Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_10.2208.321ON85485444480.0
Skud_12.1968.321ON85485436950.0
Smik_12.1908.321ON85085236680.0
YLR127C (APC2)8.321ON85385436510.0
ZYRO0F10340g8.321ON81884716850.0
TDEL0F044708.321ON80985215920.0
SAKL0H15598g8.321ON78783415610.0
KLTH0G12342g8.321ON77482713511e-174
Kwal_56.239098.321ON77682213471e-174
TPHA0C008308.321ON84285612461e-158
TBLA0A039208.321ON73273711691e-148
CAGL0M04235g8.321ON78382911511e-144
KAFR0H022808.321ON81787910211e-125
NCAS0C032808.321ON81188710111e-123
KNAG0G024308.321ON7978568621e-102
Kpol_YGOB_Anc_8.3218.321ON5115338151e-98
AGL193W8.321ON7097438266e-98
Ecym_42528.321ON6897348116e-96
NDAI0G026008.321ON9119377625e-87
KLLA0D16324g8.321ON6977605353e-57
KLTH0H11176g1.343ON774126920.026
AFR617C1.343ON77177820.39
NCAS0B073101.344ON63499800.76
Ecym_23361.343ON775199771.6
TPHA0A008803.151ON716138752.8
SAKL0D07458g1.343ON783114753.2
TPHA0H019206.266ON979152753.2
SAKL0H02640g5.89ON175104704.9
Kwal_0.701.343ON77299726.5
NCAS0I017603.244ON39464716.5
YPL048W (CAM1)8.498ON41572709.0
Suva_16.2678.498ON409122709.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_10.220
         (854 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {...  1717   0.0  
Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {...  1427   0.0  
Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {...  1417   0.0  
YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON} ...  1410   0.0  
ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {...   653   0.0  
TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {O...   617   0.0  
SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} simi...   605   0.0  
KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} simi...   525   e-174
Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {...   523   e-174
TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.3...   484   e-158
TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {O...   454   e-148
CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa] ...   447   e-144
KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.3...   397   e-125
NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.3...   394   e-123
KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {O...   336   e-102
Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 5...   318   1e-98
AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic ho...   322   6e-98
Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}...   317   6e-96
NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.3...   298   5e-87
KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]...   210   3e-57
KLTH0H11176g Chr8 complement(957667..959991) [2325 bp, 774 aa] {...    40   0.026
AFR617C Chr6 complement(1549456..1551771) [2316 bp, 771 aa] {ON}...    36   0.39 
NCAS0B07310 Chr2 (1381759..1383663) [1905 bp, 634 aa] {ON} Anc_1...    35   0.76 
Ecym_2336 Chr2 complement(652787..655114) [2328 bp, 775 aa] {ON}...    34   1.6  
TPHA0A00880 Chr1 complement(172938..175088) [2151 bp, 716 aa] {O...    33   2.8  
SAKL0D07458g Chr4 complement(612471..614822) [2352 bp, 783 aa] {...    33   3.2  
TPHA0H01920 Chr8 (450069..453008) [2940 bp, 979 aa] {ON} Anc_6.2...    33   3.2  
SAKL0H02640g Chr8 complement(263084..263611) [528 bp, 175 aa] {O...    32   4.9  
Kwal_0.70 s0 complement(30290..32608) [2319 bp, 772 aa] {ON} YJL...    32   6.5  
NCAS0I01760 Chr9 (325595..326779) [1185 bp, 394 aa] {ON} Anc_3.2...    32   6.5  
YPL048W Chr16 (464401..465648) [1248 bp, 415 aa] {ON}  CAM1Nucle...    32   9.0  
Suva_16.267 Chr16 (467433..468662) [1230 bp, 409 aa] {ON} YPL048...    32   9.1  

>Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score = 1717 bits (4448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 842/854 (98%), Positives = 842/854 (98%)

Query: 1   MTYQITPTRDLKIITDELQTLSSYIFHTNITDDLNSLLIWMSPDDPKSNHQLRPPSLRIK 60
           MTYQITPTRDLKIITDELQTLSSYIFHTNITDDLNSLLIWMSPDDPKSNHQLRPPSLRIK
Sbjct: 1   MTYQITPTRDLKIITDELQTLSSYIFHTNITDDLNSLLIWMSPDDPKSNHQLRPPSLRIK 60

Query: 61  NIIKNLFPNNACTSSYGAMNTAQANNSIVNEGNTNKELQLQFISTFKEYYIFQVRYHFFL 120
           NIIKNLFPNNACTSSYGAMNTAQANNSIVNEGNTNKELQLQFISTFKEYYIFQVRYHFFL
Sbjct: 61  NIIKNLFPNNACTSSYGAMNTAQANNSIVNEGNTNKELQLQFISTFKEYYIFQVRYHFFL 120

Query: 121 HFSSINYLKDIQRWENYYEFPLRYVSIFDLNVNGWTLELNSLRHYLLNRNTKFKNNLRTR 180
           HFSSINYLKDIQRWENYYEFPLRYVSIFDLNVNGWTLELNSLRHYLLNRNTKFKNNLRTR
Sbjct: 121 HFSSINYLKDIQRWENYYEFPLRYVSIFDLNVNGWTLELNSLRHYLLNRNTKFKNNLRTR 180

Query: 181 LNKLIIDDDFDLASNLIRWLNSANGSLSSMDLIVNALFDKISMFCEINMSGVWNKRFMIM 240
           LNKLIIDDDFDLASNLIRWLNSANGSLSSMDLIVNALFDKISMFCEINMSGVWNKRFMIM
Sbjct: 181 LNKLIIDDDFDLASNLIRWLNSANGSLSSMDLIVNALFDKISMFCEINMSGVWNKRFMIM 240

Query: 241 ETFNKFINQYWSQFSELIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKI 300
           ETFNKFINQYWSQFSELIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKI
Sbjct: 241 ETFNKFINQYWSQFSELIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKI 300

