTGTRLISGSKDSNIIVWDL 150
              L    GH K A+  + +   GT L+SG  D ++ VWDL
Sbjct: 634 GKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDL 674

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 68/151 (45%), Gaps = 5/151 (3%)

Query: 387 LQGQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTF--ECGYALTCKFLPGGL 443
             G   DV  +    +   + T S + + ++W++ T   +R F       ++    P G 
Sbjct: 556 FAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGR 615

Query: 444 LVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQ 503
            +  G+  G + ++D+ +   L  +      A++SL  + +G  LV+G AD +V+ WD +
Sbjct: 616 WLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLK 675

Query: 504 VEKTLVPGTKDKFVPMLKLNHDTTLELNDDI 534
              T  P T+ +  P      D T  +N+DI
Sbjct: 676 -RSTAEPNTEPE-QPFTSYFGDATTSVNNDI 704

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 60/142 (42%), Gaps = 4/142 (2%)

Query: 94  LAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDL-VG 152
            A    D   ++W       L  F GH   +  + F   GT + +GS D    +WD+  G
Sbjct: 533 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTG 592

Query: 153 EVGLYKLRSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAH-TGECWGLA 211
           +     L      I+        WL + S+DG+I +WD+ T + ++    H     + L+
Sbjct: 593 DSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLS 652

Query: 212 VKDD--LLITTSTDSQVKIWKL 231
              +  +L++   D  V++W L
Sbjct: 653 YSKEGTVLVSGGADHSVRVWDL 674

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 52/110 (47%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           +  H +   +  G  D   ++WD+ +   +  F GH A +        G  L +GS+D  
Sbjct: 566 VSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGI 625

Query: 145 IIVWDLVGEVGLYKLRSH-KDAITGF-WCQGEDWLVSTSKDGLIKIWDLK 192
           I VWD+     L ++R H K+A+    + +    LVS   D  +++WDLK
Sbjct: 626 INVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLK 675

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 63/160 (39%), Gaps = 10/160 (6%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   L     D  +++W + + + L+++ GH   +  + F   G    + S D    +W 
Sbjct: 487 DNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWS 546

Query: 150 LVGEVGLYKLRSHKDAI--TGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGEC 207
                 L     H + +    F   G  ++ + S D   ++WD+ T   +   + HT   
Sbjct: 547 CDHIYPLRIFAGHLNDVDCVSFHPNGT-YVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPV 605

Query: 208 WGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEM 245
              AV  D   L T S D  + +W +       G++L +M
Sbjct: 606 ISTAVSPDGRWLSTGSEDGIINVWDIG-----TGKRLKQM 640

 Score = 36.2 bits (82), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 52/132 (39%), Gaps = 16/132 (12%)

Query: 114 LLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRS-HKDAITGFWCQ 172
           +  F+     +T ++F    T   +G +DS I +W L G     KL S  ++ I      
Sbjct: 414 MYTFHNTNRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLI 473

Query: 173 GED-------------WLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKD--DLL 217
           G               +L+S S+D  +++W + T   + ++  H    W ++        
Sbjct: 474 GHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYF 533

Query: 218 ITTSTDSQVKIW 229
            T S D   ++W
Sbjct: 534 ATASHDQTARLW 545

>NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 103/231 (44%), Gaps = 22/231 (9%)

Query: 470 DAHDAAIWSLDLTSDGKR--LVTGSADKTVKFWDFQVEKTLVPGTKDKF-VPMLKLNHDT 526
           + H+  + SL  TS G+   L++GS DKT+  W          G   KF VP+      +
Sbjct: 14  EGHNGWVTSL-ATSAGQPNLLLSGSRDKTLISWKLT-------GDDQKFGVPVRSFKGHS 65

Query: 527 TLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
            +     +    ++ D  Y   +  D T++++ + + + Y    GHK  V+S+ I   + 
Sbjct: 66  HI-----VQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKAS 120

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN-----FFSCSKDAVVKY 641
           MII+ S DK IK+W +  G C  +L  H D +  V+  P   N       S   D +VK 
Sbjct: 121 MIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKA 179

Query: 642 WDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQVF 692
           W+  +F+       H   V A+  S DG+ + S+  D  I +W   E +  
Sbjct: 180 WNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAM 230

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 101/243 (41%), Gaps = 40/243 (16%)

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVEKT----------------------LVPGTKDKFVP 518
           LT DG   ++ S DKT++ WD    +T                      ++ G++DK + 
Sbjct: 73  LTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIK 132

Query: 519 MLKLNHD---TTLELNDDILSVRISP----DDRYLAISLL-DNTVKVFFLDSMKFYLSLY 570
           +  +      T L  ND +  VRI+P    DD    IS   D  VK + L+  +      
Sbjct: 133 VWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFV 192

Query: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNF 630
           GH   V ++  S D  +I ++  D  I +W L       +L A QD + S+ F P  + +
Sbjct: 193 GHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSA-QDEVFSLAFSPNRY-W 250

Query: 631 FSCSKDAVVKYWDGEKFECIQKL------YAHQSEVWA--LAISTDGSFVVSSSHDHSIR 682
            + +  + +K +  +    I  L      Y   +E  A  LA S DG  + +   D  IR
Sbjct: 251 LAAATASGIKIFCLDPQSLIDDLRPEFAGYNKSAEPHAVSLAWSADGQTLFAGYTDSVIR 310

Query: 683 IWE 685
           +W+
Sbjct: 311 VWQ 313

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 62/140 (44%), Gaps = 9/140 (6%)

Query: 100 DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D  +++WD+ +      F GHK+ +  +  D   + +ISGS+D  I VW + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 160 RSHKDAITGFWCQGEDW------LVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVK 213
             H D ++       D       ++S   D ++K W+L   Q     + H G    +   
Sbjct: 145 LGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTAS 204

Query: 214 DD--LLITTSTDSQVKIWKL 231
            D  L+ +   D ++ +W L
Sbjct: 205 PDGTLIASAGKDGEIMLWNL 224

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 55/123 (44%), Gaps = 6/123 (4%)

Query: 568 SLYGHKLPVLSIDISF-DSKMIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMSV 621
           +L GH   V S+  S     ++++ S DK +  W L      FG   +S   H   +   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSI 681
               +     S S D  ++ WD    E  Q+   H+S+V ++AI    S ++S S D +I
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTI 131

Query: 682 RIW 684
           ++W
Sbjct: 132 KVW 134

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 47/99 (47%), Gaps = 1/99 (1%)

Query: 100 DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D ++K W+L    +  +F GH   +  +     GT + S  KD  I++W+L  +  +Y L
Sbjct: 174 DKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTL 233

Query: 160 RSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIE 198
            +  +  +  +     WL + +  G IKI+ L  Q  I+
Sbjct: 234 SAQDEVFSLAFSPNRYWLAAATASG-IKIFCLDPQSLID 271

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 57/124 (45%), Gaps = 13/124 (10%)

Query: 119 GHKAAIT-LMQFDSTGTRLISGSKDSNIIVWDLVGE-----VGLYKLRSHKDAITGFWC- 171
           GH   +T L         L+SGS+D  +I W L G+     V +   + H   +    C 
Sbjct: 15  GHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQD--CT 72

Query: 172 --QGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAV--KDDLLITTSTDSQVK 227
             Q   + +S S D  +++WD+ T +  +  + H  +   +A+  K  ++I+ S D  +K
Sbjct: 73  LTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIK 132

Query: 228 IWKL 231
           +W +
Sbjct: 133 VWTI 136

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 63/156 (40%), Gaps = 18/156 (11%)

Query: 92  NLLAVGYADGVIKVWDLVS-----KTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNII 146
           NLL  G  D  +  W L          + +F GH   +        G   +S S D  + 
Sbjct: 31  NLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLR 90

Query: 147 VWDLVGEVGLYKLRSHK-DAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG 205
           +WD+       +   HK D ++    +    ++S S+D  IK+W +K  QC+ T + H  
Sbjct: 91  LWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHND 149

Query: 206 ECWGLAVK-------DDL--LITTSTDSQVKIWKLN 232
             W   V+       DD   +I+   D  VK W LN
Sbjct: 150 --WVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLN 183

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 56/122 (45%), Gaps = 12/122 (9%)

Query: 389 GQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALTCKFLPGGLLVI 446
           G   +V ++  S D  L+A+A  +G + +WN+   K + T        +  F P    + 
Sbjct: 193 GHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEVFSLAFSPNRYWLA 252

Query: 447 LGTRSGELQLFDLASSSLLDTI--------EDAHDAAIWSLDLTSDGKRLVTGSADKTVK 498
             T SG +++F L   SL+D +        + A   A+ SL  ++DG+ L  G  D  ++
Sbjct: 253 AATASG-IKIFCLDPQSLIDDLRPEFAGYNKSAEPHAV-SLAWSADGQTLFAGYTDSVIR 310

Query: 499 FW 500
            W
Sbjct: 311 VW 312

>Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 96/216 (44%), Gaps = 17/216 (7%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLEL 530
            H   +++   + D K L++GS DKTV+ W       LV                +    
Sbjct: 525 GHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALV----------------SYKGH 568

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
           N  +  V  SP   Y A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 569 NHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFT 628

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
            S+DK  ++W +  GD  +    H   ++ +   P+     + S+D ++  WD    + +
Sbjct: 629 GSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRL 688

Query: 651 QKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           +++  H ++ +++L+ S +G+ ++S   DHS+R+W+
Sbjct: 689 KQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWD 724

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 72/176 (40%), Gaps = 21/176 (11%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYL---------------------SL 569
           N D+  +  S D R  A    D+ +K++ LD                           +L
Sbjct: 464 NKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMPNINNSDHKDADDPTCKTL 523

Query: 570 YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN 629
            GH   V +   S D+K +++ S DK +++W +D      S   H   +  V F P  H 
Sbjct: 524 VGHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHY 583

Query: 630 FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           F + S D   + W  +    ++    H ++V  ++   +G +V + S D + R+W+
Sbjct: 584 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWD 639

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 105/265 (39%), Gaps = 65/265 (24%)

Query: 387 LQGQRTDVRSIDVSDDNK-LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLV 445
           L G    V +   S DNK LL+ + + ++++W++ TH  + +++                
Sbjct: 523 LVGHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYK---------------- 566

Query: 446 ILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVE 505
                                     H+  +W ++ +  G    T S D+T + W     
Sbjct: 567 -------------------------GHNHPVWDVNFSPLGHYFATASHDQTARLW----- 596

Query: 506 KTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFL---DS 562
                 + D   P+          LN D+  V   P+  Y+     D T +++ +   DS
Sbjct: 597 ------SCDHIYPLRIF----AGHLN-DVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDS 645

Query: 563 MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAH-QDSIMSV 621
           ++ +L   GH  PV+ I +S D + + T S D  I IW +  G   K +  H +++I S+
Sbjct: 646 VRLFL---GHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSL 702

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEK 646
            +  E +   S   D  V+ WD +K
Sbjct: 703 SYSKEGNVLISGGADHSVRVWDLKK 727

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 46/101 (45%), Gaps = 13/101 (12%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           +WD+ TGD V                + P  C  + V  D   L+ G  DG+I +WD+ +
Sbjct: 637 MWDVSTGDSVRLF----------LGHTAPVIC--IAVSPDGRWLSTGSEDGIINIWDIGT 684

Query: 111 KTVLLNFNGH-KAAITLMQFDSTGTRLISGSKDSNIIVWDL 150
              L    GH K AI  + +   G  LISG  D ++ VWDL
Sbjct: 685 GKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 725

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 65/162 (40%), Gaps = 14/162 (8%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   L  G  D  +++W + + T L+++ GH   +  + F   G    + S D    +W 
Sbjct: 538 DNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWS 597

Query: 150 LVGEVGLYKLRSHKDAITGFWC----QGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG 205
                 +Y LR     +    C        ++ + S D   ++WD+ T   +   + HT 
Sbjct: 598 C---DHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTA 654

Query: 206 ECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEM 245
               +AV  D   L T S D  + IW +       G++L +M
Sbjct: 655 PVICIAVSPDGRWLSTGSEDGIINIWDIG-----TGKRLKQM 691

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH A +  +     G  L +GS+D  
Sbjct: 617 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGI 676

Query: 145 IIVWDLVGEVGLYKLRSH-KDAITGF-WCQGEDWLVSTSKDGLIKIWDLK 192
           I +WD+     L ++R H K+AI    + +  + L+S   D  +++WDLK
Sbjct: 677 INIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 726

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 57/142 (40%), Gaps = 4/142 (2%)

Query: 94  LAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   G  + +GS D    +WD+   
Sbjct: 584 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 643

Query: 154 VGLYKLRSHKDAITGFWCQGED-WLVSTSKDGLIKIWDLKTQQCIETHIAHTGEC---WG 209
             +     H   +       +  WL + S+DG+I IWD+ T + ++    H         
Sbjct: 644 DSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLS 703

Query: 210 LAVKDDLLITTSTDSQVKIWKL 231
            + + ++LI+   D  V++W L
Sbjct: 704 YSKEGNVLISGGADHSVRVWDL 725

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 36/191 (18%), Positives = 61/191 (31%), Gaps = 45/191 (23%)

Query: 79  PAECTY-----------LEVHQDTNLLAVGYADGVIKVW--------------------- 106
           P+ C Y           L+   D  + A G+ D  IK+W                     
Sbjct: 453 PSVCMYTFQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMPNINNSDH 512

Query: 107 ----DLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSH 162
               D   KT++    GH   +    F      L+SGS+D  + +W +     L   + H
Sbjct: 513 KDADDPTCKTLV----GHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGH 568

Query: 163 KDAI--TGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG--ECWGLAVKDDLLI 218
              +    F   G  +  + S D   ++W       +     H    +C         + 
Sbjct: 569 NHPVWDVNFSPLGH-YFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVF 627

Query: 219 TTSTDSQVKIW 229
           T S+D   ++W
Sbjct: 628 TGSSDKTCRMW 638

>KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 826

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 109/237 (45%), Gaps = 11/237 (4%)

Query: 454 LQLFDLASSSLLDTIEDAHD--AAIWSLDLTSDGKRLVTGSADKTVKFW--DFQVEKTLV 509
           +QL +L +S+    +   H+    +  ++ + D +    G  D T+K W  D    ++++
Sbjct: 477 IQLKNLQTSAPSVCMYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSIL 536

Query: 510 PG-TKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLS 568
           P   KD+       N  T +  +  + SV  SPD+RYL  +  D TV+++ LD+    + 
Sbjct: 537 PSKAKDQS------NSATLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVC 590

Query: 569 LYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESH 628
             GH  PV  +  S      IT+S D+  ++W  D     +    H + +    F P   
Sbjct: 591 YKGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGC 650

Query: 629 NFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
             F+ S D   + WD +  + ++    H S V AL +S DG ++ + S D +I +W+
Sbjct: 651 YVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWD 707

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 80/175 (45%), Gaps = 14/175 (8%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFY-------------LSLYGHKLPVL 577
           N ++  V  S D R  A    D+T+KV++LD                   +L GH  PV 
Sbjct: 498 NGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVY 557

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDA 637
           S+  S D++ ++++S DK +++W LD   C      H   +  VKF P  H F + S D 
Sbjct: 558 SVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQ 617

Query: 638 VVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE-ETEDQV 691
             + W  +    ++    H ++V       +G +V + S D + R+W+ +T D V
Sbjct: 618 TARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSV 672

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 68/327 (20%), Positives = 135/327 (41%), Gaps = 48/327 (14%)

Query: 377 PAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVKTHK---CIRTFE-CGY 432
           P P+KT T++L+ +   VR              S  S+++ N++T     C+ TF     
Sbjct: 454 PLPVKT-TLDLKMEIQKVRE-------------SRDSIQLKNLQTSAPSVCMYTFHNTNG 499

Query: 433 ALTC-KFLPGGLLVILGTRSGELQLFDLASSSLLDTIED------------AHDAAIWSL 479
            +TC +F     L   G +   ++++ L  S L   +               H   ++S+
Sbjct: 500 NMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSV 559

Query: 480 DLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRI 539
             + D + L++ S DKTV+ W       LV              H      N  +  V+ 
Sbjct: 560 AFSPDNRYLLSASEDKTVRLWSLDTFTCLV----------CYKGH------NHPVWYVKF 603

Query: 540 SPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKI 599
           SP   Y   +  D T +++  D +       GH   V       +   + T S+DK  ++
Sbjct: 604 SPLGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRM 663

Query: 600 WGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH-QS 658
           W +  GD  +    H   + +++  P+     + S+D  +  WD    + I+++  H ++
Sbjct: 664 WDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKN 723

Query: 659 EVWALAISTDGSFVVSSSHDHSIRIWE 685
            ++++  + +G+ +V+   D S+R+W+
Sbjct: 724 PIYSITFNKEGNCLVTGGADQSVRVWD 750

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 105/227 (46%), Gaps = 23/227 (10%)

Query: 381 KTHTIELQGQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGYALTC--- 436
           ++++  L G    V S+  S DN+ L +AS + ++++W++ T  C+  ++ G+       
Sbjct: 543 QSNSATLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYK-GHNHPVWYV 601

Query: 437 KFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKT 496
           KF P G   I  +     +L+       L  I   H   +       +G  + TGS+DKT
Sbjct: 602 KFSPLGHYFITASHDQTARLWSCDHIYPL-RIFSGHLNDVDCSTFHPNGCYVFTGSSDKT 660

Query: 497 VKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVK 556
            + WD Q   ++           L L H +       + ++ +SPD R+L     D T+ 
Sbjct: 661 CRMWDIQTGDSV----------RLFLGHTSP------VTALEVSPDGRWLTTGSEDGTII 704

Query: 557 VFFLDSMKFYLSLYGH-KLPVLSIDISFDSKMIITSSADKNIKIWGL 602
           V+ + + K    + GH K P+ SI  + +   ++T  AD+++++W +
Sbjct: 705 VWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDI 751

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 88  HQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIV 147
           H +   +  G +D   ++WD+ +   +  F GH + +T ++    G  L +GS+D  IIV
Sbjct: 646 HPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIV 705

Query: 148 WDLVGEVGLYKLRSH-KDAITGFWCQGE-DWLVSTSKDGLIKIWDLK 192
           WD+     + +++ H K+ I       E + LV+   D  +++WD+K
Sbjct: 706 WDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIK 752

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 48/108 (44%), Gaps = 13/108 (12%)

Query: 44  SALENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVI 103
           S+ +   +WDI+TGD V        P             T LEV  D   L  G  DG I
Sbjct: 656 SSDKTCRMWDIQTGDSVRLFLGHTSP------------VTALEVSPDGRWLTTGSEDGTI 703

Query: 104 KVWDLVSKTVLLNFNGH-KAAITLMQFDSTGTRLISGSKDSNIIVWDL 150
            VWD+ +   +    GH K  I  + F+  G  L++G  D ++ VWD+
Sbjct: 704 IVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDI 751

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 65/162 (40%), Gaps = 14/162 (8%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   L     D  +++W L + T L+ + GH   +  ++F   G   I+ S D    +W 
Sbjct: 564 DNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWS 623

Query: 150 LVGEVGLYKLRSHKDAITGFWCQ----GEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG 205
                 +Y LR     +    C        ++ + S D   ++WD++T   +   + HT 
Sbjct: 624 C---DHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTS 680

Query: 206 ECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEM 245
               L V  D   L T S D  + +W +       G+++ +M
Sbjct: 681 PVTALEVSPDGRWLTTGSEDGTIIVWDIG-----TGKRIKQM 717

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 56/136 (41%), Gaps = 4/136 (2%)

Query: 100 DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D   ++W       L  F+GH   +    F   G  + +GS D    +WD+     +   
Sbjct: 616 DQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLF 675

Query: 160 RSHKDAITGFWCQGED-WLVSTSKDGLIKIWDLKTQQCIETHIAH-TGECWGLAV--KDD 215
             H   +T      +  WL + S+DG I +WD+ T + I+    H     + +    + +
Sbjct: 676 LGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGN 735

Query: 216 LLITTSTDSQVKIWKL 231
            L+T   D  V++W +
Sbjct: 736 CLVTGGADQSVRVWDI 751

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 66/136 (48%), Gaps = 12/136 (8%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFL---PGGLLVILGTRSGELQLFDLAS 461
           +   +S+ + ++W+++T   +R F  G+      L   P G  +  G+  G + ++D+ +
Sbjct: 652 VFTGSSDKTCRMWDIQTGDSVRLF-LGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGT 710

Query: 462 SSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLK 521
              +  ++      I+S+    +G  LVTG AD++V+ WD +   T  PG +    P  +
Sbjct: 711 GKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIK-RFTNEPGME----PEQQ 765

Query: 522 LN---HDTTLELNDDI 534
            N    D  L +N+DI
Sbjct: 766 FNTYSGDMELSVNNDI 781

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 51/132 (38%), Gaps = 16/132 (12%)