Query: 301 TLLELKKIMKDFKDYTNIVTTFLSDFKKHILNPSITTVDALLSYVKTIKAFLVLDPTGRC 360
           TLLELKKIMKDFKDYTNIVTTFLSDFKKHILNPSITTVDALLSYVKTIKAFLVLDPTGRC
Sbjct: 301 TLLELKKIMKDFKDYTNIVTTFLSDFKKHILNPSITTVDALLSYVKTIKAFLVLDPTGRC 360

Query: 361 LHSITTFVKPYFQERKHLVNVLLYAILDLPEEELKEKISFKVDMKALLLLVETLHDSDID 420
           LHSITTFVKPYFQERKHLVNVLLYAILDLPEEELKEKISFKVDMKALLLLVETLHDSDID
Sbjct: 361 LHSITTFVKPYFQERKHLVNVLLYAILDLPEEELKEKISFKVDMKALLLLVETLHDSDID 420

Query: 421 QITNTPKSKDKNKGGSFPWNLHVKGKKEKNGSSSITQSMLYEHILNYYLTWVPEPNDMIP 480
           QITNTPKSKDKNKGGSFPWNLHVKGKKEKNGSSSITQSMLYEHILNYYLTWVPEPNDMIP
Sbjct: 421 QITNTPKSKDKNKGGSFPWNLHVKGKKEKNGSSSITQSMLYEHILNYYLTWVPEPNDMIP 480

Query: 481 GNIKSSSIKTNLFEVLLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDNKWSRCLKLIREK 540
           GNIKSSSIKTNLFEVLLDL            NLLTDRLFTLKFYKLDNKWSRCLKLIREK
Sbjct: 481 GNIKSSSIKTNLFEVLLDLFESREFFISEFRNLLTDRLFTLKFYKLDNKWSRCLKLIREK 540

Query: 541 IVKSTETNQTNYIANGIIGLPQTTAPAADADLSNINSIDVMLWDIKCSEELCLKMHEVAG 600
           IVKSTETNQTNYIANGIIGLPQTTAPAADADLSNINSIDVMLWDIKCSEELCLKMHEVAG
Sbjct: 541 IVKSTETNQTNYIANGIIGLPQTTAPAADADLSNINSIDVMLWDIKCSEELCLKMHEVAG 600

Query: 601 LDPAIYPKFISLLYWKHNGDTNNANELTFHLPGNLENELQKYSDIYSQLKPGRKLQLCKD 660
           LDPAIYPKFISLLYWKHNGDTNNANELTFHLPGNLENELQKYSDIYSQLKPGRKLQLCKD
Sbjct: 601 LDPAIYPKFISLLYWKHNGDTNNANELTFHLPGNLENELQKYSDIYSQLKPGRKLQLCKD 660

Query: 661 QGKIEMELDFNDGRKLVLDVSLEQCSVINQFNSTDGEPIYLSLEQLSEPLNIAPARLLDL 720
           QGKIEMELDFNDGRKLVLDVSLEQCSVINQFNSTDGEPIYLSLEQLSEPLNIAPARLLDL
Sbjct: 661 QGKIEMELDFNDGRKLVLDVSLEQCSVINQFNSTDGEPIYLSLEQLSEPLNIAPARLLDL 720

Query: 721 LNFWIQRGVLSEENGVYSVIEYSRTDFNQTQIEFPMKNENNNNELRDETEVERKCELILE 780
           LNFWIQRGVLSEENGVYSVIEYSRTDFNQTQIEFPMKNENNNNELRDETEVERKCELILE
Sbjct: 721 LNFWIQRGVLSEENGVYSVIEYSRTDFNQTQIEFPMKNENNNNELRDETEVERKCELILE 780

Query: 781 RSLPFIEGMLANLGAMKLNKIHSFLKITVPKNWGYNRITLLQLEKYLNVLADEGKLKYIT 840
           RSLPFIEGMLANLGAMKLNKIHSFLKITVPKNWGYNRITLLQLEKYLNVLADEGKLKYIT
Sbjct: 781 RSLPFIEGMLANLGAMKLNKIHSFLKITVPKNWGYNRITLLQLEKYLNVLADEGKLKYIT 840

Query: 841 NGSYELEKNGHKNS 854
           NGSYELEKNGHKNS
Sbjct: 841 NGSYELEKNGHKNS 854

>Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score = 1427 bits (3695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 692/854 (81%), Positives = 753/854 (88%)

Query: 1   MTYQITPTRDLKIITDELQTLSSYIFHTNITDDLNSLLIWMSPDDPKSNHQLRPPSLRIK 60
           M+YQITPTRDLK+ITD+LQTLSSY+FHTNI DDLNSLLIWMSP+DPKSNHQLRPPSLRIK
Sbjct: 1   MSYQITPTRDLKVITDQLQTLSSYVFHTNIADDLNSLLIWMSPNDPKSNHQLRPPSLRIK 60

Query: 61  NIIKNLFPNNACTSSYGAMNTAQANNSIVNEGNTNKELQLQFISTFKEYYIFQVRYHFFL 120
           NIIK LFPNN  TSSYG +N+ Q  N++  EGNTNKELQLQ +ST KEYY+FQVRYHFFL
Sbjct: 61  NIIKVLFPNNVSTSSYGVINSGQTINAVAGEGNTNKELQLQLLSTLKEYYVFQVRYHFFL 120

Query: 121 HFSSINYLKDIQRWENYYEFPLRYVSIFDLNVNGWTLELNSLRHYLLNRNTKFKNNLRTR 180
            F+ I YLKDIQRWENYYEFPLRYV IFDL+VN W+LELNSLRHY+LNRN KFKNNLR R
Sbjct: 121 RFNDIIYLKDIQRWENYYEFPLRYVPIFDLSVNDWSLELNSLRHYMLNRNIKFKNNLRVR 180