Query: 114 LLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGE------VGLYKLRSHKDAIT 167
           +  F+     +T ++F        +G +DS I VW L G           K +S+   + 
Sbjct: 491 MYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLV 550

Query: 168 GF--------WCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKD--DLL 217
           G         +     +L+S S+D  +++W L T  C+  +  H    W +         
Sbjct: 551 GHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYF 610

Query: 218 ITTSTDSQVKIW 229
           IT S D   ++W
Sbjct: 611 ITASHDQTARLW 622

>Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa]
           {ON} complement(112044..114575) [2532 nt, 844 aa]
          Length = 843

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 98/216 (45%), Gaps = 17/216 (7%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLEL 530
            H  A++S   + D K L++GS DKTV+ W    + TLV                +    
Sbjct: 561 GHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLV----------------SYKGH 604

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
           N  +  V  SP   Y A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 605 NHPVWDVAFSPMGHYFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFT 664

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
            S+DK  ++W +  G+  +    H   ++S+   P+     S S+D ++  WD    + +
Sbjct: 665 GSSDKTCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWDIGSGKRL 724

Query: 651 QKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           +++  H ++ V ++  S +G+ ++S   D+S+R+W+
Sbjct: 725 KQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWD 760

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 89/227 (39%), Gaps = 17/227 (7%)

Query: 476 IWSLDLTSDGKRLVTGSADKTVKFW--DFQVEKTLVPGTKDKFVP--------MLKLNHD 525
           + SLD + D +    G  D  +K W  D     TL       F            K  H 
Sbjct: 491 MLSLDFSDDCRLAAAGFQDSYIKIWSLDGSSLDTLTSTNNTHFTKKNTADNNLHSKKKHQ 550

Query: 526 TTLELNDDIL-------SVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLS 578
             +  N  ++       S   SPD++ L     D TV+++ +D+    +S  GH  PV  
Sbjct: 551 EHVNTNTKLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWD 610

Query: 579 IDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAV 638
           +  S       T+S D+  ++W  D     +    H   +  V F P     F+ S D  
Sbjct: 611 VAFSPMGHYFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKT 670

Query: 639 VKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
            + WD    E ++    H + V +L +S DG ++ S S D  I +W+
Sbjct: 671 CRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWD 717

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 47/101 (46%), Gaps = 13/101 (12%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           +WD+ TG+ V        P  S            L V  D   LA G  DG+I VWD+ S
Sbjct: 673 MWDVSTGETVRLFLGHTAPVVS------------LGVSPDGRWLASGSEDGLINVWDIGS 720

Query: 111 KTVLLNFNGH-KAAITLMQFDSTGTRLISGSKDSNIIVWDL 150
              L    GH + A+  + F   GT +ISG  D+++ VWD+
Sbjct: 721 GKRLKQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWDM 761

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 65/149 (43%), Gaps = 6/149 (4%)

Query: 94  LAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDL-VG 152
            A    D   ++W       L  F GH + +  + F   G  + +GS D    +WD+  G
Sbjct: 620 FATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWDVSTG 679

Query: 153 E-VGLYKLRSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLA 211
           E V L+   +      G    G  WL S S+DGLI +WD+ + + ++    H        
Sbjct: 680 ETVRLFLGHTAPVVSLGVSPDGR-WLASGSEDGLINVWDIGSGKRLKQMRGHGRNAVNSI 738

Query: 212 V---KDDLLITTSTDSQVKIWKLNMENEK 237
           V   +  ++I+  TD+ V++W +   N +
Sbjct: 739 VFSQEGTVIISGGTDNSVRVWDMYKSNNE 767

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 71/164 (43%), Gaps = 18/164 (10%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D  LL  G  D  +++W + +++ L+++ GH   +  + F   G    + S D    +W 
Sbjct: 574 DNKLLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWDVAFSPMGHYFATASHDQTARLWS 633

Query: 150 LVGEVGLYKLR------SHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAH 203
                 +Y LR      S  D +T F   G  ++ + S D   ++WD+ T + +   + H
Sbjct: 634 C---DHIYSLRIFAGHLSDVDCVT-FHPNGC-YVFTGSSDKTCRMWDVSTGETVRLFLGH 688

Query: 204 TGECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEM 245
           T     L V  D   L + S D  + +W +       G++L +M
Sbjct: 689 TAPVVSLGVSPDGRWLASGSEDGLINVWDIG-----SGKRLKQM 727

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 2/106 (1%)

Query: 88  HQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIV 147
           H +   +  G +D   ++WD+ +   +  F GH A +  +     G  L SGS+D  I V
Sbjct: 656 HPNGCYVFTGSSDKTCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINV 715

Query: 148 WDLVGEVGLYKLRSH-KDAITGF-WCQGEDWLVSTSKDGLIKIWDL 191
           WD+     L ++R H ++A+    + Q    ++S   D  +++WD+
Sbjct: 716 WDIGSGKRLKQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWDM 761

 Score = 39.7 bits (91), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 40/206 (19%), Positives = 67/206 (32%), Gaps = 49/206 (23%)

Query: 72  SDAKGSKPAECTY-----------LEVHQDTNLLAVGYADGVIKVW-------DLVSKTV 113
           S+ +   P+ C Y           L+   D  L A G+ D  IK+W       D ++ T 
Sbjct: 470 SNLRSELPSVCMYTFHNTNREMLSLDFSDDCRLAAAGFQDSYIKIWSLDGSSLDTLTSTN 529

Query: 114 LLNFN--------------------------GHKAAITLMQFDSTGTRLISGSKDSNIIV 147
             +F                           GH  A+    F      LISGS+D  + +
Sbjct: 530 NTHFTKKNTADNNLHSKKKHQEHVNTNTKLVGHSGAVYSTSFSPDNKLLISGSEDKTVRL 589

Query: 148 WDLVGEVGLYKLRSHKDAI--TGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG 205
           W +  +  L   + H   +    F   G  +  + S D   ++W       +     H  
Sbjct: 590 WAMDTQSTLVSYKGHNHPVWDVAFSPMGH-YFATASHDQTARLWSCDHIYSLRIFAGHLS 648

Query: 206 --ECWGLAVKDDLLITTSTDSQVKIW 229
             +C         + T S+D   ++W
Sbjct: 649 DVDCVTFHPNGCYVFTGSSDKTCRMW 674

>NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON}
           Anc_7.534
          Length = 474

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 116/274 (42%), Gaps = 31/274 (11%)

Query: 444 LVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQ 503
           L   G+ +G++++ D  +  ++  IE+ HD  I  L   S    LV+G+ D  VK   F 
Sbjct: 200 LCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLVKIHSFD 259

Query: 504 V------EKTLVPGTKDKFV--------------------PMLKLNHDTTLELND----D 533
                  E T + G   + V                     +  +  +T L+  +    +
Sbjct: 260 PDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKE 319

Query: 534 ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSA 593
           + S+    D   L    LDN   V+ + + K  ++L GH  P+ S+D S D   I T   
Sbjct: 320 VYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGG 379

Query: 594 DKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPES-HNFFSCSKDAVVKYWDGEKFECIQK 652
           D  I IW +        L AH + +  V+F   + H   SC  D  ++ +  + +  ++ 
Sbjct: 380 DGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVKT 439

Query: 653 LYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEE 686
           L  H  ++  + IS D   +VSS  D S+++W++
Sbjct: 440 LEGHTDKILDVDISEDAQLIVSSGWDRSLKLWKQ 473

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 103/219 (47%), Gaps = 23/219 (10%)

Query: 387 LQGQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGYA---LTCKFLPGG 442
           LQG    V ++D     + +A+AS + + ++W++++   ++ F+ G+     +  F   G
Sbjct: 271 LQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQ-FQEGHGKEVYSLSFQNDG 329

Query: 443 LLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
            L+  G       ++D+ +   +  ++  H   I+S+D + DG  + TG  D  +  WD 
Sbjct: 330 ALLCSGGLDNAAIVWDVRTGKSIMNLQ-GHAKPIYSVDWSPDGYHIATGGGDGVINIWDI 388

Query: 503 QVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISL-LDNTVKVFFLD 561
           +           K     +L     L  N+ +  VR      +  +S   D  ++++  D
Sbjct: 389 R-----------KTTETTRL-----LAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSD 432

Query: 562 SMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           +     +L GH   +L +DIS D+++I++S  D+++K+W
Sbjct: 433 NWIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLW 471

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 68/154 (44%), Gaps = 4/154 (2%)

Query: 81  ECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGS 140
           E   L    D  LL  G  D    VWD+ +   ++N  GH   I  + +   G  + +G 
Sbjct: 319 EVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGG 378

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGE--DWLVSTSKDGLIKIWDLKTQQCIE 198
            D  I +WD+       +L +H + +TG   Q      LVS   D  I+I+       ++
Sbjct: 379 GDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVK 438

Query: 199 THIAHTGECWGLAVKDD--LLITTSTDSQVKIWK 230
           T   HT +   + + +D  L++++  D  +K+WK
Sbjct: 439 TLEGHTDKILDVDISEDAQLIVSSGWDRSLKLWK 472

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 64/149 (42%), Gaps = 4/149 (2%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           ++ H     +A    D   ++WD+ S+T L    GH   +  + F + G  L SG  D+ 
Sbjct: 281 VDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGALLCSGGLDNA 340

Query: 145 IIVWDLVGEVGLYKLRSHKDAITGF-WCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAH 203
            IVWD+     +  L+ H   I    W      + +   DG+I IWD++        +AH
Sbjct: 341 AIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETTRLLAH 400

Query: 204 TGECWGLAVKDD---LLITTSTDSQVKIW 229
                G+  +      L++   D Q++I+
Sbjct: 401 NNIVTGVRFQKSTGHCLVSCGYDKQIRIY 429

 Score = 51.2 bits (121), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 82/216 (37%), Gaps = 18/216 (8%)

Query: 431 GYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVT 490
           G  +   F P G  V   +     +L+D+ S + L   ++ H   ++SL   +DG  L +
Sbjct: 276 GRVVNVDFHPSGRFVASASFDMTWRLWDIESETEL-QFQEGHGKEVYSLSFQNDGALLCS 334

Query: 491 GSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISL 550
           G  D     WD +  K+++   +    P               I SV  SPD  ++A   
Sbjct: 335 GGLDNAAIVWDVRTGKSIM-NLQGHAKP---------------IYSVDWSPDGYHIATGG 378

Query: 551 LDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSA-DKNIKIWGLDFGDCHK 609
            D  + ++ +        L  H   V  +     +   + S   DK I+I+  D     K
Sbjct: 379 GDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVK 438

Query: 610 SLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGE 645
           +L  H D I+ V    ++    S   D  +K W  E
Sbjct: 439 TLEGHTDKILDVDISEDAQLIVSSGWDRSLKLWKQE 474

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 90/213 (42%), Gaps = 14/213 (6%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNF-NGHKAAITLMQFDSTGTRLISGSKDSNIIVW 148
           D  L A G   G IK+ D  +  V+    NGH   I  + ++ST T L+SG+ D  + + 
Sbjct: 197 DNALCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLVKIH 256

Query: 149 DLVGEVGLYK----LRSHKDAITG--FWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIA 202
               +V + K    L+ H   +    F   G  ++ S S D   ++WD++++  ++    
Sbjct: 257 SFDPDVKIIKELTALQGHTGRVVNVDFHPSGR-FVASASFDMTWRLWDIESETELQFQEG 315

Query: 203 HTGECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEMGIFEKQSKQRGLKIE 260
           H  E + L+ ++D  LL +   D+   +W +      M  +     I+       G  I 
Sbjct: 316 HGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIA 375

Query: 261 FITNASDGVSFFYIQNADKTIETYRIRKEEEIA 293
             T   DGV    I +  KT ET R+     I 
Sbjct: 376 --TGGGDGV--INIWDIRKTTETTRLLAHNNIV 404

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 63/152 (41%), Gaps = 15/152 (9%)

Query: 41  LITSALENVNI-WDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYA 99
           L +  L+N  I WD++TG  +  L     P  S            ++   D   +A G  
Sbjct: 332 LCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYS------------VDWSPDGYHIATGGG 379

Query: 100 DGVIKVWDLVSKTVLLNFNGHKAAITLMQFD-STGTRLISGSKDSNIIVWDLVGEVGLYK 158
           DGVI +WD+   T       H   +T ++F  STG  L+S   D  I ++     + +  
Sbjct: 380 DGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVKT 439

Query: 159 LRSHKDAITGF-WCQGEDWLVSTSKDGLIKIW 189
           L  H D I      +    +VS+  D  +K+W
Sbjct: 440 LEGHTDKILDVDISEDAQLIVSSGWDRSLKLW 471

>KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 471

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 108/245 (44%), Gaps = 16/245 (6%)

Query: 440 PGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
           P    V  G+  G++++ D  +  +L + +  HD  I  LD +SD   LVTG AD+ VK 
Sbjct: 192 PNQKSVACGSWHGDVKIIDSETLEILASFDAIHDDKIGGLDWSSDSTLLVTGGADRIVKV 251

Query: 500 WDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFF 559
           W         P + +    +LK  H+        ++ V+  P DRY+A +  D T +++ 
Sbjct: 252 WK--------PSSPNDSTAVLK-GHEGR------VVKVKFHPSDRYVASASFDMTWRLWD 296

Query: 560 LDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 619
           ++         GH   V  +D   D  ++ ++  D   +IW +  G     L  H   I 
Sbjct: 297 VERQVELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQSLMILEGHAKPIY 356

Query: 620 SVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI-STDGSFVVSSSHD 678
            V + P  H+  + S D  VK WD  K      + AH + V  +      G  +VSSS+D
Sbjct: 357 GVSWSPNGHHVATGSADGTVKVWDIRKVGNPFSILAHNNIVSDVKFDKVSGRTLVSSSYD 416

Query: 679 HSIRI 683
            ++ +
Sbjct: 417 KTVSV 421

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 109/249 (43%), Gaps = 46/249 (18%)

Query: 374 PTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTH---------- 422
           P+SP      T  L+G    V  +     ++ +A+AS + + ++W+V+            
Sbjct: 254 PSSP---NDSTAVLKGHEGRVVKVKFHPSDRYVASASFDMTWRLWDVERQVELQLQEGHA 310

Query: 423 ---KCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSL 479
               C+  F+C  +L C      +  I   RSG+         SL+  I + H   I+ +
Sbjct: 311 KEVYCL-DFQCDGSLLCSAGLDSIGRIWDMRSGQ---------SLM--ILEGHAKPIYGV 358

Query: 480 DLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRI 539
             + +G  + TGSAD TVK WD +              P   L H+  +    D+   ++
Sbjct: 359 SWSPNGHHVATGSADGTVKVWDIRKVGN----------PFSILAHNNIVS---DVKFDKV 405

Query: 540 SPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKI 599
           S   R L  S  D TV VF  DS     SL GH   V+SIDIS D   + +S  D+++K+
Sbjct: 406 S--GRTLVSSSYDKTVSVFASDSWLRLASLKGHTDKVMSIDISHDFSHLYSSGWDRSVKL 463

Query: 600 WGLDFGDCH 608
           W L  G C+
Sbjct: 464 WKL--GVCN 470

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 72/159 (45%), Gaps = 2/159 (1%)

Query: 534 ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYG-HKLPVLSIDISFDSKMIITSS 592
           +  V +SP+ + +A       VK+   ++++   S    H   +  +D S DS +++T  
Sbjct: 185 VSGVLLSPNQKSVACGSWHGDVKIIDSETLEILASFDAIHDDKIGGLDWSSDSTLLVTGG 244

Query: 593 ADKNIKIWGLDF-GDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQ 651
           AD+ +K+W      D    L  H+  ++ VKF P      S S D   + WD E+   +Q
Sbjct: 245 ADRIVKVWKPSSPNDSTAVLKGHEGRVVKVKFHPSDRYVASASFDMTWRLWDVERQVELQ 304

Query: 652 KLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQ 690
               H  EV+ L    DGS + S+  D   RIW+    Q
Sbjct: 305 LQEGHAKEVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQ 343

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 105/256 (41%), Gaps = 26/256 (10%)

Query: 394 VRSIDVSDDNKLLATA-SNGSLKIWNVKTHK---CIRTFECGYALTCKFLPGGLLVILGT 449
           +  +D S D+ LL T  ++  +K+W   +      +     G  +  KF P    V   +
Sbjct: 228 IGGLDWSSDSTLLVTGGADRIVKVWKPSSPNDSTAVLKGHEGRVVKVKFHPSDRYVASAS 287

Query: 450 RSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLV 509
                +L+D+     L  +++ H   ++ LD   DG  L +   D   + WD +  ++L 
Sbjct: 288 FDMTWRLWDVERQVEL-QLQEGHAKEVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQSL- 345

Query: 510 PGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSL 569
                    M+   H         I  V  SP+  ++A    D TVKV+ +  +    S+
Sbjct: 346 ---------MILEGHAKP------IYGVSWSPNGHHVATGSADGTVKVWDIRKVGNPFSI 390

Query: 570 YGHKLPVLSIDISFD---SKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPE 626
             H   V   D+ FD    + +++SS DK + ++  D      SL  H D +MS+    +
Sbjct: 391 LAHNNIV--SDVKFDKVSGRTLVSSSYDKTVSVFASDSWLRLASLKGHTDKVMSIDISHD 448

Query: 627 SHNFFSCSKDAVVKYW 642
             + +S   D  VK W
Sbjct: 449 FSHLYSSGWDRSVKLW 464

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 70/154 (45%), Gaps = 10/154 (6%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVS---KTVLLNFNGHKAAITLMQFDSTGTRLISGSK 141
           L+   D+ LL  G AD ++KVW   S    T +L   GH+  +  ++F  +   + S S 
Sbjct: 231 LDWSSDSTLLVTGGADRIVKVWKPSSPNDSTAVL--KGHEGRVVKVKFHPSDRYVASASF 288

Query: 142 DSNIIVWDLVGEVGLYKLRSHKDAI--TGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIET 199
           D    +WD+  +V L     H   +    F C G   L S   D + +IWD+++ Q +  
Sbjct: 289 DMTWRLWDVERQVELQLQEGHAKEVYCLDFQCDGS-LLCSAGLDSIGRIWDMRSGQSLMI 347

Query: 200 HIAHTGECWGLAVKDD--LLITTSTDSQVKIWKL 231
              H    +G++   +   + T S D  VK+W +
Sbjct: 348 LEGHAKPIYGVSWSPNGHHVATGSADGTVKVWDI 381

 Score = 51.2 bits (121), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 71/159 (44%), Gaps = 4/159 (2%)

Query: 81  ECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGS 140
           E   L+   D +LL     D + ++WD+ S   L+   GH   I  + +   G  + +GS
Sbjct: 312 EVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQSLMILEGHAKPIYGVSWSPNGHHVATGS 371

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDAITG--FWCQGEDWLVSTSKDGLIKIWDLKTQQCIE 198
            D  + VWD+      + + +H + ++   F       LVS+S D  + ++   +   + 
Sbjct: 372 ADGTVKVWDIRKVGNPFSILAHNNIVSDVKFDKVSGRTLVSSSYDKTVSVFASDSWLRLA 431

Query: 199 THIAHTGECWGLAVKDDL--LITTSTDSQVKIWKLNMEN 235
           +   HT +   + +  D   L ++  D  VK+WKL + N
Sbjct: 432 SLKGHTDKVMSIDISHDFSHLYSSGWDRSVKLWKLGVCN 470

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 46/109 (42%), Gaps = 1/109 (0%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           ++ H     +A    D   ++WD+  +  L    GH   +  + F   G+ L S   DS 
Sbjct: 274 VKFHPSDRYVASASFDMTWRLWDVERQVELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSI 333

Query: 145 IIVWDLVGEVGLYKLRSHKDAITGF-WCQGEDWLVSTSKDGLIKIWDLK 192
             +WD+     L  L  H   I G  W      + + S DG +K+WD++
Sbjct: 334 GRIWDMRSGQSLMILEGHAKPIYGVSWSPNGHHVATGSADGTVKVWDIR 382

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 122/274 (44%), Gaps = 30/274 (10%)

Query: 440 PGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
           P G     G+ +G++ +F+  + + + T  + H   I  +D +SD + LV+G  D  VK 
Sbjct: 191 PEGTCTAAGSWAGDISIFNTKTLAPVITSRETHSGKISGIDWSSDSRHLVSGGEDGIVKL 250

Query: 500 WDF-----QVEKTLVPG----TKDKFVPMLKL----NHDTTLELND-------------- 532
           ++F     QV  + +      T  KF P  K     + DTT  L D              
Sbjct: 251 YNFDSNSIQVATSFIGHDARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHS 310

Query: 533 -DILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITS 591
            +I S+    D   +A +  D    ++ L S K  LSL GH  P+   D S +       
Sbjct: 311 KEIYSLSFQTDGSLIATAGADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQNGYQ-XXX 369