Query: 181 LNKLIIDDDFDLASNLIRWLNSANGSLSSMDLIVNALFDKISMFCEINMSGVWNKRFMIM 240
           LNKLI+DDDFDLA NLIRWLN ANGSLSSM+LIVNALF+KI  FCE NMSGVWNKRFMIM
Sbjct: 181 LNKLIMDDDFDLAGNLIRWLNFANGSLSSMELIVNALFNKIEKFCEANMSGVWNKRFMIM 240

Query: 241 ETFNKFINQYWSQFSELIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKI 300
           ETFNKFINQYWSQF ELI CPEDDHELTTTVFNCFESNFLRIRT+EIFDICVLAYP SK+
Sbjct: 241 ETFNKFINQYWSQFCELICCPEDDHELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKV 300

Query: 301 TLLELKKIMKDFKDYTNIVTTFLSDFKKHILNPSITTVDALLSYVKTIKAFLVLDPTGRC 360
            LLELKKIMKDFKDYTNIVT FLSDFKK+ILNPSITTVDALL YVKTIKAFLVLDPTGRC
Sbjct: 301 ALLELKKIMKDFKDYTNIVTKFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRC 360

Query: 361 LHSITTFVKPYFQERKHLVNVLLYAILDLPEEELKEKISFKVDMKALLLLVETLHDSDID 420
           LHSI TFVKPYFQERKHLVNVLLYA+LDLPEEELKEKI+FKVDMKALL LV+ LHD DI 
Sbjct: 361 LHSIITFVKPYFQERKHLVNVLLYAMLDLPEEELKEKITFKVDMKALLSLVDILHDYDIG 420

Query: 421 QITNTPKSKDKNKGGSFPWNLHVKGKKEKNGSSSITQSMLYEHILNYYLTWVPEPNDMIP 480
           Q T+  KSKDKNK   F WNL VKGKKE N      Q+MLYEH+LN+YLTWVPEPND+IP
Sbjct: 421 QNTDAHKSKDKNKRSPFLWNLKVKGKKETNEDPLARQTMLYEHVLNHYLTWVPEPNDIIP 480

Query: 481 GNIKSSSIKTNLFEVLLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDNKWSRCLKLIREK 540
           G++KSS IKTNLFE+LLDL            NLLTDRL +LKFYKLD+KWS+CLKLIRE+
Sbjct: 481 GSVKSSYIKTNLFEILLDLFESREFFISEFRNLLTDRLSSLKFYKLDDKWSQCLKLIRER 540

Query: 541 IVKSTETNQTNYIANGIIGLPQTTAPAADADLSNINSIDVMLWDIKCSEELCLKMHEVAG 600
           IVK TETN  NYI NGI+GLP+TTAPAADAD SN+NSIDVMLWDIKCSEELC KMHEVAG
Sbjct: 541 IVKFTETNHANYITNGILGLPETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAG 600

Query: 601 LDPAIYPKFISLLYWKHNGDTNNANELTFHLPGNLENELQKYSDIYSQLKPGRKLQLCKD 660
           LDP ++PKFISLLYWKHNGDT N  +  F +P +LE ELQKYSDIYSQ+KPGR+LQLCKD
Sbjct: 601 LDPTVFPKFISLLYWKHNGDTQNPKDSKFRIPADLERELQKYSDIYSQMKPGRRLQLCKD 660

Query: 661 QGKIEMELDFNDGRKLVLDVSLEQCSVINQFNSTDGEPIYLSLEQLSEPLNIAPARLLDL 720
           QGK+EMEL F DGRKLVLDVSLEQ SV+NQFNST+ EPI LSL+QLSE LNI  ++LL L
Sbjct: 661 QGKVEMELSFRDGRKLVLDVSLEQYSVMNQFNSTNDEPINLSLKQLSESLNITTSKLLQL 720

Query: 721 LNFWIQRGVLSEENGVYSVIEYSRTDFNQTQIEFPMKNENNNNELRDETEVERKCELILE 780
           LNFWIQ+GVLSEE  VYSVIEYS T F+QTQ +  MKN NNNNELRDE+EVE+KCEL L+
Sbjct: 721 LNFWIQKGVLSEEGEVYSVIEYSDTGFSQTQKDVLMKNVNNNNELRDESEVEKKCELTLQ 780

Query: 781 RSLPFIEGMLANLGAMKLNKIHSFLKITVPKNWGYNRITLLQLEKYLNVLADEGKLKYIT 840
           RSLPFIEGMLANLGAMKLNKIHSFLKITVPK+WGYNRITLLQLEKYLN L DEGKLKYI 
Sbjct: 781 RSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRITLLQLEKYLNTLTDEGKLKYIA 840

Query: 841 NGSYELEKNGHKNS 854
           NGSYE+ KNGHKN+
Sbjct: 841 NGSYEIAKNGHKNA 854

>Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {ON}
           YLR127C (REAL)
          Length = 850

 Score = 1417 bits (3668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 684/852 (80%), Positives = 762/852 (89%), Gaps = 4/852 (0%)

Query: 1   MTYQITPTRDLKIITDELQTLSSYIFHTNITDDLNSLLIWMSPDDPKSNHQLRPPSLRIK 60
           M+YQI PTRDLK+ITDELQTLSSYIFHT I DDLNSLLIW SP+DPKSNHQLRPPSLRIK
Sbjct: 1   MSYQIAPTRDLKVITDELQTLSSYIFHTTIADDLNSLLIWTSPNDPKSNHQLRPPSLRIK 60

Query: 61  NIIKNLFPNNACTSSYGAMNTAQANNSIVNEGNTNKELQLQFISTFKEYYIFQVRYHFFL 120
           NIIK LFPN+A TS Y  +NT Q +NSIVNEGNTNKELQLQ +ST KEYYIFQVRYHFF 
Sbjct: 61  NIIKVLFPNSASTSPYSVVNTGQTSNSIVNEGNTNKELQLQLLSTLKEYYIFQVRYHFFS 120