Query: 592 SADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF-SCSKDAVVKYWDGEKFECI 650
           S D  IKIW L   D  +++ AH++ +  +KF  E+  F  S S D  +  +  + +  I
Sbjct: 370 SGDGTIKIWDLRKVDDVETILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKI 429

Query: 651 QKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
             L  H  ++ ++ IS+D   +VS   D S+++W
Sbjct: 430 HTLQGHNDKILSIDISSDYQTIVSGGWDRSVKLW 463

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 75/172 (43%), Gaps = 14/172 (8%)

Query: 80  AECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISG 139
           A  T ++ H     +     D   ++WD+V+ + LL   GH   I  + F + G+ + + 
Sbjct: 269 ARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHSKEIYSLSFQTDGSLIATA 328

Query: 140 SKDSNIIVWDLVGEVGLYKLRSHKDAI-TGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIE 198
             D   I+WDL     +  L  H   I    W Q   +    S DG IKIWDL+    +E
Sbjct: 329 GADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQN-GYQXXXSGDGTIKIWDLRKVDDVE 387

Query: 199 THIAHTGECWGLAVKDD---LLITT---------STDSQVKIWKLNMENEKM 238
           T +AH      L  + +    LI++         S+DS VKI  L   N+K+
Sbjct: 388 TILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKIHTLQGHNDKI 439

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 63/257 (24%), Positives = 115/257 (44%), Gaps = 35/257 (13%)

Query: 378 APLKTHTIELQGQRTDVRSIDVSDDNK-LLATASNGSLKIWNVKTHKC-IRTFECGY--- 432
           AP+ T      G+   +  ID S D++ L++   +G +K++N  ++   + T   G+   
Sbjct: 214 APVITSRETHSGK---ISGIDWSSDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIGHDAR 270

Query: 433 ALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGS 492
               KF P    +   +     +L+D+ ++S L  +++ H   I+SL   +DG  + T  
Sbjct: 271 VTNVKFHPSQKYIGSASFDTTWRLWDIVTNSEL-LLQEGHSKEIYSLSFQTDGSLIATAG 329

Query: 493 ADKTVKFWDFQVEK---TLVPGTKDKFVPMLKLNH-------DTTLEL-----NDDILSV 537
           ADK    WD +  K   +LV   K  +      N        D T+++      DD+ ++
Sbjct: 330 ADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQNGYQXXXSGDGTIKIWDLRKVDDVETI 389

Query: 538 RI-----------SPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
                          + ++L  S  D  + VF  DS     +L GH   +LSIDIS D +
Sbjct: 390 LAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKIHTLQGHNDKILSIDISSDYQ 449

Query: 587 MIITSSADKNIKIWGLD 603
            I++   D+++K+W ++
Sbjct: 450 TIVSGGWDRSVKLWSME 466

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 72/170 (42%), Gaps = 10/170 (5%)

Query: 526 TTLELN-DDILSVR------ISPDDRYLAISLLDNTVKVFFLDSMKFYL-SLYGHKLPVL 577
           TT++LN   ++S R      ISP+    A       + +F   ++   + S   H   + 
Sbjct: 169 TTVQLNGSQVISSRPISKICISPEGTCTAAGSWAGDISIFNTKTLAPVITSRETHSGKIS 228

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCH--KSLFAHQDSIMSVKFLPESHNFFSCSK 635
            ID S DS+ +++   D  +K++  D        S   H   + +VKF P      S S 
Sbjct: 229 GIDWSSDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIGHDARVTNVKFHPSQKYIGSASF 288

Query: 636 DAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           D   + WD      +     H  E+++L+  TDGS + ++  D    IW+
Sbjct: 289 DTTWRLWDIVTNSELLLQEGHSKEIYSLSFQTDGSLIATAGADKVGIIWD 338

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 84/179 (46%), Gaps = 5/179 (2%)

Query: 57  GDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLL- 115
           GD+    +  L P  + ++ +   + + ++   D+  L  G  DG++K+++  S ++ + 
Sbjct: 203 GDISIFNTKTLAPVIT-SRETHSGKISGIDWSSDSRHLVSGGEDGIVKLYNFDSNSIQVA 261

Query: 116 -NFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGE 174
            +F GH A +T ++F  +   + S S D+   +WD+V    L     H   I     Q +
Sbjct: 262 TSFIGHDARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHSKEIYSLSFQTD 321

Query: 175 DWLVSTS-KDGLIKIWDLKTQQCIETHIAHTGECWGLA-VKDDLLITTSTDSQVKIWKL 231
             L++T+  D +  IWDL++ + I + + H    +     ++      S D  +KIW L
Sbjct: 322 GSLIATAGADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQNGYQXXXSGDGTIKIWDL 380

>KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {ON}
           Anc_2.431 YMR116C
          Length = 319

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 102/223 (45%), Gaps = 21/223 (9%)

Query: 470 DAHDAAIWSLDLTSDGKR--LVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTT 527
           + H+  + SL  TS G+   LV+ S DKT+  W    +   V       VP+      + 
Sbjct: 14  EGHNGWVTSL-ATSAGQPNLLVSASRDKTLISWKLTGDDQKVG------VPVRSFKGHSH 66

Query: 528 LELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM 587
           +     +  V ++PD  Y   +  D T++++ + + + +    GHK  V+S+ I   + M
Sbjct: 67  I-----VQDVTLTPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASM 121

Query: 588 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP------ESHNFFSCSKDAVVKY 641
           II+ S DK+IK+W +  G C  +L  H D +  V+  P      E+    S   D +VK 
Sbjct: 122 IISGSRDKSIKVWTIK-GQCLATLLGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKA 180

Query: 642 WDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
           W+  +F+       H   V  +  S DGS + S+  D  I +W
Sbjct: 181 WNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLW 223

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 63/141 (44%), Gaps = 10/141 (7%)

Query: 100 DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D  +++W++ +      F GHK+ +  +  D   + +ISGS+D +I VW + G+  L  L
Sbjct: 86  DKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKVWTIKGQC-LATL 144

Query: 160 RSHKDAITGFWCQGED-------WLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAV 212
             H D ++       D        ++S   D ++K W+L   Q     + H G    +  
Sbjct: 145 LGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTITA 204

Query: 213 KDD--LLITTSTDSQVKIWKL 231
             D  L+ +   D ++ +W L
Sbjct: 205 SPDGSLIASAGKDGEIMLWNL 225

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 58/124 (46%), Gaps = 8/124 (6%)

Query: 568 SLYGHKLPVLSIDISF-DSKMIITSSADKNIKIWGLDFGDCHK------SLFAHQDSIMS 620
           +L GH   V S+  S     +++++S DK +  W L  GD  K      S   H   +  
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLT-GDDQKVGVPVRSFKGHSHIVQD 70

Query: 621 VKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHS 680
           V   P+     S S D  ++ W+    E  Q+   H+S+V ++AI    S ++S S D S
Sbjct: 71  VTLTPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKS 130

Query: 681 IRIW 684
           I++W
Sbjct: 131 IKVW 134

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 58/254 (22%), Positives = 107/254 (42%), Gaps = 41/254 (16%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKT----------------------L 508
            H   +  + LT DG   ++ S DKT++ W+    +T                      +
Sbjct: 63  GHSHIVQDVTLTPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMI 122

Query: 509 VPGTKDKFVPMLKLNHD---TTLELNDDILSVRISPDDR-----YLAISLL-DNTVKVFF 559
           + G++DK + +  +      T L  ND +  VR++P+D+        IS   D  VK + 
Sbjct: 123 ISGSRDKSIKVWTIKGQCLATLLGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWN 182

Query: 560 LDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 619
           L+  +      GH   V +I  S D  +I ++  D  I +W L       +L A QD + 
Sbjct: 183 LNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWNLADKVPMYTLNA-QDEVF 241

Query: 620 SVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKL------YAHQSEVWALAI--STDGSF 671
           ++ F P  + + + +  + +K +  +    I  L      Y   +E  A+++  S DG  
Sbjct: 242 ALAFSPNRY-WLAAATASGIKVFSLDPQALIDDLRPEFAGYNKAAEPHAVSLTWSADGQT 300

Query: 672 VVSSSHDHSIRIWE 685
           + +   D+ IR+W+
Sbjct: 301 LFAGYTDNVIRVWQ 314

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 47/99 (47%), Gaps = 1/99 (1%)

Query: 100 DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D ++K W+L    +  +F GH   +  +     G+ + S  KD  I++W+L  +V +Y L
Sbjct: 175 DKMVKAWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWNLADKVPMYTL 234

Query: 160 RSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIE 198
            +  +     +     WL + +  G IK++ L  Q  I+
Sbjct: 235 NAQDEVFALAFSPNRYWLAAATASG-IKVFSLDPQALID 272

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 63/155 (40%), Gaps = 15/155 (9%)

Query: 92  NLLAVGYADGVIKVWDLVSK-----TVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNII 146
           NLL     D  +  W L          + +F GH   +  +     G   +S S D  + 
Sbjct: 31  NLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDVTLTPDGAYALSASWDKTLR 90

Query: 147 VWDLVGEVGLYKLRSHK-DAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG 205
           +W++       +   HK D ++    +    ++S S+D  IK+W +K  QC+ T + H  
Sbjct: 91  LWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKVWTIK-GQCLATLLGHND 149

Query: 206 ECWGLAV----KDD----LLITTSTDSQVKIWKLN 232
               + V    KDD     +I+   D  VK W LN
Sbjct: 150 WVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLN 184

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 57/123 (46%), Gaps = 11/123 (8%)

Query: 119 GHKAAIT-LMQFDSTGTRLISGSKDSNIIVWDLVGE---VGL----YKLRSHKDAITGFW 170
           GH   +T L         L+S S+D  +I W L G+   VG+    +K  SH        
Sbjct: 15  GHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDVTLT 74

Query: 171 CQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAV--KDDLLITTSTDSQVKI 228
             G  + +S S D  +++W++ T +  +  + H  +   +A+  K  ++I+ S D  +K+
Sbjct: 75  PDGA-YALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKV 133

Query: 229 WKL 231
           W +
Sbjct: 134 WTI 136

 Score = 38.1 bits (87), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 53/124 (42%), Gaps = 10/124 (8%)

Query: 386 ELQGQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALTCKFLPGGL 443
           +  G   +V +I  S D  L+A+A  +G + +WN+     + T           F P   
Sbjct: 191 DFVGHNGNVNTITASPDGSLIASAGKDGEIMLWNLADKVPMYTLNAQDEVFALAFSPNRY 250

Query: 444 LVILGTRSGELQLFDLASSSLLDTIED-------AHDAAIWSLDLTSDGKRLVTGSADKT 496
            +   T SG +++F L   +L+D +         A +    SL  ++DG+ L  G  D  
Sbjct: 251 WLAAATASG-IKVFSLDPQALIDDLRPEFAGYNKAAEPHAVSLTWSADGQTLFAGYTDNV 309

Query: 497 VKFW 500
           ++ W
Sbjct: 310 IRVW 313

>NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {ON}
           Anc_8.544
          Length = 822

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/284 (22%), Positives = 118/284 (41%), Gaps = 38/284 (13%)

Query: 424 CIRTFEC--GYALTCKFLPGGLLVILGTRSGELQLFDLASSSL-------LDTIEDA--- 471
           C+ TF    G   + +F     LV  G +   ++L+ L  SSL        D+I      
Sbjct: 479 CMYTFHNTNGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMN 538

Query: 472 ---------HDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKL 522
                    H  A++S   + D + L++GS DKTV+ W      +LV             
Sbjct: 539 DNTSTTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLV------------- 585

Query: 523 NHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDIS 582
              +    N  +  V+ SP   Y A +  D T +++  D +       GH   V  +   
Sbjct: 586 ---SYKGHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFH 642

Query: 583 FDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYW 642
            +   + T S+DK  ++W +  GD  +    H   ++     P+     + S+D ++  W
Sbjct: 643 PNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLW 702

Query: 643 DGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           D    + ++ +  H ++ + +L+   +G+ +VS   DHS+R+W+
Sbjct: 703 DIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWD 746

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 54/110 (49%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH A +        G  L +GS+D  
Sbjct: 639 VSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGI 698

Query: 145 IIVWDLVGEVGLYKLRSH-KDAITGF-WCQGEDWLVSTSKDGLIKIWDLK 192
           I +WD+     L  +R H K+AI    +C+  + LVS   D  +++WDLK
Sbjct: 699 INLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLK 748

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 46/101 (45%), Gaps = 13/101 (12%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           +WDI TGD V                + P  CT   V  D   LA G  DG+I +WD+ +
Sbjct: 659 MWDISTGDSVRLF----------LGHTAPVLCT--AVSPDGRWLATGSEDGIINLWDIGT 706

Query: 111 KTVLLNFNGH-KAAITLMQFDSTGTRLISGSKDSNIIVWDL 150
              L    GH K AI  + +   G  L+SG  D ++ VWDL
Sbjct: 707 AKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDL 747

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 64/134 (47%), Gaps = 8/134 (5%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTF--ECGYALTCKFLPGGLLVILGTRSGELQLFDLASS 462
           +   +S+ + ++W++ T   +R F       L     P G  +  G+  G + L+D+ ++
Sbjct: 648 VFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLWDIGTA 707

Query: 463 SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPG--TKDKFVPML 520
             L  +      AI SL    +G  LV+G AD +V+ WD + + T  PG   +++FV  +
Sbjct: 708 KRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLK-KSTAEPGPEPEEQFVGYI 766

Query: 521 KLNHDTTLELNDDI 534
               + T  +N DI
Sbjct: 767 G---NLTASINQDI 777

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 62/156 (39%), Gaps = 6/156 (3%)

Query: 94  LAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH + +  + F   G  + +GS D    +WD+   
Sbjct: 606 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTG 665

Query: 154 VGLYKLRSHKDAI--TGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGEC---W 208
             +     H   +  T     G  WL + S+DG+I +WD+ T + ++    H        
Sbjct: 666 DSVRLFLGHTAPVLCTAVSPDGR-WLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSL 724

Query: 209 GLAVKDDLLITTSTDSQVKIWKLNMENEKMGEKLTE 244
               + ++L++   D  V++W L     + G +  E
Sbjct: 725 SYCKEGNVLVSGGADHSVRVWDLKKSTAEPGPEPEE 760

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 59/148 (39%), Gaps = 9/148 (6%)

Query: 90  DTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           D   L  G  D  +++W   + T L+++ GH   +  +QF   G    + S D    +W 
Sbjct: 560 DNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATASHDQTARLWS 619

Query: 150 LVGEVGLYKLRSHKDAITGFWC----QGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG 205
                 +Y LR     ++   C        ++ + S D   ++WD+ T   +   + HT 
Sbjct: 620 C---DHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTA 676

Query: 206 ECWGLAVKDD--LLITTSTDSQVKIWKL 231
                AV  D   L T S D  + +W +
Sbjct: 677 PVLCTAVSPDGRWLATGSEDGIINLWDI 704

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 63/173 (36%), Gaps = 25/173 (14%)

Query: 83  TYLEVHQDTNLLAVGYADGVIKVWDLVSKTVL--------------LNFN------GHKA 122
           T L+  +D+ L+A G+ D  IK+W L   ++               +N N      GH  
Sbjct: 491 TSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTSTTLIGHSG 550

Query: 123 AITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAI--TGFWCQGEDWLVST 180
           A+    F      L+SGS+D  + +W       L   + H   +    F   G  +  + 
Sbjct: 551 AVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGH-YFATA 609

Query: 181 SKDGLIKIWDLKTQQCIETHIAHTG--ECWGLAVKDDLLITTSTDSQVKIWKL 231
           S D   ++W       +     H    +C         + T S+D   ++W +
Sbjct: 610 SHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDI 662

>Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 103/224 (45%), Gaps = 23/224 (10%)

Query: 470 DAHDAAIWSLDLTSDGKR--LVTGSADKTVKFWDFQVEKTLVPGTKDKF-VPMLKLNHDT 526
           + H+  + SL  TS G+   L++ S DKT+  W          G   KF VP+      +
Sbjct: 14  EGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLT-------GDDQKFGVPVRSFKGHS 65

Query: 527 TLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
            +     +    ++ D  Y   +  D T++++ + + + Y    GHK  V+S+DI   + 
Sbjct: 66  HI-----VQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS 120

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP------ESHNFFSCSKDAVVK 640
           MII+ S DK IK+W +  G C  +L  H D +  V+ +P      +S    S   D +VK
Sbjct: 121 MIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 641 YWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
            W+  +F+       H S +  L  S DG+ + S+  D  I +W
Sbjct: 180 AWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLW 223

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 74/322 (22%), Positives = 131/322 (40%), Gaps = 43/322 (13%)

Query: 387 LQGQRTDVRSIDVS--DDNKLLATASNGSLKIWNV-----KTHKCIRTFECGYALT--CK 437
           L+G    V S+  S    N LL+ + + +L  W +     K    +R+F+    +   C 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 438 FLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTV 497
               G   +  +    L+L+D+A+          H + + S+D+      +++GS DKT+
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFV-GHKSDVMSVDIDKKASMIISGSRDKTI 131

Query: 498 KFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISP-----DDRYLAISLL- 551
           K W  + +                    T L  ND +  VR+ P     DD    IS   
Sbjct: 132 KVWTIKGQCLA-----------------TLLGHNDWVSQVRVVPNEKADDDSVTIISAGN 174

Query: 552 DNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSL 611
           D  VK + L+  +      GH   + ++  S D  +I ++  D  I +W L       +L
Sbjct: 175 DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTL 234

Query: 612 FAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKL------YAHQSEVWA--L 663
            A QD + S+ F P  + + + +    +K +  +    +  L      Y+  +E  A  L
Sbjct: 235 SA-QDEVFSLAFSPNRY-WLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSL 292

Query: 664 AISTDGSFVVSSSHDHSIRIWE 685
           A S DG  + +   D+ IR+W+
Sbjct: 293 AWSADGQTLFAGYTDNVIRVWQ 314

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 70/158 (44%), Gaps = 16/158 (10%)

Query: 89  QDTNLLAVG-YA-----DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKD 142
           QD  L A G YA     D  +++WD+ +      F GHK+ +  +  D   + +ISGS+D
Sbjct: 69  QDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRD 128

Query: 143 SNIIVWDLVGEVGLYKLRSHKDAITGFWC----QGED---WLVSTSKDGLIKIWDLKTQQ 195
             I VW + G+  L  L  H D ++        + +D    ++S   D ++K W+L   Q
Sbjct: 129 KTIKVWTIKGQC-LATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQ 187

Query: 196 CIETHIAHTGECWGLAVKDD--LLITTSTDSQVKIWKL 231
                I H      L    D  L+ +   D ++ +W L
Sbjct: 188 IEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNL 225

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 48/99 (48%), Gaps = 1/99 (1%)

Query: 100 DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D ++K W+L    +  +F GH + I  +     GT + S  KD  I++W+L  +  +Y L
Sbjct: 175 DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTL 234

Query: 160 RSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIE 198
            +  +  +  +     WL + +  G IK++ L  Q  ++
Sbjct: 235 SAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 38.9 bits (89), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 14/128 (10%)

Query: 116 NFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHK-DAITGFWCQGE 174
           +F GH   +      + G   +S S D  + +WD+       +   HK D ++    +  
Sbjct: 60  SFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA 119

Query: 175 DWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVK-------DD---LLITTSTDS 224
             ++S S+D  IK+W +K  QC+ T + H    W   V+       DD    +I+   D 
Sbjct: 120 SMIISGSRDKTIKVWTIK-GQCLATLLGHND--WVSQVRVVPNEKADDDSVTIISAGNDK 176

Query: 225 QVKIWKLN 232
            VK W LN
Sbjct: 177 MVKAWNLN 184

>Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 103/224 (45%), Gaps = 23/224 (10%)

Query: 470 DAHDAAIWSLDLTSDGKR--LVTGSADKTVKFWDFQVEKTLVPGTKDKF-VPMLKLNHDT 526
           + H+  + SL  TS G+   L++ S DKT+  W          G   KF VP+      +
Sbjct: 14  EGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLT-------GDDQKFGVPVRSFKGHS 65

Query: 527 TLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
            +     +    ++ D  Y   +  D T++++ + + + Y    GHK  V+S+DI   + 
Sbjct: 66  HI-----VQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS 120

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP------ESHNFFSCSKDAVVK 640
           MII+ S DK IK+W +  G C  +L  H D +  V+ +P      +S    S   D +VK
Sbjct: 121 MIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 641 YWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
            W+  +F+       H S +  L  S DG+ + S+  D  I +W
Sbjct: 180 AWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLW 223

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 74/322 (22%), Positives = 131/322 (40%), Gaps = 43/322 (13%)

Query: 387 LQGQRTDVRSIDVS--DDNKLLATASNGSLKIWNV-----KTHKCIRTFECGYALT--CK 437
           L+G    V S+  S    N LL+ + + +L  W +     K    +R+F+    +   C 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 438 FLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTV 497
               G   +  +    L+L+D+A+          H + + S+D+      +++GS DKT+
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFV-GHKSDVMSVDIDKKASMIISGSRDKTI 131

Query: 498 KFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISP-----DDRYLAISLL- 551
           K W  + +                    T L  ND +  VR+ P     DD    IS   
Sbjct: 132 KVWTIKGQCLA-----------------TLLGHNDWVSQVRVVPNEKADDDSVTIISAGN 174

Query: 552 DNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSL 611
           D  VK + L+  +      GH   + ++  S D  +I ++  D  I +W L       +L
Sbjct: 175 DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTL 234

Query: 612 FAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKL------YAHQSEVWA--L 663
            A QD + S+ F P  + + + +    +K +  +    +  L      Y+  +E  A  L
Sbjct: 235 SA-QDEVFSLAFSPNRY-WLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSL 292

Query: 664 AISTDGSFVVSSSHDHSIRIWE 685
           A S DG  + +   D+ IR+W+
Sbjct: 293 AWSADGQTLFAGYTDNVIRVWQ 314

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 70/158 (44%), Gaps = 16/158 (10%)

Query: 89  QDTNLLAVG-YA-----DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKD 142
           QD  L A G YA     D  +++WD+ +      F GHK+ +  +  D   + +ISGS+D
Sbjct: 69  QDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRD 128

Query: 143 SNIIVWDLVGEVGLYKLRSHKDAITGFWC----QGED---WLVSTSKDGLIKIWDLKTQQ 195
             I VW + G+  L  L  H D ++        + +D    ++S   D ++K W+L   Q
Sbjct: 129 KTIKVWTIKGQC-LATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQ 187

Query: 196 CIETHIAHTGECWGLAVKDD--LLITTSTDSQVKIWKL 231
                I H      L    D  L+ +   D ++ +W L
Sbjct: 188 IEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNL 225

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 48/99 (48%), Gaps = 1/99 (1%)

Query: 100 DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D ++K W+L    +  +F GH + I  +     GT + S  KD  I++W+L  +  +Y L
Sbjct: 175 DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTL 234

Query: 160 RSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIE 198
            +  +  +  +     WL + +  G IK++ L  Q  ++
Sbjct: 235 SAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 38.9 bits (89), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 14/128 (10%)

Query: 116 NFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHK-DAITGFWCQGE 174
           +F GH   +      + G   +S S D  + +WD+       +   HK D ++    +  
Sbjct: 60  SFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA 119

Query: 175 DWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVK-------DD---LLITTSTDS 224
             ++S S+D  IK+W +K  QC+ T + H    W   V+       DD    +I+   D 
Sbjct: 120 SMIISGSRDKTIKVWTIK-GQCLATLLGHND--WVSQVRVVPNEKADDDSVTIISAGNDK 176

Query: 225 QVKIWKLN 232
            VK W LN
Sbjct: 177 MVKAWNLN 184

>Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 103/224 (45%), Gaps = 23/224 (10%)

Query: 470 DAHDAAIWSLDLTSDGKR--LVTGSADKTVKFWDFQVEKTLVPGTKDKF-VPMLKLNHDT 526
           + H+  + SL  TS G+   L++ S DKT+  W          G   KF VP+      +
Sbjct: 14  EGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLT-------GDDQKFGVPVRSFKGHS 65

Query: 527 TLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
            +     +    ++ D  Y   +  D T++++ + + + Y    GHK  V+S+DI   + 
Sbjct: 66  HI-----VQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS 120

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP------ESHNFFSCSKDAVVK 640
           MII+ S DK IK+W +  G C  +L  H D +  V+ +P      +S    S   D +VK
Sbjct: 121 MIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 641 YWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
            W+  +F+       H S +  L  S DG+ + S+  D  I +W
Sbjct: 180 AWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLW 223

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 74/322 (22%), Positives = 131/322 (40%), Gaps = 43/322 (13%)

Query: 387 LQGQRTDVRSIDVS--DDNKLLATASNGSLKIWNV-----KTHKCIRTFECGYALT--CK 437
           L+G    V S+  S    N LL+ + + +L  W +     K    +R+F+    +   C 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 438 FLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTV 497
               G   +  +    L+L+D+A+          H + + S+D+      +++GS DKT+
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFV-GHKSDVMSVDIDKKASMIISGSRDKTI 131

Query: 498 KFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISP-----DDRYLAISLL- 551
           K W  + +                    T L  ND +  VR+ P     DD    IS   
Sbjct: 132 KVWTIKGQCLA-----------------TLLGHNDWVSQVRVVPNEKADDDSVTIISAGN 174

Query: 552 DNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSL 611
           D  VK + L+  +      GH   + ++  S D  +I ++  D  I +W L       +L
Sbjct: 175 DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTL 234

Query: 612 FAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKL------YAHQSEVWA--L 663
            A QD + S+ F P  + + + +    +K +  +    +  L      Y+  +E  A  L
Sbjct: 235 SA-QDEVFSLAFSPNRY-WLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSL 292

Query: 664 AISTDGSFVVSSSHDHSIRIWE 685
           A S DG  + +   D+ IR+W+
Sbjct: 293 AWSADGQTLFAGYTDNVIRVWQ 314

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 70/158 (44%), Gaps = 16/158 (10%)

Query: 89  QDTNLLAVG-YA-----DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKD 142
           QD  L A G YA     D  +++WD+ +      F GHK+ +  +  D   + +ISGS+D
Sbjct: 69  QDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRD 128

Query: 143 SNIIVWDLVGEVGLYKLRSHKDAITGFWC----QGED---WLVSTSKDGLIKIWDLKTQQ 195
             I VW + G+  L  L  H D ++        + +D    ++S   D ++K W+L   Q
Sbjct: 129 KTIKVWTIKGQC-LATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQ 187

Query: 196 CIETHIAHTGECWGLAVKDD--LLITTSTDSQVKIWKL 231
                I H      L    D  L+ +   D ++ +W L
Sbjct: 188 IEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNL 225

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 48/99 (48%), Gaps = 1/99 (1%)

Query: 100 DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D ++K W+L    +  +F GH + I  +     GT + S  KD  I++W+L  +  +Y L
Sbjct: 175 DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTL 234

Query: 160 RSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIE 198
            +  +  +  +     WL + +  G IK++ L  Q  ++
Sbjct: 235 SAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 38.9 bits (89), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 14/128 (10%)

Query: 116 NFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHK-DAITGFWCQGE 174
           +F GH   +      + G   +S S D  + +WD+       +   HK D ++    +  
Sbjct: 60  SFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA 119

Query: 175 DWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVK-------DD---LLITTSTDS 224
             ++S S+D  IK+W +K  QC+ T + H    W   V+       DD    +I+   D 
Sbjct: 120 SMIISGSRDKTIKVWTIK-GQCLATLLGHND--WVSQVRVVPNEKADDDSVTIISAGNDK 176

Query: 225 QVKIWKLN 232
            VK W LN
Sbjct: 177 MVKAWNLN 184

>YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,
           319 aa] {ON}  ASC1G-protein beta subunit and guanine
           nucleotide dissociation inhibitor for Gpa2p; ortholog of
           RACK1 that inhibits translation; core component of the
           small (40S) ribosomal subunit; represses Gcn4p in the
           absence of amino acid starvation
          Length = 319

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 103/224 (45%), Gaps = 23/224 (10%)

Query: 470 DAHDAAIWSLDLTSDGKR--LVTGSADKTVKFWDFQVEKTLVPGTKDKF-VPMLKLNHDT 526
           + H+  + SL  TS G+   L++ S DKT+  W          G   KF VP+      +
Sbjct: 14  EGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLT-------GDDQKFGVPVRSFKGHS 65

Query: 527 TLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
            +     +    ++ D  Y   +  D T++++ + + + Y    GHK  V+S+DI   + 
Sbjct: 66  HI-----VQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS 120

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP------ESHNFFSCSKDAVVK 640
           MII+ S DK IK+W +  G C  +L  H D +  V+ +P      +S    S   D +VK
Sbjct: 121 MIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 641 YWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
            W+  +F+       H S +  L  S DG+ + S+  D  I +W
Sbjct: 180 AWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLW 223

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 74/322 (22%), Positives = 131/322 (40%), Gaps = 43/322 (13%)

Query: 387 LQGQRTDVRSIDVS--DDNKLLATASNGSLKIWNV-----KTHKCIRTFECGYALT--CK 437
           L+G    V S+  S    N LL+ + + +L  W +     K    +R+F+    +   C 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 438 FLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTV 497
               G   +  +    L+L+D+A+          H + + S+D+      +++GS DKT+
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFV-GHKSDVMSVDIDKKASMIISGSRDKTI 131

Query: 498 KFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISP-----DDRYLAISLL- 551
           K W  + +                    T L  ND +  VR+ P     DD    IS   
Sbjct: 132 KVWTIKGQCLA-----------------TLLGHNDWVSQVRVVPNEKADDDSVTIISAGN 174

Query: 552 DNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSL 611
           D  VK + L+  +      GH   + ++  S D  +I ++  D  I +W L       +L
Sbjct: 175 DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTL 234

Query: 612 FAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKL------YAHQSEVWA--L 663
            A QD + S+ F P  + + + +    +K +  +    +  L      Y+  +E  A  L
Sbjct: 235 SA-QDEVFSLAFSPNRY-WLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSL 292

Query: 664 AISTDGSFVVSSSHDHSIRIWE 685
           A S DG  + +   D+ IR+W+
Sbjct: 293 AWSADGQTLFAGYTDNVIRVWQ 314

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 70/158 (44%), Gaps = 16/158 (10%)

Query: 89  QDTNLLAVG-YA-----DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKD 142
           QD  L A G YA     D  +++WD+ +      F GHK+ +  +  D   + +ISGS+D
Sbjct: 69  QDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRD 128

Query: 143 SNIIVWDLVGEVGLYKLRSHKDAITGFWC----QGED---WLVSTSKDGLIKIWDLKTQQ 195
             I VW + G+  L  L  H D ++        + +D    ++S   D ++K W+L   Q
Sbjct: 129 KTIKVWTIKGQC-LATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQ 187

Query: 196 CIETHIAHTGECWGLAVKDD--LLITTSTDSQVKIWKL 231
                I H      L    D  L+ +   D ++ +W L
Sbjct: 188 IEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNL 225

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 48/99 (48%), Gaps = 1/99 (1%)

Query: 100 DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D ++K W+L    +  +F GH + I  +     GT + S  KD  I++W+L  +  +Y L
Sbjct: 175 DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTL 234

Query: 160 RSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIE 198
            +  +  +  +     WL + +  G IK++ L  Q  ++
Sbjct: 235 SAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 38.9 bits (89), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 14/128 (10%)

Query: 116 NFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHK-DAITGFWCQGE 174
           +F GH   +      + G   +S S D  + +WD+       +   HK D ++    +  
Sbjct: 60  SFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA 119

Query: 175 DWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVK-------DD---LLITTSTDS 224
             ++S S+D  IK+W +K  QC+ T + H    W   V+       DD    +I+   D 
Sbjct: 120 SMIISGSRDKTIKVWTIK-GQCLATLLGHND--WVSQVRVVPNEKADDDSVTIISAGNDK 176

Query: 225 QVKIWKLN 232
            VK W LN
Sbjct: 177 MVKAWNLN 184

>NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 82.4 bits (202), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 102/231 (44%), Gaps = 22/231 (9%)

Query: 470 DAHDAAIWSLDLTSDGKR--LVTGSADKTVKFWDFQVEKTLVPGTKDKF-VPMLKLNHDT 526
           + H+  + SL  TS G+   L++GS DKT+  W          G   KF VP+      +
Sbjct: 14  EGHNGWVTSL-ATSAGQPNLLLSGSRDKTLISWKLT-------GDDQKFGVPVRSFKGHS 65

Query: 527 TLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
            +     +    ++ D  Y   +  D T++++ + + + Y    GHK  V+S+ I   + 
Sbjct: 66  HI-----VQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKAS 120

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN-----FFSCSKDAVVKY 641
           MII+ S DK IK+W +  G C  +L  H D +  V+  P   N       S   D +VK 
Sbjct: 121 MIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKA 179

Query: 642 WDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQVF 692
           W+  +F+       H   V  +  S DG+ + S+  D  I +W   E +  
Sbjct: 180 WNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAM 230

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 101/243 (41%), Gaps = 40/243 (16%)

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVEKT----------------------LVPGTKDKFVP 518
           LT DG   ++ S DKT++ WD    +T                      ++ G++DK + 
Sbjct: 73  LTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIK 132

Query: 519 MLKLNHD---TTLELNDDILSVRISP----DDRYLAISLL-DNTVKVFFLDSMKFYLSLY 570
           +  +      T L  ND +  VRI+P    DD    IS   D  VK + L+  +      
Sbjct: 133 VWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFV 192

Query: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNF 630
           GH   V ++  S D  +I ++  D  I +W L       +L A QD + ++ F P  + +
Sbjct: 193 GHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSA-QDEVFALAFSPNRY-W 250

Query: 631 FSCSKDAVVKYWDGEKFECIQKL------YAHQSEVWA--LAISTDGSFVVSSSHDHSIR 682
            + +  + +K +  +    +  L      Y   +E  A  LA S DG  + +   D  IR
Sbjct: 251 LAAATASGIKIFCLDPQSLVDDLRPEFAGYNKSAEPHAVSLAWSADGQTLFAGYTDSVIR 310

Query: 683 IWE 685
           +W+
Sbjct: 311 VWQ 313

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 62/140 (44%), Gaps = 9/140 (6%)

Query: 100 DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D  +++WD+ +      F GHK+ +  +  D   + +ISGS+D  I VW + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 160 RSHKDAITGFWCQGEDW------LVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVK 213
             H D ++       D       ++S   D ++K W+L   Q     + H G    +   
Sbjct: 145 LGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTVTAS 204

Query: 214 DD--LLITTSTDSQVKIWKL 231
            D  L+ +   D ++ +W L
Sbjct: 205 PDGTLIASAGKDGEIMLWNL 224

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 55/123 (44%), Gaps = 6/123 (4%)

Query: 568 SLYGHKLPVLSIDISF-DSKMIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMSV 621
           +L GH   V S+  S     ++++ S DK +  W L      FG   +S   H   +   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSI 681
               +     S S D  ++ WD    E  Q+   H+S+V ++AI    S ++S S D +I
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTI 131

Query: 682 RIW 684
           ++W
Sbjct: 132 KVW 134

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 46/99 (46%), Gaps = 1/99 (1%)

Query: 100 DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D ++K W+L    +  +F GH   +  +     GT + S  KD  I++W+L  +  +Y L
Sbjct: 174 DKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTL 233

Query: 160 RSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIE 198
            +  +     +     WL + +  G IKI+ L  Q  ++
Sbjct: 234 SAQDEVFALAFSPNRYWLAAATASG-IKIFCLDPQSLVD 271

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 57/124 (45%), Gaps = 13/124 (10%)

Query: 119 GHKAAIT-LMQFDSTGTRLISGSKDSNIIVWDLVGE-----VGLYKLRSHKDAITGFWC- 171
           GH   +T L         L+SGS+D  +I W L G+     V +   + H   +    C 
Sbjct: 15  GHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQD--CT 72

Query: 172 --QGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAV--KDDLLITTSTDSQVK 227
             Q   + +S S D  +++WD+ T +  +  + H  +   +A+  K  ++I+ S D  +K
Sbjct: 73  LTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIK 132

Query: 228 IWKL 231
           +W +
Sbjct: 133 VWTI 136

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 63/156 (40%), Gaps = 18/156 (11%)

Query: 92  NLLAVGYADGVIKVWDLVS-----KTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNII 146
           NLL  G  D  +  W L          + +F GH   +        G   +S S D  + 
Sbjct: 31  NLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLR 90

Query: 147 VWDLVGEVGLYKLRSHK-DAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG 205
           +WD+       +   HK D ++    +    ++S S+D  IK+W +K  QC+ T + H  
Sbjct: 91  LWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHND 149

Query: 206 ECWGLAVK-------DD--LLITTSTDSQVKIWKLN 232
             W   V+       DD   +I+   D  VK W LN
Sbjct: 150 --WVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLN 183

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 55/122 (45%), Gaps = 12/122 (9%)

Query: 389 GQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALTCKFLPGGLLVI 446
           G   +V ++  S D  L+A+A  +G + +WN+   K + T           F P    + 
Sbjct: 193 GHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEVFALAFSPNRYWLA 252

Query: 447 LGTRSGELQLFDLASSSLLDTI--------EDAHDAAIWSLDLTSDGKRLVTGSADKTVK 498
             T SG +++F L   SL+D +        + A   A+ SL  ++DG+ L  G  D  ++
Sbjct: 253 AATASG-IKIFCLDPQSLVDDLRPEFAGYNKSAEPHAV-SLAWSADGQTLFAGYTDSVIR 310

Query: 499 FW 500
            W
Sbjct: 311 VW 312

>ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 114/254 (44%), Gaps = 21/254 (8%)

Query: 375 TSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGYA 433
           T+P P+ +     +G R +V S+    DNK +AT+S +G++K+W+V+     R ++    
Sbjct: 63  TNPNPVAS----FEGHRGNVTSVSFQQDNKWMATSSEDGTIKVWDVRAPSIPRNYKLNAP 118

Query: 434 LTCKFL-PGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGS 492
           +    + P    +I   R G ++++DL  +     +    D  + SL L SDG  LV  +
Sbjct: 119 VNEVVIHPNQGELISCDRDGHIRIWDLGENQCTHQLTPEDDTPLQSLSLASDGSMLVAAN 178

Query: 493 ADKTVKFWDFQVEKTLVPGTKD--KFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISL 550
                  W+       +P   D     P+ K     T      I  + +S D ++LA   
Sbjct: 179 NKGNCYVWE-------MPNRTDASNLKPVTKFRSHNTY-----ITRILLSSDVKHLATCS 226

Query: 551 LDNTVKVFFLD-SMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK 609
            D+T +V+ +D + K   +L GH+  V     S DS  ++T+S+D  +++W L   +  +
Sbjct: 227 ADHTARVWSVDDNFKLETTLDGHQRWVWDCAFSADSAYLMTASSDHYVRLWDLSTREIVR 286

Query: 610 SLFAHQDSIMSVKF 623
               H    + V  
Sbjct: 287 QYGGHHKGAVCVAL 300

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/291 (19%), Positives = 120/291 (41%), Gaps = 27/291 (9%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALTCKF-LPGGLLVILGTRSGELQLFDLASSS 463
           L++   + +++ W   T  C RT +   +   +  +     ++       ++L+D+ +++
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGHQNVRLYDIRTTN 64

Query: 464 LLDTIE-DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKL 522
                  + H   + S+    D K + T S D T+K WD +              P +  
Sbjct: 65  PNPVASFEGHRGNVTSVSFQQDNKWMATSSEDGTIKVWDVRA-------------PSIPR 111

Query: 523 NHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHK-LPVLSIDI 581
           N+    +LN  +  V I P+   L     D  ++++ L   +    L      P+ S+ +
Sbjct: 112 NY----KLNAPVNEVVIHPNQGELISCDRDGHIRIWDLGENQCTHQLTPEDDTPLQSLSL 167

Query: 582 SFDSKMIITSSADKNIKIWGLDFGDCHKSL------FAHQDSIMSVKFLPESHNFFSCSK 635
           + D  M++ ++   N  +W +       +L       +H   I  +    +  +  +CS 
Sbjct: 168 ASDGSMLVAANNKGNCYVWEMPNRTDASNLKPVTKFRSHNTYITRILLSSDVKHLATCSA 227

Query: 636 DAVVKYWD-GEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           D   + W   + F+    L  HQ  VW  A S D ++++++S DH +R+W+
Sbjct: 228 DHTARVWSVDDNFKLETTLDGHQRWVWDCAFSADSAYLMTASSDHYVRLWD 278

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/243 (20%), Positives = 88/243 (36%), Gaps = 62/243 (25%)

Query: 41  LITSALENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYAD 100
           L  +  +NV ++DI+T +         P   +  +G +    T +   QD   +A    D
Sbjct: 47  LAAAGHQNVRLYDIRTTN---------PNPVASFEGHR-GNVTSVSFQQDNKWMATSSED 96

Query: 101 GVIKVWDLVSKTVLLNF-----------------------NGH----------------- 120
           G IKVWD+ + ++  N+                       +GH                 
Sbjct: 97  GTIKVWDVRAPSIPRNYKLNAPVNEVVIHPNQGELISCDRDGHIRIWDLGENQCTHQLTP 156

Query: 121 --KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEV------GLYKLRSHKDAITGFWCQ 172
                +  +   S G+ L++ +   N  VW++           + K RSH   IT     
Sbjct: 157 EDDTPLQSLSLASDGSMLVAANNKGNCYVWEMPNRTDASNLKPVTKFRSHNTYITRILLS 216