Query: 121 HFSSINYLKDIQRWENYYEFPLRYVSIFDLNVNGWTLELNSLRHYLLNRNTKFKNNLRTR 180
           HF +INYLKDIQRWENYYEFPLRYV IFDL++NGW+LELNSLRHYLLNRN KFKNNLRTR
Sbjct: 121 HFENINYLKDIQRWENYYEFPLRYVPIFDLDINGWSLELNSLRHYLLNRNMKFKNNLRTR 180

Query: 181 LNKLIIDDDFDLASNLIRWLNSANGSLSSMDLIVNALFDKISMFCEINMSGVWNKRFMIM 240
           L+KLI+DDDFDLA NLI+WLNSA+GSLSSM+LIVNALF+KI+ FCE  MSGVWNKRFMIM
Sbjct: 181 LDKLIMDDDFDLADNLIQWLNSADGSLSSMELIVNALFNKINKFCEDTMSGVWNKRFMIM 240

Query: 241 ETFNKFINQYWSQFSELIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKI 300
           ETFNKFINQYWSQFS+LIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYP SK+
Sbjct: 241 ETFNKFINQYWSQFSKLIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKV 300

Query: 301 TLLELKKIMKDFKDYTNIVTTFLSDFKKHILNPSITTVDALLSYVKTIKAFLVLDPTGRC 360
           TLLELKKIMKDFKDY NIVTTFLSDFKK+ILNPSITTVDALL YVKTIKAFLVLDPTGRC
Sbjct: 301 TLLELKKIMKDFKDYANIVTTFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRC 360

Query: 361 LHSITTFVKPYFQERKHLVNVLLYAILDLPEEELKEKISFKVDMKALLLLVETLHDSDID 420
           LHSITTFVKPYFQERKHLV++LLYA+LDLPEEELKEKI+FKVD+KAL+ LV+TLHDSDI 
Sbjct: 361 LHSITTFVKPYFQERKHLVDLLLYAMLDLPEEELKEKITFKVDIKALISLVDTLHDSDIS 420

Query: 421 QITNTPKSKDKNKGGSFPWNLHVKGKKEKNGSSSITQSMLYEHILNYYLTWVPEPNDMIP 480
           Q TN  K ++KNK G F WNL VKG   KNG S  +Q+M+Y+HILNYYLTWVPEPNDMIP
Sbjct: 421 QFTNVMK-RNKNKKGPFLWNLKVKG---KNGPSPTSQTMIYQHILNYYLTWVPEPNDMIP 476

Query: 481 GNIKSSSIKTNLFEVLLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDNKWSRCLKLIREK 540
           G++KSS IKTNLFEVLLDL            NLLTDRLFTLKFYKLD+KW++CLKLIREK
Sbjct: 477 GSVKSSCIKTNLFEVLLDLFESREFFISEFRNLLTDRLFTLKFYKLDDKWTQCLKLIREK 536

Query: 541 IVKSTETNQTNYIANGIIGLPQTTAPAADADLSNINSIDVMLWDIKCSEELCLKMHEVAG 600
           +VK  ET+  NYI NGI+GLP+TTAP+ADAD SN+NSIDVMLWDIKCSEELC KMHEVAG
Sbjct: 537 VVKFRETSHVNYITNGILGLPETTAPSADADQSNLNSIDVMLWDIKCSEELCRKMHEVAG 596

Query: 601 LDPAIYPKFISLLYWKHNGDTNNANELTFHLPGNLENELQKYSDIYSQLKPGRKLQLCKD 660
           LDPAI+PKFISLLYWK+N D  ++NELTFHLP +L+ ELQKYSD+YSQLKPGRKLQLCKD
Sbjct: 597 LDPAIFPKFISLLYWKYNCDMQSSNELTFHLPIHLKKELQKYSDVYSQLKPGRKLQLCKD 656

Query: 661 QGKIEMELDFNDGRKLVLDVSLEQCSVINQFNSTDGEPIYLSLEQLSEPLNIAPARLLDL 720
           QGK+E+EL+F DGRKLVLDVSLEQCSVINQF+STD + I L+LEQLS+ LNI P RL+ L
Sbjct: 657 QGKVEIELNFKDGRKLVLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNITPPRLVHL 716

Query: 721 LNFWIQRGVLSEENGVYSVIEYSRTDFNQTQIEFPMKNENNNNELRDETEVERKCELILE 780
           L+FWIQ+GV+S+ENGVYSVIE   TDF++   + PM+ ENNN  LR+E+E ERKCEL L+
Sbjct: 717 LDFWIQKGVISKENGVYSVIENCETDFDKVHKDIPMETENNNRGLRNESEAERKCELTLQ 776

Query: 781 RSLPFIEGMLANLGAMKLNKIHSFLKITVPKNWGYNRITLLQLEKYLNVLADEGKLKYIT 840
           RSLPFIEGMLANLGAMKLNKIHSFLKITVPK+WGYNR++L QLE+YL+ LADEG+LKYI 
Sbjct: 777 RSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRVSLQQLEQYLSALADEGRLKYIA 836

Query: 841 NGSYELEKNGHK 852
           NGSYE+ KN HK
Sbjct: 837 NGSYEIVKNEHK 848

>YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON}
           APC2Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; component of the catalytic core of the
           APC/C; has similarity to cullin Cdc53p
          Length = 853

 Score = 1410 bits (3651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 691/854 (80%), Positives = 754/854 (88%), Gaps = 1/854 (0%)

Query: 1   MTYQITPTRDLKIITDELQTLSSYIFHTNITDDLNSLLIWMSPDDPKSNHQLRPPSLRIK 60
           M++QITPTRDLK+ITDELQTLSSYIFHTNI DDLNSLL WMSP+D KSNHQLRPPSLRIK
Sbjct: 1   MSFQITPTRDLKVITDELQTLSSYIFHTNIVDDLNSLLTWMSPNDAKSNHQLRPPSLRIK 60