Query: 173 GE-DWLVSTSKDGLIKIWDLKTQQCIETHI-AHTGECWGLAVKDD--LLITTSTDSQVKI 228
            +   L + S D   ++W +     +ET +  H    W  A   D   L+T S+D  V++
Sbjct: 217 SDVKHLATCSADHTARVWSVDDNFKLETTLDGHQRWVWDCAFSADSAYLMTASSDHYVRL 276

Query: 229 WKL 231
           W L
Sbjct: 277 WDL 279

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 59/118 (50%), Gaps = 4/118 (3%)

Query: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSC 633
           V  ++I+ D K++  ++  +N++++ +   + +   S   H+ ++ SV F  ++    + 
Sbjct: 35  VNRLEITNDKKLL-AAAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNKWMATS 93

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQV 691
           S+D  +K WD  +   I + Y   + V  + I  +   ++S   D  IRIW+  E+Q 
Sbjct: 94  SEDGTIKVWD-VRAPSIPRNYKLNAPVNEVVIHPNQGELISCDRDGHIRIWDLGENQC 150

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 30/149 (20%), Positives = 67/149 (44%), Gaps = 9/149 (6%)

Query: 93  LLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDL-- 150
           L++ GY D  I+ W+ ++           + +  ++  +   +L++ +   N+ ++D+  
Sbjct: 5   LVSAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLEI-TNDKKLLAAAGHQNVRLYDIRT 62

Query: 151 VGEVGLYKLRSHKDAITGFWCQGED-WLVSTSKDGLIKIWDLKTQQCIETHI--AHTGEC 207
                +     H+  +T    Q ++ W+ ++S+DG IK+WD++       +   A   E 
Sbjct: 63  TNPNPVASFEGHRGNVTSVSFQQDNKWMATSSEDGTIKVWDVRAPSIPRNYKLNAPVNEV 122

Query: 208 WGLAVKDDLLITTSTDSQVKIWKLNMENE 236
             +      LI+   D  ++IW L  EN+
Sbjct: 123 -VIHPNQGELISCDRDGHIRIWDLG-ENQ 149

>Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR178W
           (PRP4) - associated with the U4/U6 snRNP [contig 8] FULL
          Length = 474

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 111/245 (45%), Gaps = 13/245 (5%)

Query: 440 PGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
           P G  +  G+ +G++++    S  ++ +++ AHD  I  +  +SD + L TG AD  VK 
Sbjct: 192 PDGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKI 251

Query: 500 WDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFF 559
           W+ Q +      +  +   ++   H+        +  V+  P DR++A +  D T +++ 
Sbjct: 252 WNPQAQ------SHSEASRVVLRGHEAR------VSKVKFHPSDRFVASASFDMTWRLWD 299

Query: 560 LDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 619
           ++         GH   V  +D   D  ++ ++  D    +W +  G     L  H   I 
Sbjct: 300 VERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIY 359

Query: 620 SVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTD-GSFVVSSSHD 678
            V + P  H+  + S D  V+ WD  K      + AH S V  +    + G+F+VSSS+D
Sbjct: 360 GVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYD 419

Query: 679 HSIRI 683
            +I +
Sbjct: 420 RTIGV 424

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 133/292 (45%), Gaps = 44/292 (15%)

Query: 325 ILHP--FQTVRSLY-----KIKSASWTTVTSSKLELVVTTSNNTIEYYSIPYEKRDPTSP 377
           ILHP   + VRSL      KI   +W++   S+L L    ++N ++ +       +P + 
Sbjct: 208 ILHPQSLEVVRSLDGAHDDKIGGVAWSS--DSQL-LATGGADNLVKIW-------NPQAQ 257

Query: 378 APLKTHTIELQGQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGYALTC 436
           +  +   + L+G    V  +     ++ +A+AS + + ++W+V+    ++  E G+A   
Sbjct: 258 SHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQE-GHAKEV 316

Query: 437 KFLP----GGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGS 492
             L     G LL   G  S    ++D+ +   L  +E  H   I+ +  + +G  + TGS
Sbjct: 317 YCLDFQCDGSLLCSAGLDSVG-HVWDMRTGRSLMVLE-GHAKPIYGVSWSPNGHHVATGS 374

Query: 493 ADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILS-VRISPDD-RYLAISL 550
            D TV+ WD +                 K N  +++  ++ I+S V    ++  +L  S 
Sbjct: 375 GDGTVQVWDIR-----------------KANKPSSILAHNSIVSEVNFEKENGNFLVSSS 417

Query: 551 LDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGL 602
            D T+ VF   S     SL GH   +LS+DIS     + +S  D+++KIW L
Sbjct: 418 YDRTIGVFATGSWIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWAL 469

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 72/167 (43%), Gaps = 5/167 (2%)

Query: 524 HDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYG-HKLPVLSIDIS 582
           H + +  +  +  V  SPD   LA    +  VK+    S++   SL G H   +  +  S
Sbjct: 175 HGSQVVFSRPVSQVARSPDGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWS 234

Query: 583 FDSKMIITSSADKNIKIWGLDFGDCHKS----LFAHQDSIMSVKFLPESHNFFSCSKDAV 638
            DS+++ T  AD  +KIW        ++    L  H+  +  VKF P      S S D  
Sbjct: 235 SDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMT 294

Query: 639 VKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
            + WD E+   +Q    H  EV+ L    DGS + S+  D    +W+
Sbjct: 295 WRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWD 341

 Score = 57.8 bits (138), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 103/252 (40%), Gaps = 27/252 (10%)

Query: 400 SDDNKLLATASNGSL-KIWN--VKTHK-----CIRTFECGYALTCKFLPGGLLVILGTRS 451
           S D++LLAT    +L KIWN   ++H       +R  E   +   KF P    V   +  
Sbjct: 234 SSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVS-KVKFHPSDRFVASASFD 292

Query: 452 GELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPG 511
              +L+D+   + L  +++ H   ++ LD   DG  L +   D     WD +  ++L   
Sbjct: 293 MTWRLWDVERETEL-QLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSL--- 348

Query: 512 TKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYG 571
                  M+   H         I  V  SP+  ++A    D TV+V+ +       S+  
Sbjct: 349 -------MVLEGHAKP------IYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSILA 395

Query: 572 HKLPVLSIDISFDS-KMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNF 630
           H   V  ++   ++   +++SS D+ I ++         SL  H D I+SV       N 
Sbjct: 396 HNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWIKLASLQGHTDKILSVDISRGGANL 455

Query: 631 FSCSKDAVVKYW 642
           +S   D  VK W
Sbjct: 456 WSSGWDRSVKIW 467

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 72/158 (45%), Gaps = 15/158 (9%)

Query: 90  DTNLLAVGYADGVIKVWDL-------VSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKD 142
           D+ LLA G AD ++K+W+         S+ VL    GH+A ++ ++F  +   + S S D
Sbjct: 236 DSQLLATGGADNLVKIWNPQAQSHSEASRVVL---RGHEARVSKVKFHPSDRFVASASFD 292

Query: 143 SNIIVWDLVGEVGLYKLRSHKDAI--TGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETH 200
               +WD+  E  L     H   +    F C G   L S   D +  +WD++T + +   
Sbjct: 293 MTWRLWDVERETELQLQEGHAKEVYCLDFQCDGS-LLCSAGLDSVGHVWDMRTGRSLMVL 351

Query: 201 IAHTGECWGLAVKDD--LLITTSTDSQVKIWKLNMENE 236
             H    +G++   +   + T S D  V++W +   N+
Sbjct: 352 EGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANK 389

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 53/126 (42%), Gaps = 1/126 (0%)

Query: 80  AECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISG 139
           A  + ++ H     +A    D   ++WD+  +T L    GH   +  + F   G+ L S 
Sbjct: 272 ARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSA 331

Query: 140 SKDSNIIVWDLVGEVGLYKLRSHKDAITGF-WCQGEDWLVSTSKDGLIKIWDLKTQQCIE 198
             DS   VWD+     L  L  H   I G  W      + + S DG +++WD++      
Sbjct: 332 GLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPS 391

Query: 199 THIAHT 204
           + +AH 
Sbjct: 392 SILAHN 397

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 69/159 (43%), Gaps = 4/159 (2%)

Query: 81  ECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGS 140
           E   L+   D +LL     D V  VWD+ +   L+   GH   I  + +   G  + +GS
Sbjct: 315 EVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGS 374

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDAIT--GFWCQGEDWLVSTSKDGLIKIWDLKTQQCIE 198
            D  + VWD+        + +H   ++   F  +  ++LVS+S D  I ++   +   + 
Sbjct: 375 GDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWIKLA 434

Query: 199 THIAHTGECWGLAVKDDL--LITTSTDSQVKIWKLNMEN 235
           +   HT +   + +      L ++  D  VKIW L + +
Sbjct: 435 SLQGHTDKILSVDISRGGANLWSSGWDRSVKIWALGVRS 473

>KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 755

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 98/215 (45%), Gaps = 7/215 (3%)

Query: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEK--TLVPGTKDKFVPMLKLNHDTTLEL 530
           ++ + SL+ + D +    G  D  VK W    E   + +P  +D+     + N+ T +  
Sbjct: 427 NSEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDE-----RSNNATLVGH 481

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
           +  + S   SPD+RYL  +  D TV+++  D+    +S  GH  P+  +  S       T
Sbjct: 482 SGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGHYFAT 541

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
           +S D+  ++W  D     +    H + + +V F P     F+ S D   + WD    + +
Sbjct: 542 ASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGDSV 601

Query: 651 QKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           +    H + V A A+S DG ++ + S D  I +W+
Sbjct: 602 RLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWD 636

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 95/216 (43%), Gaps = 17/216 (7%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLEL 530
            H   ++S   + D + L++ S DKTV+ W      +LV                +    
Sbjct: 480 GHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLV----------------SYKGH 523

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
           N  I  V  SP   Y A +  D T +++  D +       GH   V ++    +   + T
Sbjct: 524 NHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFT 583

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
            S+DK  ++W +  GD  +    H   + +    P+     + S+D ++  WD    + +
Sbjct: 584 GSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTGKRL 643

Query: 651 QKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           +++  H ++ V++L+ S +G  +VS   DHS+R+W+
Sbjct: 644 KQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWD 679

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 70/151 (46%), Gaps = 5/151 (3%)

Query: 387 LQGQRTDVRSIDVSDDNKLLAT-ASNGSLKIWNVKTHKCIRTF--ECGYALTCKFLPGGL 443
             G   DV ++    +   + T +S+ + ++W++ T   +R F             P G 
Sbjct: 562 FAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGR 621

Query: 444 LVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQ 503
            +  G+  G + ++D+ +   L  +      A++SL  + +G  LV+G AD +++ WD +
Sbjct: 622 WLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDVK 681

Query: 504 VEKTLVPGTKDKFVPMLKLNHDTTLELNDDI 534
            + T  PG++ +  P    + D T  +N DI
Sbjct: 682 -KSTAEPGSEPE-QPFTSFSGDVTTSVNQDI 710

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH A +T       G  L +GS+D  
Sbjct: 572 VSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGI 631

Query: 145 IIVWDLVGEVGLYKLRSH-KDAITGFWCQGEDW-LVSTSKDGLIKIWDLK 192
           I VWD+     L ++R H K+A+       E   LVS   D  +++WD+K
Sbjct: 632 INVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDVK 681

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/152 (21%), Positives = 63/152 (41%), Gaps = 4/152 (2%)

Query: 94  LAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   GT + +GS D    +WD+   
Sbjct: 539 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTG 598

Query: 154 VGLYKLRSHKDAITGFWCQGED-WLVSTSKDGLIKIWDLKTQQCIETHIAH-TGECWGLA 211
             +     H   +T      +  WL + S+DG+I +WD+ T + ++    H     + L+
Sbjct: 599 DSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLS 658

Query: 212 VKDD--LLITTSTDSQVKIWKLNMENEKMGEK 241
              +  +L++   D  +++W +     + G +
Sbjct: 659 YSKEGHVLVSGGADHSLRVWDVKKSTAEPGSE 690

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 44/101 (43%), Gaps = 13/101 (12%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           +WD+ TGD V        P             T   V  D   L+ G  DG+I VWD+ +
Sbjct: 592 MWDMSTGDSVRLFLGHTAP------------VTATAVSPDGRWLSTGSEDGIINVWDIGT 639

Query: 111 KTVLLNFNGH-KAAITLMQFDSTGTRLISGSKDSNIIVWDL 150
              L    GH K A+  + +   G  L+SG  D ++ VWD+
Sbjct: 640 GKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDV 680

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/224 (19%), Positives = 72/224 (32%), Gaps = 63/224 (28%)

Query: 80  AECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFN-------------GHKAAITL 126
           +E T LE   D  L + G+ D ++K+W L  + +                  GH   +  
Sbjct: 428 SEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNNATLVGHSGTVYS 487

Query: 127 MQFDSTGTRLISGSKDS-------------------NIIVWDLV-GEVGLYKLRSHKDAI 166
             F      L+S S+D                    N  +WD+    +G Y   +  D  
Sbjct: 488 TAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGHYFATASHDQT 547

Query: 167 TGFWC-----------------------QGEDWLVSTSKDGLIKIWDLKTQQCIETHIAH 203
              W                            ++ + S D   ++WD+ T   +   + H
Sbjct: 548 ARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLGH 607

Query: 204 TGECWGLAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEM 245
           T      AV  D   L T S D  + +W +       G++L +M
Sbjct: 608 TAPVTATAVSPDGRWLSTGSEDGIINVWDIG-----TGKRLKQM 646

 Score = 38.5 bits (88), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 55/133 (41%), Gaps = 18/133 (13%)

Query: 114 LLNFNGHKAAITLMQFDSTGTRLIS-GSKDSNIIVWDLVGEVGLYKLRSHKD-------- 164
           +  F+   + +T ++F S   RL S G +DS + +W L GE    KL S +D        
Sbjct: 420 MYTFHNTNSEMTSLEF-SDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNNATL 478

Query: 165 ------AITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKD--DL 216
                   +  +     +L+S S+D  +++W   T   + ++  H    W +A       
Sbjct: 479 VGHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGHY 538

Query: 217 LITTSTDSQVKIW 229
             T S D   ++W
Sbjct: 539 FATASHDQTARLW 551

>Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR198C
           (TAF5) - Probable transcription-associated factor
           protein, probable -transducin type [contig 24] FULL
          Length = 755

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 96/216 (44%), Gaps = 17/216 (7%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLEL 530
            H   ++S   + D + L++ S DKTV+ W      +LV             N+      
Sbjct: 480 GHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLV-------------NYKGH--- 523

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
           N  I  V  SP   Y A +  D T +++  D +       GH   V ++    +   + T
Sbjct: 524 NHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFT 583

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
            S+DK  ++W +  GD  +    H   + S    P+     + S+D V+  WD    + +
Sbjct: 584 GSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRL 643

Query: 651 QKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           +++  H ++ V++L+ S +G  ++S   DHS+R+W+
Sbjct: 644 KQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWD 679

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 98/215 (45%), Gaps = 7/215 (3%)

Query: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVE--KTLVPGTKDKFVPMLKLNHDTTLEL 530
           ++ + SL+ + D +    G  D  +K W    E  K  +P  + +     + N++T +  
Sbjct: 427 NSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGE-----RTNNETLVGH 481

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
           +  + S   SPD+RYL  +  D TV+++  D+    ++  GH  P+  +  S       T
Sbjct: 482 SGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFAT 541

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
           +S D+  ++W  D     +    H + + +V F P     F+ S D   + WD    + +
Sbjct: 542 ASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSV 601

Query: 651 QKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           +    H + V + A+S DG ++ + S D  I +W+
Sbjct: 602 RLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWD 636

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 78/170 (45%), Gaps = 13/170 (7%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDS--MKFYL-----------SLYGHKLPVL 577
           N ++ S+  S D R  A    D+ +K++ LD   +K  L           +L GH   V 
Sbjct: 427 NSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVY 486

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDA 637
           S   S D++ ++++S DK +++W  D      +   H   I  V F P  H F + S D 
Sbjct: 487 STSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQ 546

Query: 638 VVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEET 687
             + W  +    ++    H ++V  ++   +G++V + S D + R+W+ T
Sbjct: 547 TARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDIT 596

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 62/150 (41%), Gaps = 4/150 (2%)

Query: 94  LAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   GT + +GS D    +WD+   
Sbjct: 539 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSG 598

Query: 154 VGLYKLRSHKDAITGFWCQGED-WLVSTSKDGLIKIWDLKTQQCIETHIAH-TGECWGLA 211
             +     H   +T      +  WL + S+DG+I +WD+ T + ++    H     + L+
Sbjct: 599 DSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLS 658

Query: 212 VKDD--LLITTSTDSQVKIWKLNMENEKMG 239
              +  +LI+   D  V++W +     + G
Sbjct: 659 YSKEGHVLISGGADHSVRVWDVKKSTAEPG 688

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           +  H +   +  G +D   ++WD+ S   +  F GH A +T       G  L +GS+D  
Sbjct: 572 VSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGV 631

Query: 145 IIVWDLVGEVGLYKLRSH-KDAITGFWCQGEDW-LVSTSKDGLIKIWDLK 192
           I VWD+     L ++R H K+A+       E   L+S   D  +++WD+K
Sbjct: 632 INVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVK 681

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 48/108 (44%), Gaps = 13/108 (12%)

Query: 44  SALENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVI 103
           S+ +   +WDI +GD V        P  S A            V  D   L+ G  DGVI
Sbjct: 585 SSDKTCRMWDITSGDSVRLFLGHTAPVTSTA------------VSPDGRWLSTGSEDGVI 632

Query: 104 KVWDLVSKTVLLNFNGH-KAAITLMQFDSTGTRLISGSKDSNIIVWDL 150
            VWD+ +   L    GH K A+  + +   G  LISG  D ++ VWD+
Sbjct: 633 NVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDV 680

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/169 (20%), Positives = 60/169 (35%), Gaps = 18/169 (10%)

Query: 80  AECTYLEVHQDTNLLAVGYADGVIKVWDL-------------VSKTVLLNFNGHKAAITL 126
           +E T LE   D  L A G+ D +IK+W L               +T      GH   +  
Sbjct: 428 SEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYS 487

Query: 127 MQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAI--TGFWCQGEDWLVSTSKDG 184
             F      L+S S+D  + +W       L   + H   I    F   G  +  + S D 
Sbjct: 488 TSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGH-YFATASHDQ 546

Query: 185 LIKIWDLKTQQCIETHIAHTGECWGLAVKDD--LLITTSTDSQVKIWKL 231
             ++W       +     H  +   ++   +   + T S+D   ++W +
Sbjct: 547 TARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDI 595

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 53/132 (40%), Gaps = 16/132 (12%)

Query: 114 LLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKL------RSHKDAIT 167
           +  F+   + +T ++F        +G +DS I +W L GE    KL      R++ + + 
Sbjct: 420 MYTFHNTNSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLV 479

Query: 168 GF--------WCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKD--DLL 217
           G         +     +L+S S+D  +++W   T   +  +  H    W +A        
Sbjct: 480 GHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYF 539

Query: 218 ITTSTDSQVKIW 229
            T S D   ++W
Sbjct: 540 ATASHDQTARLW 551

>NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 82.0 bits (201), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 101/227 (44%), Gaps = 22/227 (9%)

Query: 470 DAHDAAIWSLDLTSDGKR--LVTGSADKTVKFWDFQVEKTLVPGTKDKF-VPMLKLNHDT 526
           + H+  + SL  TS G+   L++ S DKT+  W          G   KF VP+      +
Sbjct: 14  EGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLT-------GDDQKFGVPVRSFKGHS 65

Query: 527 TLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
            +     +    ++ D  Y   +  D T++++ + + + Y    GHK  V+S+ I   + 
Sbjct: 66  HI-----VQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKAS 120

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN-----FFSCSKDAVVKY 641
           MII+ S DK IK+W +  G C  +L  H D +  V+  P   N       S   D +VK 
Sbjct: 121 MIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKA 179

Query: 642 WDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETE 688
           W+  +F+       H   V A+  S DGS + S+  D  I +W   E
Sbjct: 180 WNLNQFQIEADFVGHNGNVNAVTASPDGSLIASAGKDGEIMLWNLLE 226

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 103/243 (42%), Gaps = 40/243 (16%)

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVEKT----------------------LVPGTKDKFVP 518
           LT DG   ++ S DKT++ WD    +T                      ++ G++DK + 
Sbjct: 73  LTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIK 132

Query: 519 MLKLNHD---TTLELNDDILSVRISP----DDRYLAISLL-DNTVKVFFLDSMKFYLSLY 570
           +  +      T L  ND +  VRI+P    DD    IS   D  VK + L+  +      
Sbjct: 133 VWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKAWNLNQFQIEADFV 192

Query: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNF 630
           GH   V ++  S D  +I ++  D  I +W L       +L A QD + ++ F P  + +
Sbjct: 193 GHNGNVNAVTASPDGSLIASAGKDGEIMLWNLLEKTAMYTLSA-QDEVFALAFSPNRY-W 250