Query: 61  NIIKNLFPNNACTSSYGAMNTAQANNSIVNEGNTNKELQLQFISTFKEYYIFQVRYHFFL 120
           NIIK LFPNNA TS Y  +NT+QANNSIVNEGNTNKELQLQ  ST KE+YIFQVRYHFFL
Sbjct: 61  NIIKVLFPNNATTSPYSMINTSQANNSIVNEGNTNKELQLQLFSTLKEFYIFQVRYHFFL 120

Query: 121 HFSSINYLKDIQRWENYYEFPLRYVSIFDLNVNGWTLELNSLRHYLLNRNTKFKNNLRTR 180
           HF++INYLKDIQRWENYYEFPLRYV IFD+NVN W LELNSLRHYLLNRN KFKNNLRTR
Sbjct: 121 HFNNINYLKDIQRWENYYEFPLRYVPIFDVNVNDWALELNSLRHYLLNRNIKFKNNLRTR 180

Query: 181 LNKLIIDDDFDLASNLIRWLNSANGSLSSMDLIVNALFDKISMFCEINMSGVWNKRFMIM 240
           L+KLI+DDDFDLA NLI+WL SANGSLSS +LIVNAL+ KI+ FCE NMS VWNKRFMIM
Sbjct: 181 LDKLIMDDDFDLADNLIQWLKSANGSLSSTELIVNALYSKINKFCEDNMSRVWNKRFMIM 240

Query: 241 ETFNKFINQYWSQFSELIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKI 300
           ETFNKFINQYWSQFS+L+GCPEDDHELTTTVFNCFESNFLRIRT EIFDICVLAYP SK+
Sbjct: 241 ETFNKFINQYWSQFSKLVGCPEDDHELTTTVFNCFESNFLRIRTNEIFDICVLAYPDSKV 300

Query: 301 TLLELKKIMKDFKDYTNIVTTFLSDFKKHILNPSITTVDALLSYVKTIKAFLVLDPTGRC 360
           TLLEL+KIMKDFKDYTNIVTTFLSDFKK+ILNPS+TTVDALL YVKTIKAFLVLDPTGRC
Sbjct: 301 TLLELRKIMKDFKDYTNIVTTFLSDFKKYILNPSVTTVDALLRYVKTIKAFLVLDPTGRC 360

Query: 361 LHSITTFVKPYFQERKHLVNVLLYAILDLPEEELKEKISFKVDMKALLLLVETLHDSDID 420
           LHSITTFVKPYFQERKHLVNVLLYA+LDLPEEELKEKI+F VDMKALL LV+TLHDSDI+
Sbjct: 361 LHSITTFVKPYFQERKHLVNVLLYAMLDLPEEELKEKINFNVDMKALLSLVDTLHDSDIN 420

Query: 421 QITNTPKSKDKNKGGSFPWNLHVKGKKEKNGSSSITQSMLYEHILNYYLTWVPEPNDMIP 480
           Q TN  K +DKNK   F WNL VKGK+E N    I  +MLYEHILNYY+ WVPEPNDMIP
Sbjct: 421 QDTNITK-RDKNKKSPFLWNLKVKGKRELNKDLPIRHAMLYEHILNYYIAWVPEPNDMIP 479

Query: 481 GNIKSSSIKTNLFEVLLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDNKWSRCLKLIREK 540
           GNIKSS IKTNLFEVLLDL            NLLTDRLFTLKFY LD KW+RCLKLIREK
Sbjct: 480 GNIKSSYIKTNLFEVLLDLFESREFFISEFRNLLTDRLFTLKFYTLDEKWTRCLKLIREK 539

Query: 541 IVKSTETNQTNYIANGIIGLPQTTAPAADADLSNINSIDVMLWDIKCSEELCLKMHEVAG 600
           IVK TET+ +NYI NGI+GL +TTAPAADAD SN+NSIDVMLWDIKCSEELC KMHEVAG
Sbjct: 540 IVKFTETSHSNYITNGILGLLETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAG 599

Query: 601 LDPAIYPKFISLLYWKHNGDTNNANELTFHLPGNLENELQKYSDIYSQLKPGRKLQLCKD 660
           LDP I+PKFISLLYWK+N DT  +N+L FHLP +LE ELQKYSDIYSQLKPGRKLQLCKD
Sbjct: 600 LDPIIFPKFISLLYWKYNCDTQGSNDLAFHLPIDLERELQKYSDIYSQLKPGRKLQLCKD 659

Query: 661 QGKIEMELDFNDGRKLVLDVSLEQCSVINQFNSTDGEPIYLSLEQLSEPLNIAPARLLDL 720
           +GK+E++L F DGRKLVLDVSLEQCSVINQF+S + EPI LSLEQLSE LNIAP RL  L
Sbjct: 660 KGKVEIQLAFKDGRKLVLDVSLEQCSVINQFDSPNDEPICLSLEQLSESLNIAPPRLTHL 719

Query: 721 LNFWIQRGVLSEENGVYSVIEYSRTDFNQTQIEFPMKNENNNNELRDETEVERKCELILE 780
           L+FWIQ+GVL +ENG YSVIE+S  DF+Q Q   PM+ EN+N EL +++E+ERK EL L+
Sbjct: 720 LDFWIQKGVLLKENGTYSVIEHSEMDFDQAQKTAPMEIENSNYELHNDSEIERKYELTLQ 779

Query: 781 RSLPFIEGMLANLGAMKLNKIHSFLKITVPKNWGYNRITLLQLEKYLNVLADEGKLKYIT 840
           RSLPFIEGML NLGAMKL+KIHSFLKITVPK+WGYNRITL QLE YLN LADEG+LKYI 
Sbjct: 780 RSLPFIEGMLTNLGAMKLHKIHSFLKITVPKDWGYNRITLQQLEGYLNTLADEGRLKYIA 839

Query: 841 NGSYELEKNGHKNS 854
           NGSYE+ KNGHKNS
Sbjct: 840 NGSYEIVKNGHKNS 853

>ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {ON}
           similar to uniprot|Q7LGV7 Saccharomyces cerevisiae
           YLR127C
          Length = 818

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/847 (43%), Positives = 518/847 (61%), Gaps = 46/847 (5%)

Query: 10  DLKIITDELQTLSSYIFHTNITDDLNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLFPN 69
           DLK +  ++Q ++    H N  DDL SLL W++P++P+SNHQ +PP+LR+KN IK L   
Sbjct: 10  DLKRLLVQIQEVALRT-HPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKNSIKML--- 65

Query: 70  NACTSSYGAMNTAQANNSIVNEGNTNKELQLQFISTFKEYYIFQVRYHFFLHFSSINYLK 129
               + Y  M   +      +E +T       FI   +++Y++QVR HFF   S+++  K
Sbjct: 66  ---VNQYYNMELRE------DERDTG----YLFIQLVRQFYVYQVRLHFFASLSNLHTFK 112

Query: 130 DIQRWENYYEFPLRYVSIFDLNVNGWTLELNSLRHYLLNRNTKFKNNLRTRLNKLIIDDD 189
           D+QR   YYEFPL+YV IF+     W  E + L HYLLNR+ K + N+ +RL  L+++DD
Sbjct: 113 DVQRLVKYYEFPLKYVYIFENCPEEWIGERDGLMHYLLNRHKKLRINVVSRLKDLVMEDD 172

Query: 190 FDLASNLIRWLNSANGSLSSMDLIVNALFDKISMFCEINMSGVWNKRFMIMETFNKFINQ 249
           FDLA ++++WLN +N ++SSMDL+++ + +KIS FC+  M+G WN RF+IMETFN+FI  
Sbjct: 173 FDLAMDVVKWLNESNSNVSSMDLMLDLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITS 232

Query: 250 YWSQFSELIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKITLLELKKIM 309
           YWSQF  L+ CPED+HELTT V++ FE  F+++RTKEIFDI V  YP SK TLLEL++++
Sbjct: 233 YWSQFCLLLACPEDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVL 292

Query: 310 KDFKDYTNIVTTFLSDFKKHILNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTFVK 369
              KD+T IV  FLS+F++ ILNPSI+TV+ALL+YVKT+KAFL LDPTGRCL+S++ FVK
Sbjct: 293 VKSKDFTQIVVEFLSNFERQILNPSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVK 352

Query: 370 PYFQERKHLVNVLLYAILDLPEEELKEKISFKVDMKALLLLVETLHDSDIDQITNTPKSK 429
           PYFQER  LV VLLYAIL+L  EE +      +D  +L  L + L D +   I ++ ++ 
Sbjct: 353 PYFQERNDLVTVLLYAILELQSEEFEGPARAYLDTNSLNQLSQELKDPEFG-IESSFETI 411

Query: 430 DKNKGGSFPWNLHVKGKKEKNGSSSITQSML-----YEHILNYYLTWVPEPNDMIPGNI- 483
            +    S P             S++ T +ML     Y+ ++  +L W PEP D I  N  
Sbjct: 412 PQADLLSRP------------ASTATTAAMLDPRLPYKSVIKNFLQWTPEPMDTISKNYS 459

Query: 484 KSSSIKTNLFEVLLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDNKWSRCLKLIREKIVK 543
           KS S   NL ++L+D+            +LLT +L TLK Y LD KWS CL+L++ K   
Sbjct: 460 KSLSASRNLLDILMDMFESKDFFVSEFLSLLTRKLLTLKLYTLDRKWSHCLRLLKTKFGP 519

Query: 544 STETNQTNYIANGIIGLPQTTAPAADADLSNINSIDVMLWDIKCSEELCLKMHEVAGLDP 603
           +           G  G         D   SNIN+IDVML D++ S ELC +MH+VAGLD 
Sbjct: 520 AGAAAVVATGIGGGDGGSIDGVRGGDP--SNINNIDVMLRDVRGSSELCKRMHQVAGLDQ 577

Query: 604 AIYPKFISLLYWKHNGDTNNANELTFHLPGNLENELQKYSDIYSQLKPGRKLQLCKDQGK 663
            IYPKFIS LYW  +   N++N  TF L   +  EL KY  +YS++KPGR L L KDQG 
Sbjct: 578 RIYPKFISPLYWNRD---NSSNGWTFQLDPQMALELDKYCQVYSEIKPGRALHLYKDQGI 634

Query: 664 IEMELDFNDGRKLVLDVSLEQCSVINQFNSTDGEPIYLSLEQLSEPLNIAPARLLDLLNF 723
           + + L F DGRK   + +LEQCSVI QF+++      L+ + +   L + PAR    L  
Sbjct: 635 VVLTLSFQDGRKKRCEATLEQCSVIQQFDASTATTTGLTEQMIGARLQMDPARARAALQH 694

Query: 724 WIQRGVLSEENGVYSVIEYSRTDFNQTQIEFPMKNENNNNELRDETEVERKCEL--ILER 781
           W+Q GVL  +   Y   EY     +Q     P   +++ +        +R   L  ILE+
Sbjct: 695 WVQEGVLYYDGNAYKTREYLD---DQPAENLPASKDSSASSQARTMSPDRDSRLTSILEQ 751

Query: 782 SLPFIEGMLANLGAMKLNKIHSFLKITVPKNWGYNRITLLQLEKYLNVLADEGKLKYITN 841
           + PFI+GML NLGA+K+ KIHSFLK+T PK  G++ +T  QLE YL+ L +E +L   TN
Sbjct: 752 TWPFIQGMLTNLGALKVKKIHSFLKVTTPKELGFSMVTPSQLESYLHSLVEEERLICTTN 811