Query: 631 FSCSKDAVVKYWDGEKFECIQKL------YAHQSEVWALAI--STDGSFVVSSSHDHSIR 682
            + +  + VK +  +    I  L      Y   +E  A+++  S DG  + +   D+ IR
Sbjct: 251 LAAATASGVKIFSLDPQSLIDDLRPEFAGYNKAAEPHAVSLTWSADGQTLFAGYTDNVIR 310

Query: 683 IWE 685
           +W+
Sbjct: 311 VWQ 313

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 62/140 (44%), Gaps = 9/140 (6%)

Query: 100 DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D  +++WD+ +      F GHK+ +  +  D   + +ISGS+D  I VW + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 160 RSHKDAITGFWCQGEDW------LVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVK 213
             H D ++       D       ++S   D ++K W+L   Q     + H G    +   
Sbjct: 145 LGHNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTAS 204

Query: 214 DD--LLITTSTDSQVKIWKL 231
            D  L+ +   D ++ +W L
Sbjct: 205 PDGSLIASAGKDGEIMLWNL 224

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 56/123 (45%), Gaps = 6/123 (4%)

Query: 568 SLYGHKLPVLSIDISF-DSKMIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMSV 621
           +L GH   V S+  S     +++++S DK +  W L      FG   +S   H   +   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSI 681
               +     S S D  ++ WD    E  Q+   H+S+V ++AI    S ++S S D +I
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTI 131

Query: 682 RIW 684
           ++W
Sbjct: 132 KVW 134

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 47/99 (47%), Gaps = 1/99 (1%)

Query: 100 DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D ++K W+L    +  +F GH   +  +     G+ + S  KD  I++W+L+ +  +Y L
Sbjct: 174 DKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGSLIASAGKDGEIMLWNLLEKTAMYTL 233

Query: 160 RSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIE 198
            +  +     +     WL + +  G +KI+ L  Q  I+
Sbjct: 234 SAQDEVFALAFSPNRYWLAAATASG-VKIFSLDPQSLID 271

 Score = 38.9 bits (89), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 52/121 (42%), Gaps = 10/121 (8%)

Query: 389 GQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALTCKFLPGGLLVI 446
           G   +V ++  S D  L+A+A  +G + +WN+     + T           F P    + 
Sbjct: 193 GHNGNVNAVTASPDGSLIASAGKDGEIMLWNLLEKTAMYTLSAQDEVFALAFSPNRYWLA 252

Query: 447 LGTRSGELQLFDLASSSLLDTIED-------AHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
             T SG +++F L   SL+D +         A +    SL  ++DG+ L  G  D  ++ 
Sbjct: 253 AATASG-VKIFSLDPQSLIDDLRPEFAGYNKAAEPHAVSLTWSADGQTLFAGYTDNVIRV 311

Query: 500 W 500
           W
Sbjct: 312 W 312

>TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.534
           YPR178W
          Length = 477

 Score = 83.6 bits (205), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 108/223 (48%), Gaps = 19/223 (8%)

Query: 465 LDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNH 524
           +DT++  H   +  + L   GK L + S D T + WD + +K +          +L+  H
Sbjct: 268 IDTLK-GHQGRVSDVKLHPLGKYLGSSSFDNTWRLWDIEKKKEI----------LLQEGH 316

Query: 525 DTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFD 584
                 + +I S+    D    A +  D+   ++ L S K  ++L GH  P+ S+D + +
Sbjct: 317 ------SKEIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLIGHAKPIYSLDWAPN 370

Query: 585 SKMIITSSADKNIKIWGLDFGDCH-KSLFAHQDSIMSVKFLPESHNF-FSCSKDAVVKYW 642
              + T S D  IKIW L   + +  S+FAH++ + SV++   +  F FS   D ++K  
Sbjct: 371 GYQLATGSGDGTIKIWDLRNKESNCASIFAHKNLVTSVQYEKNNGGFVFSAGYDKLIKIH 430

Query: 643 DGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           D + +E +  L  H  ++  L  S   + +VSS  D +++IW+
Sbjct: 431 DSKTYESVATLEGHTEKILTLDTSPISNLIVSSGWDRTVKIWD 473

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 73/154 (47%), Gaps = 5/154 (3%)

Query: 81  ECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGS 140
           E   L  H D +L A    D +  +WDL S   ++N  GH   I  + +   G +L +GS
Sbjct: 319 EIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLIGHAKPIYSLDWAPNGYQLATGS 378

Query: 141 KDSNIIVWDLVG-EVGLYKLRSHKDAITGFWCQGED--WLVSTSKDGLIKIWDLKTQQCI 197
            D  I +WDL   E     + +HK+ +T    +  +  ++ S   D LIKI D KT + +
Sbjct: 379 GDGTIKIWDLRNKESNCASIFAHKNLVTSVQYEKNNGGFVFSAGYDKLIKIHDSKTYESV 438

Query: 198 ETHIAHTGECWGLAVK--DDLLITTSTDSQVKIW 229
            T   HT +   L      +L++++  D  VKIW
Sbjct: 439 ATLEGHTEKILTLDTSPISNLIVSSGWDRTVKIW 472

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 112/241 (46%), Gaps = 31/241 (12%)

Query: 369 YEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRT 427
           YEK D TS   LK H    QG+ +DV+   +    K L ++S + + ++W+++  K I  
Sbjct: 260 YEKNDLTSIDTLKGH----QGRVSDVK---LHPLGKYLGSSSFDNTWRLWDIEKKKEI-L 311

Query: 428 FECGYA---LTCKFLPGGLLVILGTRSGELQLFDLASS-SLLDTIEDAHDAAIWSLDLTS 483
            + G++    +  F   G L           ++DL S  ++++ I   H   I+SLD   
Sbjct: 312 LQEGHSKEIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLI--GHAKPIYSLDWAP 369

Query: 484 DGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDD 543
           +G +L TGS D T+K WD + +++               N  +     + + SV+   ++
Sbjct: 370 NGYQLATGSGDGTIKIWDLRNKES---------------NCASIFAHKNLVTSVQYEKNN 414

Query: 544 RYLAISL-LDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGL 602
                S   D  +K+    + +   +L GH   +L++D S  S +I++S  D+ +KIW  
Sbjct: 415 GGFVFSAGYDKLIKIHDSKTYESVATLEGHTEKILTLDTSPISNLIVSSGWDRTVKIWDN 474

Query: 603 D 603
           D
Sbjct: 475 D 475

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 67/154 (43%), Gaps = 7/154 (4%)

Query: 537 VRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLY---GHKLPVLSIDISFDSKMIITSSA 593
           V+++P  + LA    D  + +  +D+M      +    H   +  I+ S D   + T   
Sbjct: 194 VKLAPQSKLLASGSWDGAISI--VDNMNLERKTHFQAAHVGKIGGIEWSNDEAYLFTGGE 251

Query: 594 DKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQ 651
           D  +K++G +  D     +L  HQ  +  VK  P      S S D   + WD EK + I 
Sbjct: 252 DCLVKVFGYEKNDLTSIDTLKGHQGRVSDVKLHPLGKYLGSSSFDNTWRLWDIEKKKEIL 311

Query: 652 KLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
               H  E+++LA  TDGS   ++  D    IW+
Sbjct: 312 LQEGHSKEIFSLAFHTDGSLTATAGFDSIGMIWD 345

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 49/113 (43%), Gaps = 1/113 (0%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSN 144
           +++H     L     D   ++WD+  K  +L   GH   I  + F + G+   +   DS 
Sbjct: 281 VKLHPLGKYLGSSSFDNTWRLWDIEKKKEILLQEGHSKEIFSLAFHTDGSLTATAGFDSI 340

Query: 145 IIVWDLVGEVGLYKLRSHKDAITGF-WCQGEDWLVSTSKDGLIKIWDLKTQQC 196
            ++WDL     +  L  H   I    W      L + S DG IKIWDL+ ++ 
Sbjct: 341 GMIWDLRSGKNIMNLIGHAKPIYSLDWAPNGYQLATGSGDGTIKIWDLRNKES 393

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 65/155 (41%), Gaps = 11/155 (7%)

Query: 85  LEVHQDTNLLAVGYADGVIKVW-----DLVSKTVLLNFNGHKAAITLMQFDSTGTRLISG 139
           +E   D   L  G  D ++KV+     DL S   L    GH+  ++ ++    G  L S 
Sbjct: 237 IEWSNDEAYLFTGGEDCLVKVFGYEKNDLTSIDTL---KGHQGRVSDVKLHPLGKYLGSS 293

Query: 140 SKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVSTSK-DGLIKIWDLKTQQCIE 198
           S D+   +WD+  +  +     H   I       +  L +T+  D +  IWDL++ + I 
Sbjct: 294 SFDNTWRLWDIEKKKEILLQEGHSKEIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKNIM 353

Query: 199 THIAHTGECWGL--AVKDDLLITTSTDSQVKIWKL 231
             I H    + L  A     L T S D  +KIW L
Sbjct: 354 NLIGHAKPIYSLDWAPNGYQLATGSGDGTIKIWDL 388

>KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa]
           {ON} Anc_2.431 YMR116C
          Length = 319

 Score = 81.3 bits (199), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 103/225 (45%), Gaps = 23/225 (10%)

Query: 470 DAHDAAIWSLDLTSDGKR--LVTGSADKTVKFWDFQVEKTLVPGTKDKF-VPMLKLNHDT 526
           + H+  + SL  TS G+   LV+ S DKT+  W          G   KF VP+      +
Sbjct: 14  EGHNGWVTSL-ATSAGQPNLLVSASRDKTLISWKLT-------GDDQKFGVPVRSFKGHS 65

Query: 527 TLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
            +     +  V ++PD  Y   +  D T++++ + + + Y    GHK  V+S+ I   + 
Sbjct: 66  HI-----VQDVTLTPDGAYALSASWDKTLRLWDVATGETYQRFVGHKGDVMSVAIDRKAS 120

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP------ESHNFFSCSKDAVVK 640
           MII+ S DK+IK+W +  G C  +L  H D +  V+  P      ++    S   D +VK
Sbjct: 121 MIISGSRDKSIKVWTIK-GQCLATLLGHNDWVSQVRVAPTEKENDDTVTVISAGNDKMVK 179

Query: 641 YWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
            W+  +F+       H + V  +  S DG+ + S+     I +W 
Sbjct: 180 AWNLNQFQIEADFVGHNANVNTITASPDGTLIASADKSGEIMLWN 224

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 102/256 (39%), Gaps = 45/256 (17%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKT----------------------L 508
            H   +  + LT DG   ++ S DKT++ WD    +T                      +
Sbjct: 63  GHSHIVQDVTLTPDGAYALSASWDKTLRLWDVATGETYQRFVGHKGDVMSVAIDRKASMI 122

Query: 509 VPGTKDKFVPMLKLNHD---TTLELNDDILSVRISP-----DDRYLAISLL-DNTVKVFF 559
           + G++DK + +  +      T L  ND +  VR++P     DD    IS   D  VK + 
Sbjct: 123 ISGSRDKSIKVWTIKGQCLATLLGHNDWVSQVRVAPTEKENDDTVTVISAGNDKMVKAWN 182

Query: 560 LDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 619
           L+  +      GH   V +I  S D  +I ++     I +W L       +L A QD + 
Sbjct: 183 LNQFQIEADFVGHNANVNTITASPDGTLIASADKSGEIMLWNLHNKTPMYTLNA-QDEVF 241

Query: 620 SVKFLPESH----------NFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDG 669
           +V F P  +            FS   +A++   D  + E +    A      +LA S DG
Sbjct: 242 AVAFSPNRYWLAAATASGIKIFSLDPEALI---DDLRPEFVGYNKAADPHAISLAWSADG 298

Query: 670 SFVVSSSHDHSIRIWE 685
             + +   D+ IR+W+
Sbjct: 299 QTLFAGYTDNVIRVWQ 314

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 57/123 (46%), Gaps = 6/123 (4%)

Query: 568 SLYGHKLPVLSIDISF-DSKMIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMSV 621
           +L GH   V S+  S     +++++S DK +  W L      FG   +S   H   +  V
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDV 71

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSI 681
              P+     S S D  ++ WD    E  Q+   H+ +V ++AI    S ++S S D SI
Sbjct: 72  TLTPDGAYALSASWDKTLRLWDVATGETYQRFVGHKGDVMSVAIDRKASMIISGSRDKSI 131

Query: 682 RIW 684
           ++W
Sbjct: 132 KVW 134

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 61/144 (42%), Gaps = 8/144 (5%)

Query: 100 DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D  +++WD+ +      F GHK  +  +  D   + +ISGS+D +I VW + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKGDVMSVAIDRKASMIISGSRDKSIKVWTIKGQC-LATL 144

Query: 160 RSHKDAITGFWCQGED-------WLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAV 212
             H D ++       +        ++S   D ++K W+L   Q     + H      +  
Sbjct: 145 LGHNDWVSQVRVAPTEKENDDTVTVISAGNDKMVKAWNLNQFQIEADFVGHNANVNTITA 204

Query: 213 KDDLLITTSTDSQVKIWKLNMENE 236
             D  +  S D   +I   N+ N+
Sbjct: 205 SPDGTLIASADKSGEIMLWNLHNK 228

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 65/152 (42%), Gaps = 8/152 (5%)

Query: 47  ENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVW 106
           +++ +W IK   L T L      G +D         T  E      +++ G  D ++K W
Sbjct: 129 KSIKVWTIKGQCLATLL------GHNDWVSQVRVAPTEKENDDTVTVISAGN-DKMVKAW 181

Query: 107 DLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAI 166
           +L    +  +F GH A +  +     GT + S  K   I++W+L  +  +Y L +  +  
Sbjct: 182 NLNQFQIEADFVGHNANVNTITASPDGTLIASADKSGEIMLWNLHNKTPMYTLNAQDEVF 241

Query: 167 TGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIE 198
              +     WL + +  G IKI+ L  +  I+
Sbjct: 242 AVAFSPNRYWLAAATASG-IKIFSLDPEALID 272

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 56/122 (45%), Gaps = 9/122 (7%)

Query: 119 GHKAAIT-LMQFDSTGTRLISGSKDSNIIVWDLVGE-----VGLYKLRSHKDAITGFWCQ 172
           GH   +T L         L+S S+D  +I W L G+     V +   + H   +      
Sbjct: 15  GHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDVTLT 74

Query: 173 GED-WLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAV--KDDLLITTSTDSQVKIW 229
            +  + +S S D  +++WD+ T +  +  + H G+   +A+  K  ++I+ S D  +K+W
Sbjct: 75  PDGAYALSASWDKTLRLWDVATGETYQRFVGHKGDVMSVAIDRKASMIISGSRDKSIKVW 134

Query: 230 KL 231
            +
Sbjct: 135 TI 136

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 53/124 (42%), Gaps = 10/124 (8%)

Query: 386 ELQGQRTDVRSIDVSDDNKLLATA-SNGSLKIWNVKTHKCIRTFEC-GYALTCKFLPGGL 443
           +  G   +V +I  S D  L+A+A  +G + +WN+     + T           F P   
Sbjct: 191 DFVGHNANVNTITASPDGTLIASADKSGEIMLWNLHNKTPMYTLNAQDEVFAVAFSPNRY 250

Query: 444 LVILGTRSGELQLFDLASSSLLDTIED-------AHDAAIWSLDLTSDGKRLVTGSADKT 496
            +   T SG +++F L   +L+D +         A D    SL  ++DG+ L  G  D  
Sbjct: 251 WLAAATASG-IKIFSLDPEALIDDLRPEFVGYNKAADPHAISLAWSADGQTLFAGYTDNV 309

Query: 497 VKFW 500
           ++ W
Sbjct: 310 IRVW 313

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 62/155 (40%), Gaps = 15/155 (9%)

Query: 92  NLLAVGYADGVIKVWDLVSK-----TVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNII 146
           NLL     D  +  W L          + +F GH   +  +     G   +S S D  + 
Sbjct: 31  NLLVSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDVTLTPDGAYALSASWDKTLR 90

Query: 147 VWDLVGEVGLYKLRSHK-DAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG 205
           +WD+       +   HK D ++    +    ++S S+D  IK+W +K  QC+ T + H  
Sbjct: 91  LWDVATGETYQRFVGHKGDVMSVAIDRKASMIISGSRDKSIKVWTIK-GQCLATLLGHND 149

Query: 206 ECWGLAV------KDD--LLITTSTDSQVKIWKLN 232
               + V       DD   +I+   D  VK W LN
Sbjct: 150 WVSQVRVAPTEKENDDTVTVISAGNDKMVKAWNLN 184

>TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {ON}
           Anc_8.544 YBR198C
          Length = 1034

 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 99/209 (47%), Gaps = 4/209 (1%)

Query: 478 SLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSV 537
           SLD +SD     TG  D  +K W   +E T +   +  +  +  +   T +  +D + SV
Sbjct: 710 SLDFSSDYTLAATGFQDSYIKIW--SLEGTSINENEQNYSQINSI-FKTLVGHSDAVYSV 766

Query: 538 RISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDIS-FDSKMIITSSADKN 596
             SP +R+L     D T +++  D+ K  +S  GH+ P+  ++ S   + +  T+S+D  
Sbjct: 767 NFSPCNRFLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGNNLFATASSDNT 826

Query: 597 IKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH 656
            ++W  D     + L  H   +  V F P     F+ S D   + WD    + ++    H
Sbjct: 827 ARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSVRLFIGH 886

Query: 657 QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
            S V A A+S DG ++ +++ D +I +W+
Sbjct: 887 SSAVTATAVSPDGRWLSTANEDGTITVWD 915

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 99/216 (45%), Gaps = 16/216 (7%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLEL 530
            H  A++S++ +   + L++GS DKT + W     K LV   K    P+  +N   T   
Sbjct: 758 GHSDAVYSVNFSPCNRFLLSGSGDKTARLWSTDTYKGLV-SYKGHEKPIWDVNFSPT--- 813

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
                       +   A +  DNT +V+  D +     L GH   V  +    + + + T
Sbjct: 814 -----------GNNLFATASSDNTARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFT 862

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
            S+DK  ++W L  GD  +    H  ++ +    P+     + ++D  +  WD    + +
Sbjct: 863 GSSDKTSRMWDLSSGDSVRLFIGHSSAVTATAVSPDGRWLSTANEDGTITVWDIGSGKKL 922

Query: 651 QKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           + +  H ++ +++L+ +  G+ +VSS  D+S+R+W+
Sbjct: 923 KSMRGHGKNSIYSLSYNKTGNILVSSGADNSVRVWD 958

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 68/146 (46%), Gaps = 8/146 (5%)

Query: 92  NLLAVGYADGVIKVW--DLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWD 149
           NL A   +D   +VW  D V    +L   GH + +  + F   G  + +GS D    +WD
Sbjct: 816 NLFATASSDNTARVWSCDRVYPVRILA--GHLSDVDCVSFHPNGQYVFTGSSDKTSRMWD 873

Query: 150 LVGEVGLYKLRSHKDAITGFWCQGED-WLVSTSKDGLIKIWDLKTQQCIETHIAH-TGEC 207
           L     +     H  A+T      +  WL + ++DG I +WD+ + + +++   H     
Sbjct: 874 LSSGDSVRLFIGHSSAVTATAVSPDGRWLSTANEDGTITVWDIGSGKKLKSMRGHGKNSI 933

Query: 208 WGLAVKD--DLLITTSTDSQVKIWKL 231
           + L+     ++L+++  D+ V++W +
Sbjct: 934 YSLSYNKTGNILVSSGADNSVRVWDI 959

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 63/276 (22%), Positives = 116/276 (42%), Gaps = 43/276 (15%)

Query: 393 DVRSIDVSDDNKLLATASNGS-LKIWNVKTHKCIRTFECGYA----------------LT 435
           ++ S+D S D  L AT    S +KIW+++    I   E  Y+                 +
Sbjct: 707 NMSSLDFSSDYTLAATGFQDSYIKIWSLEG-TSINENEQNYSQINSIFKTLVGHSDAVYS 765

Query: 436 CKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRL-VTGSAD 494
             F P    ++ G+     +L+   +   L + +  H+  IW ++ +  G  L  T S+D
Sbjct: 766 VNFSPCNRFLLSGSGDKTARLWSTDTYKGLVSYK-GHEKPIWDVNFSPTGNNLFATASSD 824

Query: 495 KTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNT 554
            T + W             D+  P+  L    +     D+  V   P+ +Y+     D T
Sbjct: 825 NTARVWSC-----------DRVYPVRILAGHLS-----DVDCVSFHPNGQYVFTGSSDKT 868

Query: 555 VKVFFL---DSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSL 611
            +++ L   DS++ ++   GH   V +  +S D + + T++ D  I +W +  G   KS+
Sbjct: 869 SRMWDLSSGDSVRLFI---GHSSAVTATAVSPDGRWLSTANEDGTITVWDIGSGKKLKSM 925

Query: 612 FAH-QDSIMSVKFLPESHNFFSCSKDAVVKYWDGEK 646
             H ++SI S+ +    +   S   D  V+ WD +K
Sbjct: 926 RGHGKNSIYSLSYNKTGNILVSSGADNSVRVWDIKK 961

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 54/107 (50%), Gaps = 2/107 (1%)

Query: 88  HQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIV 147
           H +   +  G +D   ++WDL S   +  F GH +A+T       G  L + ++D  I V
Sbjct: 854 HPNGQYVFTGSSDKTSRMWDLSSGDSVRLFIGHSSAVTATAVSPDGRWLSTANEDGTITV 913

Query: 148 WDLVGEVGLYKLRSH-KDAITGF-WCQGEDWLVSTSKDGLIKIWDLK 192
           WD+     L  +R H K++I    + +  + LVS+  D  +++WD+K
Sbjct: 914 WDIGSGKKLKSMRGHGKNSIYSLSYNKTGNILVSSGADNSVRVWDIK 960

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 58/164 (35%), Gaps = 17/164 (10%)

Query: 85  LEVHQDTNLLAVGYADGVIKVWDLVSKTVLLN-------------FNGHKAAITLMQFDS 131
           L+   D  L A G+ D  IK+W L   ++  N               GH  A+  + F  
Sbjct: 711 LDFSSDYTLAATGFQDSYIKIWSLEGTSINENEQNYSQINSIFKTLVGHSDAVYSVNFSP 770

Query: 132 TGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAI--TGFWCQGEDWLVSTSKDGLIKIW 189
               L+SGS D    +W      GL   + H+  I    F   G +   + S D   ++W
Sbjct: 771 CNRFLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGNNLFATASSDNTARVW 830

Query: 190 DLKTQQCIETHIAHTG--ECWGLAVKDDLLITTSTDSQVKIWKL 231
                  +     H    +C         + T S+D   ++W L
Sbjct: 831 SCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDL 874

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 48/101 (47%), Gaps = 13/101 (12%)

Query: 51  IWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVS 110
           +WD+ +GD V      L  G S A        T   V  D   L+    DG I VWD+ S
Sbjct: 871 MWDLSSGDSVR-----LFIGHSSA-------VTATAVSPDGRWLSTANEDGTITVWDIGS 918

Query: 111 KTVLLNFNGH-KAAITLMQFDSTGTRLISGSKDSNIIVWDL 150
              L +  GH K +I  + ++ TG  L+S   D+++ VWD+
Sbjct: 919 GKKLKSMRGHGKNSIYSLSYNKTGNILVSSGADNSVRVWDI 959

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 64/158 (40%), Gaps = 11/158 (6%)

Query: 93  LLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLIS-GSKDSNIIVWDLV 151
            L  G  D   ++W   +   L+++ GH+  I  + F  TG  L +  S D+   VW   
Sbjct: 774 FLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGNNLFATASSDNTARVWSCD 833

Query: 152 GEVGLYKLRSHKDAI--TGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWG 209
               +  L  H   +    F   G+ ++ + S D   ++WDL +   +   I H+     
Sbjct: 834 RVYPVRILAGHLSDVDCVSFHPNGQ-YVFTGSSDKTSRMWDLSSGDSVRLFIGHSSAVTA 892

Query: 210 LAVKDD--LLITTSTDSQVKIWKLNMENEKMGEKLTEM 245
            AV  D   L T + D  + +W +       G+KL  M
Sbjct: 893 TAVSPDGRWLSTANEDGTITVWDIG-----SGKKLKSM 925

>Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/277 (22%), Positives = 123/277 (44%), Gaps = 26/277 (9%)

Query: 352 ELVVTTSNNTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATAS- 410
           +L+ T  +  +  Y I       T+P P+ +     +G R +V S+    DN+ + T+S 
Sbjct: 45  KLLATAGHQNVRLYDI-----RTTNPNPVAS----FEGHRGNVTSVSFQQDNRWMVTSSE 95

Query: 411 NGSLKIWNVKTHKCIRTFECGYALTCKFL-PGGLLVILGTRSGELQLFDLASSSLLDTIE 469
           +G++K+W+V++    R ++    +    + P    +I   R G ++++DL  +     + 
Sbjct: 96  DGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 470 DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKD--KFVPMLKLNHDTT 527
              D ++ SL + SDG  L   ++      W+       +P   D     P+ K    +T
Sbjct: 156 PEDDTSLQSLSMASDGSMLAAANSKGNCYVWE-------MPNHTDASHLKPVTKFRAHST 208

Query: 528 LELNDDILSVRISPDDRYLAISLLDNTVKVFFL-DSMKFYLSLYGHKLPVLSIDISFDSK 586
                 I  + +S D ++LA    D+T +V+ + D  K   +L GH+  V     S DS 
Sbjct: 209 Y-----ITRILLSSDVKHLATCSADHTARVWSIEDDFKLETTLDGHQRWVWDCAFSADSA 263

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623
            ++T+S+D  +++W L   +  +    H    + V  
Sbjct: 264 YLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 61/291 (20%), Positives = 120/291 (41%), Gaps = 27/291 (9%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRSGE-LQLFDLASSS 463
           L++   + +++ W   T  C RT +   +   +        +L T   + ++L+D+ +++
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64

Query: 464 LLDTIE-DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKL 522
                  + H   + S+    D + +VT S D T+K WD +              P +  
Sbjct: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS-------------PSIPR 111

Query: 523 NHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVL-SIDI 581
           N+     +N+    V I P+   L     D  ++++ L   +    L       L S+ +
Sbjct: 112 NYKHNAPVNE----VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSM 167

Query: 582 SFDSKMIITSSADKNIKIWGL-DFGDCHK-----SLFAHQDSIMSVKFLPESHNFFSCSK 635
           + D  M+  +++  N  +W + +  D           AH   I  +    +  +  +CS 
Sbjct: 168 ASDGSMLAAANSKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSA 227

Query: 636 DAVVKYWDGEK-FECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           D   + W  E  F+    L  HQ  VW  A S D +++V++S DH +R+W+
Sbjct: 228 DHTARVWSIEDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/292 (20%), Positives = 127/292 (43%), Gaps = 30/292 (10%)

Query: 387 LQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVKT--HKCIRTFEC--GYALTCKFLPGG 442
           +Q   + V  +++++D KLLATA + ++++++++T     + +FE   G   +  F    
Sbjct: 28  IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDN 87

Query: 443 LLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
             ++  +  G ++++D+ S S+    +  H+A +  + +  +   L++   D  ++ WD 
Sbjct: 88  RWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 503 QVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS 562
                     +++    L    DT+L+      S+ ++ D   LA +       V+ + +
Sbjct: 146 G---------ENQCTHQLTPEDDTSLQ------SLSMASDGSMLAAANSKGNCYVWEMPN 190

Query: 563 ------MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGL--DFGDCHKSLFAH 614
                 +K       H   +  I +S D K + T SAD   ++W +  DF     +L  H
Sbjct: 191 HTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIEDDF-KLETTLDGH 249

Query: 615 QDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIS 666
           Q  +    F  +S    + S D  V+ WD    E +++   H      +A++
Sbjct: 250 QRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 94/224 (41%), Gaps = 23/224 (10%)

Query: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELND 532
           D+ +  L++T+D K+L+  +  + V+ +D    +T  P     F                
Sbjct: 32  DSQVNRLEITND-KKLLATAGHQNVRLYDI---RTTNPNPVASFEGH-----------RG 76

Query: 533 DILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSS 592
           ++ SV    D+R++  S  D T+KV+ + S     + Y H  PV  + I  +   +I+  
Sbjct: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135

Query: 593 ADKNIKIWGLDFGDCHKSLFAHQD-SIMSVKFLPESHNFFSCSKDAVVKYW------DGE 645
            D NI+IW L    C   L    D S+ S+    +     + +       W      D  
Sbjct: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNHTDAS 195

Query: 646 KFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETED 689
             + + K  AH + +  + +S+D   + + S DH+ R+W   +D
Sbjct: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIEDD 239

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 92/245 (37%), Gaps = 64/245 (26%)

Query: 41  LITSALENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYAD 100
           L T+  +NV ++DI+T +         P   +  +G +    T +   QD   +     D
Sbjct: 47  LATAGHQNVRLYDIRTTN---------PNPVASFEGHR-GNVTSVSFQQDNRWMVTSSED 96

Query: 101 GVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDL---------- 150
           G IKVWD+ S ++  N+  H A +  +        LIS  +D NI +WDL          
Sbjct: 97  GTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 151 ------------------------VGEVGLYKLRSHKDA-----ITGFWCQGE------- 174
                                    G   ++++ +H DA     +T F            
Sbjct: 156 PEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILL 215

Query: 175 ----DWLVSTSKDGLIKIWDLKTQQCIETHI-AHTGECWGLAVKDD--LLITTSTDSQVK 227
                 L + S D   ++W ++    +ET +  H    W  A   D   L+T S+D  V+
Sbjct: 216 SSDVKHLATCSADHTARVWSIEDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVR 275

Query: 228 IWKLN 232
           +W L+
Sbjct: 276 LWDLS 280

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 7/121 (5%)

Query: 80  AECTYLEVHQDTNLLAVGYADGVIKVWDL--VSKTVLLNFNGHKAAITLMQFDSTGTRLI 137
           ++   LE+  D  LLA      V +++D+   +   + +F GH+  +T + F      ++
Sbjct: 33  SQVNRLEITNDKKLLATAGHQNV-RLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMV 91

Query: 138 SGSKDSNIIVWDLVGEV--GLYKLRSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQ 195
           + S+D  I VWD+        YK  +  + +     QGE  L+S  +DG I+IWDL   Q
Sbjct: 92  TSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGENQ 149

Query: 196 C 196
           C
Sbjct: 150 C 150

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSC 633
           V  ++I+ D K++ T+   +N++++ +   + +   S   H+ ++ SV F  ++    + 
Sbjct: 35  VNRLEITNDKKLLATA-GHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTS 93

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQV 691
           S+D  +K WD  +   I + Y H + V  + I  +   ++S   D +IRIW+  E+Q 
Sbjct: 94  SEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/149 (20%), Positives = 71/149 (47%), Gaps = 9/149 (6%)

Query: 93  LLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDL-- 150
           L++ GY D  I+ W+ ++           + +  ++  +   +L++ +   N+ ++D+  
Sbjct: 5   LVSAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLEI-TNDKKLLATAGHQNVRLYDIRT 62

Query: 151 VGEVGLYKLRSHKDAITGFWCQGED-WLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWG 209
                +     H+  +T    Q ++ W+V++S+DG IK+WD+++   I  +  H      
Sbjct: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPS-IPRNYKHNAPVNE 121

Query: 210 LAVKDDL--LITTSTDSQVKIWKLNMENE 236
           + +  +   LI+   D  ++IW L  EN+
Sbjct: 122 VVIHPNQGELISCDRDGNIRIWDLG-ENQ 149

>Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/277 (22%), Positives = 123/277 (44%), Gaps = 26/277 (9%)

Query: 352 ELVVTTSNNTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATAS- 410
           +L+ T  +  +  Y I       T+P P+ +     +G R +V S+    DN+ + T+S 
Sbjct: 45  KLLATAGHQNVRLYDI-----RTTNPNPVAS----FEGHRGNVTSVSFQQDNRWMVTSSE 95

Query: 411 NGSLKIWNVKTHKCIRTFECGYALTCKFL-PGGLLVILGTRSGELQLFDLASSSLLDTIE 469
           +G++K+W+V++    R ++    +    + P    +I   R G ++++DL  +     + 
Sbjct: 96  DGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 470 DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKD--KFVPMLKLNHDTT 527
              D ++ SL + SDG  L   ++      W+       +P   D     P+ K    +T
Sbjct: 156 PEDDTSLQSLSMASDGSMLAAANSKGNCYVWE-------MPNRTDASHLKPVTKFRAHST 208

Query: 528 LELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS-MKFYLSLYGHKLPVLSIDISFDSK 586
                 I  + +S D ++LA    D+T +V+ +D   K   +L GH+  V     S DS 
Sbjct: 209 Y-----ITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSA 263

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623
            ++T+S+D  +++W L   +  +    H    + V  
Sbjct: 264 YLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/291 (20%), Positives = 119/291 (40%), Gaps = 27/291 (9%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRSGE-LQLFDLASSS 463
           L++   + +++ W   T  C RT +   +   +        +L T   + ++L+D+ +++
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64

Query: 464 LLDTIE-DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKL 522
                  + H   + S+    D + +VT S D T+K WD +              P +  
Sbjct: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS-------------PSIPR 111

Query: 523 NHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVL-SIDI 581
           N+     +N+    V I P+   L     D  ++++ L   +    L       L S+ +
Sbjct: 112 NYKHNAPVNE----VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSM 167

Query: 582 SFDSKMIITSSADKNIKIWGLDFGDCHKSL------FAHQDSIMSVKFLPESHNFFSCSK 635
           + D  M+  +++  N  +W +        L       AH   I  +    +  +  +CS 
Sbjct: 168 ASDGSMLAAANSKGNCYVWEMPNRTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSA 227

Query: 636 DAVVKYWD-GEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           D   + W   + F+    L  HQ  VW  A S D +++V++S DH +R+W+
Sbjct: 228 DHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/291 (19%), Positives = 126/291 (43%), Gaps = 28/291 (9%)

Query: 387 LQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVKT--HKCIRTFEC--GYALTCKFLPGG 442
           +Q   + V  +++++D KLLATA + ++++++++T     + +FE   G   +  F    
Sbjct: 28  IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDN 87

Query: 443 LLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
             ++  +  G ++++D+ S S+    +  H+A +  + +  +   L++   D  ++ WD 
Sbjct: 88  RWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 503 QVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS 562
                     +++    L    DT+L+      S+ ++ D   LA +       V+ + +
Sbjct: 146 G---------ENQCTHQLTPEDDTSLQ------SLSMASDGSMLAAANSKGNCYVWEMPN 190

Query: 563 ------MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG-DCHKSLFAHQ 615
                 +K       H   +  I +S D K + T SAD   ++W +D       +L  HQ
Sbjct: 191 RTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQ 250

Query: 616 DSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIS 666
             +    F  +S    + S D  V+ WD    E +++   H      +A++
Sbjct: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 94/224 (41%), Gaps = 23/224 (10%)

Query: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELND 532
           D+ +  L++T+D K+L+  +  + V+ +D    +T  P     F                
Sbjct: 32  DSQVNRLEITND-KKLLATAGHQNVRLYDI---RTTNPNPVASFEGH-----------RG 76

Query: 533 DILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSS 592
           ++ SV    D+R++  S  D T+KV+ + S     + Y H  PV  + I  +   +I+  
Sbjct: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135

Query: 593 ADKNIKIWGLDFGDCHKSLFAHQD-SIMSVKFLPESHNFFSCSKDAVVKYW------DGE 645
            D NI+IW L    C   L    D S+ S+    +     + +       W      D  
Sbjct: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNRTDAS 195

Query: 646 KFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETED 689
             + + K  AH + +  + +S+D   + + S DH+ R+W   +D
Sbjct: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 7/121 (5%)

Query: 80  AECTYLEVHQDTNLLAVGYADGVIKVWDL--VSKTVLLNFNGHKAAITLMQFDSTGTRLI 137
           ++   LE+  D  LLA      V +++D+   +   + +F GH+  +T + F      ++
Sbjct: 33  SQVNRLEITNDKKLLATAGHQNV-RLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMV 91

Query: 138 SGSKDSNIIVWDLVGEV--GLYKLRSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQ 195
           + S+D  I VWD+        YK  +  + +     QGE  L+S  +DG I+IWDL   Q
Sbjct: 92  TSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGENQ 149

Query: 196 C 196
           C
Sbjct: 150 C 150

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 53/245 (21%), Positives = 87/245 (35%), Gaps = 64/245 (26%)

Query: 41  LITSALENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYAD 100
           L T+  +NV ++DI+T +         P   +  +G +    T +   QD   +     D
Sbjct: 47  LATAGHQNVRLYDIRTTN---------PNPVASFEGHR-GNVTSVSFQQDNRWMVTSSED 96

Query: 101 GVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNI--------------- 145
           G IKVWD+ S ++  N+  H A +  +        LIS  +D NI               
Sbjct: 97  GTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 146 ----------------------------IVWDLVGEVG------LYKLRSHKDAITGFWC 171
                                        VW++           + K R+H   IT    
Sbjct: 156 PEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNRTDASHLKPVTKFRAHSTYITRILL 215

Query: 172 QGE-DWLVSTSKDGLIKIWDLKTQQCIETHI-AHTGECWGLAVKDD--LLITTSTDSQVK 227
             +   L + S D   ++W +     +ET +  H    W  A   D   L+T S+D  V+
Sbjct: 216 SSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVR 275

Query: 228 IWKLN 232
           +W L+
Sbjct: 276 LWDLS 280

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSC 633
           V  ++I+ D K++ T+   +N++++ +   + +   S   H+ ++ SV F  ++    + 
Sbjct: 35  VNRLEITNDKKLLATA-GHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTS 93

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQV 691
           S+D  +K WD  +   I + Y H + V  + I  +   ++S   D +IRIW+  E+Q 
Sbjct: 94  SEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/149 (20%), Positives = 71/149 (47%), Gaps = 9/149 (6%)

Query: 93  LLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDL-- 150
           L++ GY D  I+ W+ ++           + +  ++  +   +L++ +   N+ ++D+  
Sbjct: 5   LVSAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLEI-TNDKKLLATAGHQNVRLYDIRT 62

Query: 151 VGEVGLYKLRSHKDAITGFWCQGED-WLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWG 209
                +     H+  +T    Q ++ W+V++S+DG IK+WD+++   I  +  H      
Sbjct: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPS-IPRNYKHNAPVNE 121

Query: 210 LAVKDDL--LITTSTDSQVKIWKLNMENE 236
           + +  +   LI+   D  ++IW L  EN+
Sbjct: 122 VVIHPNQGELISCDRDGNIRIWDLG-ENQ 149

>TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 101/223 (45%), Gaps = 21/223 (9%)

Query: 470 DAHDAAIWSLDLTSDGKR--LVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTT 527
           + H+  + SL  TS G+   LV+ S DKT+  W       L    +   VP+        
Sbjct: 13  EGHNGWVTSL-ATSAGQPNLLVSASRDKTLISWK------LTGDDQQYGVPVRSFKGH-- 63

Query: 528 LELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM 587
              N  +    ++ D  Y   +  D T++++ + + + Y    GHK  V+S+ I   + M
Sbjct: 64  ---NHIVQDCALTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKASM 120

Query: 588 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP------ESHNFFSCSKDAVVKY 641
           II+ S DK IK+W +  GDC  +L  H D +  V+  P      ++    S   D +VK 
Sbjct: 121 IISGSRDKTIKVWSIK-GDCLATLLGHNDWVSQVRVAPNEKQEDDNVTLISAGSDKMVKA 179

Query: 642 WDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
           W+  +F+       H + + ++  S DGS V S+  D  I +W
Sbjct: 180 WNINQFQIEADFVGHNNYINSITASPDGSLVASAGKDGDIMLW 222

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 108/254 (42%), Gaps = 41/254 (16%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKT----------------------L 508
            H+  +    LT+DG   ++ S DKT++ W+    +T                      +
Sbjct: 62  GHNHIVQDCALTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKASMI 121

Query: 509 VPGTKDKFVPMLKLNHD---TTLELNDDILSVRISP-----DDRYLAISL-LDNTVKVFF 559
           + G++DK + +  +  D   T L  ND +  VR++P     DD    IS   D  VK + 
Sbjct: 122 ISGSRDKTIKVWSIKGDCLATLLGHNDWVSQVRVAPNEKQEDDNVTLISAGSDKMVKAWN 181

Query: 560 LDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 619
           ++  +      GH   + SI  S D  ++ ++  D +I +W L       +L A QD + 
Sbjct: 182 INQFQIEADFVGHNNYINSITASPDGSLVASAGKDGDIMLWNLKQKTPLYTLSA-QDEVF 240

Query: 620 SVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKL------YAHQSEVWALAI--STDGSF 671
           ++ F P  + + + +    +K +  E    I +L      Y   +E  A+++  S DG  
Sbjct: 241 ALAFSPNRY-WLTAATATGIKVYSLEDEVLIDELKPEFTGYNKAAEPHAVSLTWSADGQT 299

Query: 672 VVSSSHDHSIRIWE 685
           + +   D  IR+W+
Sbjct: 300 LFAGYTDSIIRVWQ 313

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 69/158 (43%), Gaps = 16/158 (10%)

Query: 89  QDTNLLAVG-YA-----DGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKD 142
           QD  L A G YA     D  +++W++ +      F GHK+ +  +  D   + +ISGS+D
Sbjct: 68  QDCALTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKASMIISGSRD 127

Query: 143 SNIIVWDLVGEVGLYKLRSHKDAITGFWC-----QGED--WLVSTSKDGLIKIWDLKTQQ 195
             I VW + G+  L  L  H D ++         Q +D   L+S   D ++K W++   Q
Sbjct: 128 KTIKVWSIKGDC-LATLLGHNDWVSQVRVAPNEKQEDDNVTLISAGSDKMVKAWNINQFQ 186