Query: 842 GSYELEK 848
            +Y+L K
Sbjct: 812 DTYKLPK 818

>TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {ON}
           Anc_8.321 YLR127C
          Length = 809

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/852 (41%), Positives = 510/852 (59%), Gaps = 64/852 (7%)

Query: 8   TRDLKIITDELQTLSSYIFHTNITDDLNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLF 67
           + +L +I D ++ ++  + H    DDL +LL W++P++ +SNH +RPP LR+K+ IK LF
Sbjct: 6   SSELPVIIDSIKEVALRL-HPGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIK-LF 63

Query: 68  PNNACTSSYGAMNTAQANNSIVNEGNTNKELQLQFISTFKEYYIFQVRYHFFLHFSSINY 127
            N    S Y + +          +G  NK  + +  +  +++YI+QVR HFF  F+ I  
Sbjct: 64  VNQYYNSGYISGS----------DGEINKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQT 113

Query: 128 LKDIQRWENYYEFPLRYVSIFDLNVNGWTLELNSLRHYLLNRNTKFKNNLRTRLNKLIID 187
            KDIQR E YY  PL Y+ +F+ +   W +E + LRHYLLNRN +F NN++ R+  L + 
Sbjct: 114 FKDIQRLEKYYVSPLAYIHLFESSGYEWIIERDGLRHYLLNRNMEFHNNMKQRMESLFMQ 173

Query: 188 DDFDLASNLIRWLNSANGSLSSMDLIVNALFDKISMFCEINMSGVWNKRFMIMETFNKFI 247
           DDF+  + ++ W+  A+ SLSS D++++ +  K+  FC+ +M GV+ K +++M+TFNKFI
Sbjct: 174 DDFEYVAEMLDWVEKAHTSLSSKDILLDLIIAKVKQFCDDHMMGVYGKTYLVMKTFNKFI 233

Query: 248 NQYWSQFSELIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKITLLELKK 307
            +YWS F++L+GCP+DDH LT  V+ CFE  F+RIRT+E+FDI V  +P SK T++E++K
Sbjct: 234 IKYWSNFAQLLGCPQDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRK 293

Query: 308 IMKDFKDYTNIVTTFLSDFKKHILNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTF 367
           ++    D+  IV  FLS F+K +LNPS+TT DALL+YVK++KAFL LDP+GR L S+ +F
Sbjct: 294 LITHSTDFKTIVIAFLSTFEKKVLNPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISF 353

Query: 368 VKPYFQERKHLVNVLLYAILDLPEEELKEKISFKVDMKALLLLVETLHDSDI-------- 419
           VK  FQER  LV +LLYAILDL  + L      +VD   L  L   L D ++        
Sbjct: 354 VKQTFQERSDLVVILLYAILDLQLDGLVGS-HIQVDPVCLKALASELRDPELGIENDIYP 412

Query: 420 -DQITNTPKSKDK-NKGGSFPWNLHVKGKKEKNGSSSITQSMLYEHILNYYLTWVPEPND 477
            D + N      K N  G  P                      YE ++  +L+W P+P D
Sbjct: 413 DDNLANVATGMAKLNYEGCLP----------------------YEEVMQRFLSWNPDPRD 450

Query: 478 MIPGNI-KSSSIKTNLFEVLLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDNKWSRCLKL 536
           M P  I K S    +L ++L++L             LLT RL +LKFY LD  WS+CL+L
Sbjct: 451 MAPRAISKQSPSHMSLLDILMELFESKDFFVSEFLKLLTKRLLSLKFYNLDRNWSKCLQL 510

Query: 537 IREKIVKSTETNQTNYIANGIIGLPQTTAPAADADLSNINSIDVMLWDIKCSEELCLKMH 596
           +++K+ +         I+    G  Q  +   D D SNINS DVMLWD+K S ELC +MH
Sbjct: 511 LKKKLARGAPN-----ISLAPTG-QQNNSERGD-DYSNINSNDVMLWDVKLSYELCKQMH 563

Query: 597 EVAGLDPAIYPKFISLLYWKHNGDTNNANELTFHLPGNLENELQKYSDIYSQLKPGRKLQ 656
           +V+GLD  IYPKFIS LYW    ++ N     F +P  L +E +KYS +YS++K GR L+
Sbjct: 564 QVSGLDQRIYPKFISYLYWNCQLESKN----DFEIPEPLNSEFEKYSRVYSEVKAGRALK 619

Query: 657 LCKDQGKIEMELDFNDGRKLVLDVSLEQCSVINQFNSTDGEPIYLSLEQLSEPLNIAPAR 716
           L KDQG IE++L+F DGR L  DV+LEQ +VI QF+  D     L  E +S  LN+  +R
Sbjct: 620 LLKDQGVIELDLEFKDGRVLQCDVTLEQYAVIQQFDE-DSYANRLMAETISLYLNMEISR 678

Query: 717 LLDLLNFWIQRGVLSEENGVYSVIEYSRTDFNQTQIEFPMKNENNNNELRDETEVERKCE 776
           +   L FW+++GVL + +  Y+  E SR D N   I+    +   +   ++ET +E +  
Sbjct: 679 VKSALQFWVEKGVLYQVDAFYATQE-SRQDSN---IKTAKSDSVGSFFEKNETIIEEETT 734

Query: 777 L--ILERSLPFIEGMLANLGAMKLNKIHSFLKITVPKNWGYNRITLLQLEKYLNVLADEG 834
           L   L    PF++GML NLG++K  KIHSFLK+TVPK  GY  +T  QLE YLN L +E 
Sbjct: 735 LSKTLNAIWPFVQGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQSQLESYLNSLVEEE 794

Query: 835 KLKYITNGSYEL 846
           +L   T+GSY+L
Sbjct: 795 RLACTTSGSYKL 806

>SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 787

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/834 (40%), Positives = 495/834 (59%), Gaps = 78/834 (9%)