Query: 196 CIETHIAHTGECWGLAVKDD--LLITTSTDSQVKIWKL 231
                + H      +    D  L+ +   D  + +W L
Sbjct: 187 IEADFVGHNNYINSITASPDGSLVASAGKDGDIMLWNL 224

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 69/152 (45%), Gaps = 8/152 (5%)

Query: 47  ENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVW 106
           + + +W IK GD + TL      G +D            +   +  L++ G +D ++K W
Sbjct: 128 KTIKVWSIK-GDCLATL-----LGHNDWVSQVRVAPNEKQEDDNVTLISAG-SDKMVKAW 180

Query: 107 DLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAI 166
           ++    +  +F GH   I  +     G+ + S  KD +I++W+L  +  LY L +  +  
Sbjct: 181 NINQFQIEADFVGHNNYINSITASPDGSLVASAGKDGDIMLWNLKQKTPLYTLSAQDEVF 240

Query: 167 TGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIE 198
              +     WL + +  G IK++ L+ +  I+
Sbjct: 241 ALAFSPNRYWLTAATATG-IKVYSLEDEVLID 271

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 63/155 (40%), Gaps = 15/155 (9%)

Query: 92  NLLAVGYADGVIKVWDLVSK-----TVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNII 146
           NLL     D  +  W L          + +F GH   +      + G   +S S D  + 
Sbjct: 30  NLLVSASRDKTLISWKLTGDDQQYGVPVRSFKGHNHIVQDCALTADGAYALSASWDKTLR 89

Query: 147 VWDLVGEVGLYKLRSHK-DAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQCIETHIAHTG 205
           +W++       +   HK D ++    +    ++S S+D  IK+W +K   C+ T + H  
Sbjct: 90  LWNVATGETYQRFTGHKSDVMSVAIDRKASMIISGSRDKTIKVWSIK-GDCLATLLGHND 148

Query: 206 ECWGLAV------KDD--LLITTSTDSQVKIWKLN 232
               + V      +DD   LI+  +D  VK W +N
Sbjct: 149 WVSQVRVAPNEKQEDDNVTLISAGSDKMVKAWNIN 183

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 54/124 (43%), Gaps = 9/124 (7%)

Query: 117 FNGHKAAIT-LMQFDSTGTRLISGSKDSNIIVWDLVGE-----VGLYKLRSHKDAITGFW 170
             GH   +T L         L+S S+D  +I W L G+     V +   + H   +    
Sbjct: 12  LEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQQYGVPVRSFKGHNHIVQDCA 71

Query: 171 CQGED-WLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWGLAV--KDDLLITTSTDSQVK 227
              +  + +S S D  +++W++ T +  +    H  +   +A+  K  ++I+ S D  +K
Sbjct: 72  LTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKASMIISGSRDKTIK 131

Query: 228 IWKL 231
           +W +
Sbjct: 132 VWSI 135

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 52/121 (42%), Gaps = 10/121 (8%)

Query: 389 GQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALTCKFLPGGLLVI 446
           G    + SI  S D  L+A+A  +G + +WN+K    + T           F P    + 
Sbjct: 193 GHNNYINSITASPDGSLVASAGKDGDIMLWNLKQKTPLYTLSAQDEVFALAFSPNRYWLT 252

Query: 447 LGTRSGELQLFDLASSSLLDTIED-------AHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
             T +G ++++ L    L+D ++        A +    SL  ++DG+ L  G  D  ++ 
Sbjct: 253 AATATG-IKVYSLEDEVLIDELKPEFTGYNKAAEPHAVSLTWSADGQTLFAGYTDSIIRV 311

Query: 500 W 500
           W
Sbjct: 312 W 312

>TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/283 (23%), Positives = 125/283 (44%), Gaps = 27/283 (9%)

Query: 346 VTSSKLELVVTTSNNTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKL 405
           +TS K +L+    +  +  Y I       T+P P+ +     +G R +V SI    DNK 
Sbjct: 40  ITSDK-KLLAAAGHQNVRLYDI-----RTTNPNPVAS----FEGHRGNVTSISFQQDNKW 89

Query: 406 LATAS-NGSLKIWNVKTHKCIRTFECGYALTCKFL-PGGLLVILGTRSGELQLFDLASSS 463
           + ++S +G++K+W+V+     R ++    +    + P    +I   R G ++++DL  + 
Sbjct: 90  MVSSSEDGTIKVWDVRAPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ 149

Query: 464 LLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKD--KFVPMLK 521
               +    D  + SL L SDG  LV  ++      W+       +P   D     P+ K
Sbjct: 150 CTHQLTPEDDTPLQSLSLASDGSMLVAANSKGNCYVWE-------MPNRTDASNLKPVTK 202

Query: 522 LNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS-MKFYLSLYGHKLPVLSID 580
                T      I  + +S D ++LA    D+T +V+ +D+  +   +L GH+  V    
Sbjct: 203 FRSHATY-----ITRILLSSDVKHLATCSADHTARVWSIDNNFELETTLDGHQRWVWDCA 257

Query: 581 ISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623
            S DS  ++T+S+D  +++W L   +  +    H    + V  
Sbjct: 258 FSADSAYLVTASSDHYVRLWDLSTKEIVRQYGGHHKGAVCVAL 300

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/291 (19%), Positives = 120/291 (41%), Gaps = 27/291 (9%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALTCKF-LPGGLLVILGTRSGELQLFDLASSS 463
           L++   + +++ W   T  C RT +   +   +  +     ++       ++L+D+ +++
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITSDKKLLAAAGHQNVRLYDIRTTN 64

Query: 464 LLDTIE-DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKL 522
                  + H   + S+    D K +V+ S D T+K WD +              P +  
Sbjct: 65  PNPVASFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRA-------------PSVPR 111

Query: 523 NHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHK-LPVLSIDI 581
           N+     +N+    V I P+   L     D  ++++ L   +    L      P+ S+ +
Sbjct: 112 NYKHNAPVNE----VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPLQSLSL 167

Query: 582 SFDSKMIITSSADKNIKIWGLDFGDCHKSL------FAHQDSIMSVKFLPESHNFFSCSK 635
           + D  M++ +++  N  +W +       +L       +H   I  +    +  +  +CS 
Sbjct: 168 ASDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRSHATYITRILLSSDVKHLATCSA 227

Query: 636 DAVVKYWD-GEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           D   + W     FE    L  HQ  VW  A S D +++V++S DH +R+W+
Sbjct: 228 DHTARVWSIDNNFELETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 90/220 (40%), Gaps = 17/220 (7%)

Query: 80  AECTYLEVHQDTNLLAVGYADGVIKVWDL--VSKTVLLNFNGHKAAITLMQFDSTGTRLI 137
           ++   LE+  D  LLA      V +++D+   +   + +F GH+  +T + F      ++
Sbjct: 33  SQVNRLEITSDKKLLAAAGHQNV-RLYDIRTTNPNPVASFEGHRGNVTSISFQQDNKWMV 91

Query: 138 SGSKDSNIIVWDLVGE--VGLYKLRSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQ 195
           S S+D  I VWD+        YK  +  + +     QGE  L+S  +DG I+IWDL   Q
Sbjct: 92  SSSEDGTIKVWDVRAPSVPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGENQ 149

Query: 196 CIETHIAHTG---ECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGEKLTEMGIFEKQS 252
           C            +   LA    +L+  ++     +W+  M N      L  +  F    
Sbjct: 150 CTHQLTPEDDTPLQSLSLASDGSMLVAANSKGNCYVWE--MPNRTDASNLKPVTKF---- 203

Query: 253 KQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEI 292
           +     I  I  +SD V      +AD T   + I    E+
Sbjct: 204 RSHATYITRILLSSD-VKHLATCSADHTARVWSIDNNFEL 242

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/247 (21%), Positives = 90/247 (36%), Gaps = 64/247 (25%)

Query: 41  LITSALENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYAD 100
           L  +  +NV ++DI+T +         P   +  +G +    T +   QD   +     D
Sbjct: 47  LAAAGHQNVRLYDIRTTN---------PNPVASFEGHR-GNVTSISFQQDNKWMVSSSED 96

Query: 101 GVIKVWDLVSKTVLLNFNGHKAAIT----------LMQFD-------------------- 130
           G IKVWD+ + +V  N+  H A +           L+  D                    
Sbjct: 97  GTIKVWDVRAPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 131 -------------STGTRLISGSKDSNIIVWDLVGEV------GLYKLRSHKDAITGFWC 171
                        S G+ L++ +   N  VW++           + K RSH   IT    
Sbjct: 156 PEDDTPLQSLSLASDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRSHATYITRILL 215

Query: 172 QGE-DWLVSTSKDGLIKIWDLKTQQCIETHI-AHTGECWGLAVKDD--LLITTSTDSQVK 227
             +   L + S D   ++W +     +ET +  H    W  A   D   L+T S+D  V+
Sbjct: 216 SSDVKHLATCSADHTARVWSIDNNFELETTLDGHQRWVWDCAFSADSAYLVTASSDHYVR 275

Query: 228 IWKLNME 234
           +W L+ +
Sbjct: 276 LWDLSTK 282

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 70/149 (46%), Gaps = 9/149 (6%)

Query: 93  LLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDL-- 150
           L++ GY D  I+ W+ ++           + +  ++  S   +L++ +   N+ ++D+  
Sbjct: 5   LVSAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLEITS-DKKLLAAAGHQNVRLYDIRT 62

Query: 151 VGEVGLYKLRSHKDAITGFWCQGED-WLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWG 209
                +     H+  +T    Q ++ W+VS+S+DG IK+WD++    +  +  H      
Sbjct: 63  TNPNPVASFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPS-VPRNYKHNAPVNE 121

Query: 210 LAVKDDL--LITTSTDSQVKIWKLNMENE 236
           + +  +   LI+   D  ++IW L  EN+
Sbjct: 122 VVIHPNQGELISCDRDGNIRIWDLG-ENQ 149

>Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 63/277 (22%), Positives = 122/277 (44%), Gaps = 26/277 (9%)

Query: 352 ELVVTTSNNTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATAS- 410
           +L+ T  +  +  Y I       T+P P+ +     +G R +V S+    DN+ + T+S 
Sbjct: 45  KLLATAGHQNVRLYDI-----RTTNPNPVAS----FEGHRGNVTSVSFQQDNRWMVTSSE 95

Query: 411 NGSLKIWNVKTHKCIRTFECGYALTCKFL-PGGLLVILGTRSGELQLFDLASSSLLDTIE 469
           +G++K+W+V++    R ++    +    + P    +I   R G ++++DL  +     + 
Sbjct: 96  DGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 470 DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKD--KFVPMLKLNHDTT 527
              D ++ SL + SDG  L   +       W+       +P   D     P+ K    +T
Sbjct: 156 PEDDTSLQSLSMASDGSMLAAANTKGNCYVWE-------MPNHTDASHLKPVTKFRAHST 208

Query: 528 LELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS-MKFYLSLYGHKLPVLSIDISFDSK 586
                 I  + +S D ++LA    D+T +V+ +D   K   +L GH+  V     S DS 
Sbjct: 209 Y-----ITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSA 263

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623
            ++T+S+D  +++W L   +  +    H    + V  
Sbjct: 264 YLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/291 (20%), Positives = 119/291 (40%), Gaps = 27/291 (9%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRSGE-LQLFDLASSS 463
           L++   + +++ W   T  C RT +   +   +        +L T   + ++L+D+ +++
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64

Query: 464 LLDTIE-DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKL 522
                  + H   + S+    D + +VT S D T+K WD +              P +  
Sbjct: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS-------------PSIPR 111

Query: 523 NHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVL-SIDI 581
           N+     +N+    V I P+   L     D  ++++ L   +    L       L S+ +
Sbjct: 112 NYKHNAPVNE----VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSM 167

Query: 582 SFDSKMIITSSADKNIKIWGL-DFGDCHK-----SLFAHQDSIMSVKFLPESHNFFSCSK 635
           + D  M+  ++   N  +W + +  D           AH   I  +    +  +  +CS 
Sbjct: 168 ASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSA 227

Query: 636 DAVVKYWD-GEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           D   + W   + F+    L  HQ  VW  A S D +++V++S DH +R+W+
Sbjct: 228 DHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/291 (19%), Positives = 126/291 (43%), Gaps = 28/291 (9%)

Query: 387 LQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVKT--HKCIRTFEC--GYALTCKFLPGG 442
           +Q   + V  +++++D KLLATA + ++++++++T     + +FE   G   +  F    
Sbjct: 28  IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDN 87

Query: 443 LLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
             ++  +  G ++++D+ S S+    +  H+A +  + +  +   L++   D  ++ WD 
Sbjct: 88  RWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 503 QVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS 562
                     +++    L    DT+L+      S+ ++ D   LA +       V+ + +
Sbjct: 146 G---------ENQCTHQLTPEDDTSLQ------SLSMASDGSMLAAANTKGNCYVWEMPN 190

Query: 563 ------MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG-DCHKSLFAHQ 615
                 +K       H   +  I +S D K + T SAD   ++W +D       +L  HQ
Sbjct: 191 HTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQ 250

Query: 616 DSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIS 666
             +    F  +S    + S D  V+ WD    E +++   H      +A++
Sbjct: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 94/224 (41%), Gaps = 23/224 (10%)

Query: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELND 532
           D+ +  L++T+D K+L+  +  + V+ +D    +T  P     F                
Sbjct: 32  DSQVNRLEITND-KKLLATAGHQNVRLYDI---RTTNPNPVASFEGH-----------RG 76

Query: 533 DILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSS 592
           ++ SV    D+R++  S  D T+KV+ + S     + Y H  PV  + I  +   +I+  
Sbjct: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135

Query: 593 ADKNIKIWGLDFGDCHKSLFAHQD-SIMSVKFLPESHNFFSCSKDAVVKYW------DGE 645
            D NI+IW L    C   L    D S+ S+    +     + +       W      D  
Sbjct: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195

Query: 646 KFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETED 689
             + + K  AH + +  + +S+D   + + S DH+ R+W   +D
Sbjct: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 91/245 (37%), Gaps = 64/245 (26%)

Query: 41  LITSALENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYAD 100
           L T+  +NV ++DI+T +         P   +  +G +    T +   QD   +     D
Sbjct: 47  LATAGHQNVRLYDIRTTN---------PNPVASFEGHR-GNVTSVSFQQDNRWMVTSSED 96

Query: 101 GVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDL---------- 150
           G IKVWD+ S ++  N+  H A +  +        LIS  +D NI +WDL          
Sbjct: 97  GTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 151 ------------------------VGEVGLYKLRSHKDA-----ITGFWCQGE------- 174
                                    G   ++++ +H DA     +T F            
Sbjct: 156 PEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILL 215

Query: 175 ----DWLVSTSKDGLIKIWDLKTQQCIETHI-AHTGECWGLAVKDD--LLITTSTDSQVK 227
                 L + S D   ++W +     +ET +  H    W  A   D   L+T S+D  V+
Sbjct: 216 SSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVR 275

Query: 228 IWKLN 232
           +W L+
Sbjct: 276 LWDLS 280

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 76/180 (42%), Gaps = 12/180 (6%)

Query: 80  AECTYLEVHQDTNLLAVGYADGVIKVWDL--VSKTVLLNFNGHKAAITLMQFDSTGTRLI 137
           ++   LE+  D  LLA      V +++D+   +   + +F GH+  +T + F      ++
Sbjct: 33  SQVNRLEITNDKKLLATAGHQNV-RLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMV 91

Query: 138 SGSKDSNIIVWDLVGEV--GLYKLRSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQQ 195
           + S+D  I VWD+        YK  +  + +     QGE  L+S  +DG I+IWDL   Q
Sbjct: 92  TSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGENQ 149

Query: 196 CIETHIAH---TGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGEKLTEMGIFEKQS 252
           C          + +   +A    +L   +T     +W+  M N      L  +  F   S
Sbjct: 150 CTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWE--MPNHTDASHLKPVTKFRAHS 207

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSC 633
           V  ++I+ D K++ T+   +N++++ +   + +   S   H+ ++ SV F  ++    + 
Sbjct: 35  VNRLEITNDKKLLATA-GHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTS 93

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQV 691
           S+D  +K WD  +   I + Y H + V  + I  +   ++S   D +IRIW+  E+Q 
Sbjct: 94  SEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/149 (20%), Positives = 71/149 (47%), Gaps = 9/149 (6%)

Query: 93  LLAVGYADGVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSKDSNIIVWDL-- 150
           L++ GY D  I+ W+ ++           + +  ++  +   +L++ +   N+ ++D+  
Sbjct: 5   LVSAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLEI-TNDKKLLATAGHQNVRLYDIRT 62

Query: 151 VGEVGLYKLRSHKDAITGFWCQGED-WLVSTSKDGLIKIWDLKTQQCIETHIAHTGECWG 209
                +     H+  +T    Q ++ W+V++S+DG IK+WD+++   I  +  H      
Sbjct: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPS-IPRNYKHNAPVNE 121

Query: 210 LAVKDDL--LITTSTDSQVKIWKLNMENE 236
           + +  +   LI+   D  ++IW L  EN+
Sbjct: 122 VVIHPNQGELISCDRDGNIRIWDLG-ENQ 149

>YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protein
           required for the transport of amino acid permease Gap1p
           from the Golgi to the cell surface; component of the TOR
           signaling pathway; associates with both Tor1p and Tor2p;
           contains a WD-repeat
          Length = 303

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 63/277 (22%), Positives = 122/277 (44%), Gaps = 26/277 (9%)

Query: 352 ELVVTTSNNTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATAS- 410
           +L+ T  +  +  Y I       T+P P+ +     +G R +V S+    DN+ + T+S 
Sbjct: 45  KLLATAGHQNVRLYDI-----RTTNPNPVAS----FEGHRGNVTSVSFQQDNRWMVTSSE 95

Query: 411 NGSLKIWNVKTHKCIRTFECGYALTCKFL-PGGLLVILGTRSGELQLFDLASSSLLDTIE 469
           +G++K+W+V++    R ++    +    + P    +I   R G ++++DL  +     + 
Sbjct: 96  DGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 470 DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKD--KFVPMLKLNHDTT 527
              D ++ SL + SDG  L   +       W+       +P   D     P+ K    +T
Sbjct: 156 PEDDTSLQSLSMASDGSMLAAANTKGNCYVWE-------MPNHTDASHLKPVTKFRAHST 208

Query: 528 LELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS-MKFYLSLYGHKLPVLSIDISFDSK 586
                 I  + +S D ++LA    D+T +V+ +D   K   +L GH+  V     S DS 
Sbjct: 209 Y-----ITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSA 263

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623
            ++T+S+D  +++W L   +  +    H    + V  
Sbjct: 264 YLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/291 (20%), Positives = 119/291 (40%), Gaps = 27/291 (9%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRSGE-LQLFDLASSS 463
           L++   + +++ W   T  C RT +   +   +        +L T   + ++L+D+ +++
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64

Query: 464 LLDTIE-DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKL 522
                  + H   + S+    D + +VT S D T+K WD +              P +  
Sbjct: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS-------------PSIPR 111

Query: 523 NHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVL-SIDI 581
           N+     +N+    V I P+   L     D  ++++ L   +    L       L S+ +
Sbjct: 112 NYKHNAPVNE----VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSM 167

Query: 582 SFDSKMIITSSADKNIKIWGL-DFGDCHK-----SLFAHQDSIMSVKFLPESHNFFSCSK 635
           + D  M+  ++   N  +W + +  D           AH   I  +    +  +  +CS 
Sbjct: 168 ASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSA 227

Query: 636 DAVVKYWD-GEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           D   + W   + F+    L  HQ  VW  A S D +++V++S DH +R+W+
Sbjct: 228 DHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/291 (19%), Positives = 126/291 (43%), Gaps = 28/291 (9%)

Query: 387 LQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVKT--HKCIRTFEC--GYALTCKFLPGG 442
           +Q   + V  +++++D KLLATA + ++++++++T     + +FE   G   +  F    
Sbjct: 28  IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDN 87

Query: 443 LLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
             ++  +  G ++++D+ S S+    +  H+A +  + +  +   L++   D  ++ WD 
Sbjct: 88  RWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 503 QVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS 562
                     +++    L    DT+L+      S+ ++ D   LA +       V+ + +
Sbjct: 146 G---------ENQCTHQLTPEDDTSLQ------SLSMASDGSMLAAANTKGNCYVWEMPN 190

Query: 563 ------MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG-DCHKSLFAHQ 615
                 +K       H   +  I +S D K + T SAD   ++W +D       +L  HQ
Sbjct: 191 HTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQ 250

Query: 616 DSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIS 666
             +    F  +S    + S D  V+ WD    E +++   H      +A++
Sbjct: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 94/224 (41%), Gaps = 23/224 (10%)

Query: 473