Query: 26  FHTNITDDLNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLFPNNACTSSYGAMNTAQAN 85
           ++ N+ D+L+ +L W++P++P SNHQLRPPSLR+KN IK +                  N
Sbjct: 21  YNPNLEDELDGVLTWLNPNEPNSNHQLRPPSLRLKNGIKLV-----------------VN 63

Query: 86  NSIVNEGNTNKELQLQFISTFKEYYIFQVRYHFFLHFSSINYLKDIQRWENYYEFPLRYV 145
           N  V  G         F+   +++ + Q R HFF +F+SI   KDIQR E YYEFPL+Y+
Sbjct: 64  NEDVPPG---------FVHLLRQFVLLQTRIHFFSNFNSITSFKDIQRLEKYYEFPLKYI 114

Query: 146 SIFDLNVNGWTLELNSLRHYLLNRNTKFKNNLRTRLNKLIIDDDFDLASNLIRWLNSANG 205
           +IF    + W +E+N  RHYL+++N  F +N++ R+ +LI++DDFD+A  +  WL    G
Sbjct: 115 NIF--TPDEWFIEMNGFRHYLMSKNRIFGDNIKHRVRQLIMEDDFDMAWKIYTWLTETMG 172

Query: 206 SLSSMDLIVNALFDKISMFCEINMSGVWNKRFMIMETFNKFINQYWSQFSELIGCPEDDH 265
               + L++  L DKI+ F + NM G W +RF++METFN FI +YWS F++ + CPEDDH
Sbjct: 173 H-QLVSLLLEILMDKIADFSKQNMMGKWTQRFLVMETFNTFITKYWSTFAQALRCPEDDH 231

Query: 266 ELTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKITLLELKKIMKDFKDYTNIVTTFLSD 325
           E+TT +F+CFE  F++IRT EI++ICVL YP SK  LLEL+ +MK   DY+ ++  FLS 
Sbjct: 232 EITTEIFHCFEKEFVKIRTSEIYEICVLEYPHSKPALLELRNVMKTSADYSKLMIEFLSK 291

Query: 326 FKKHILNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYA 385
           F+  ++NPS+TT + LLSY++TIK+FL +DP GR L S+T ++KPY +ER+  V  LLYA
Sbjct: 292 FESKLMNPSVTTTEILLSYIRTIKSFLTVDPAGRYLQSVTAYIKPYLRERRDTVVHLLYA 351

Query: 386 ILDLPEEELKEKISFKVDMKALLLLVETLHDSDIDQITNTPKSKDKNKGGSFPWNLHVKG 445
           +L+L E E+ +  +  ++M  L  L + L D D        KS+              K 
Sbjct: 352 MLELDESEIDDA-NVSLNMPILTELSKELKDPDFGIEDADSKSR--------------KN 396

Query: 446 KKEKNGSSSI--TQSMLYEHILNYYLTWVPEPNDMIPGNIKSSSIKTNLFEVLLDLXXXX 503
           K     SS +   +  L E +LNY+L W PEP+D+      ++ +  +L ++LLD+    
Sbjct: 397 KLMVTDSSPVFKVEKPLCEQVLNYFLQWTPEPSDVAHRKPNNTFVNKSLLDILLDIFDSK 456

Query: 504 XXXXXXXXNLLTDRLFTLKFYKLDNKWSRCLKLIREKIVKSTETNQTNYIANGIIGLPQT 563
                   +L T +L  LK+YKL+ KW + L+L+++K               G    PQ 
Sbjct: 457 DVFISEFLSLFTKKLLGLKYYKLETKWIKILRLLKKKF--------------GHTSFPQH 502

Query: 564 TAPAADADLSNINSIDVMLWDIKCSEELCLKMHEVAGLDPAIYPKFISLLYWKHNGDTNN 623
                  D SNIN+ID+ML D+K S EL  KMHEVAGLD  ++PKFIS L+W    +   
Sbjct: 503 QF----QDTSNINNIDIMLRDVKTSYELISKMHEVAGLDDRVFPKFISYLFWNSALEAET 558

Query: 624 ANELTFHLPGNLENELQKYSDIYSQLKPGRKLQLCKDQGKIEMELDFNDGRKLVLDVSLE 683
           ++   F LPG LE E++KYS++YSQLKPGR+L L KDQG +E++L+F DGRK+  +V L 
Sbjct: 559 SD---FQLPGWLETEIEKYSEVYSQLKPGRRLHLYKDQGTVELDLEFKDGRKISCEVPLN 615

Query: 684 QCSVINQFNSTDGEPIYLSLEQLSEPLNIAPARLLDLLNFWIQRGVL--SEENGVYSVIE 741
           + +VI+ F+  D     L++EQ+ + + +  A +  +L FW ++  +   +    Y V+E
Sbjct: 616 KAAVISCFDQ-DTALKGLAVEQIVDNVKMEKALVTSILQFWCKKNAIYYDDRYNTYRVLE 674

Query: 742 YSRTDFNQTQIEFPMKNENNNNEL-----RDETEVERKCELI--LERSLPFIEGMLANLG 794
           Y   +   +         N N  +     +D    +++ E I  + +  PFI+GML NLG
Sbjct: 675 YYEPNSALSASTVISSKGNTNGGINPMDDQDNAGDKQQQEFIQSMSKIWPFIQGMLTNLG 734

Query: 795 AMKLNKIHSFLKITVPKNWGYNRITLLQLEKYLNVLADEGKLKYITNGSYELEK 848
           +MK  KIHSFLK+ VPK+ GY   T+ QLE YLNVL DE KL  + NGSY+L K
Sbjct: 735 SMKPEKIHSFLKMAVPKDIGYT-ATVNQLESYLNVLVDEDKLAAVPNGSYKLVK 787

>KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 774

 Score =  525 bits (1351), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 303/827 (36%), Positives = 454/827 (54%), Gaps = 81/827 (9%)

Query: 28  TNITDDLNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLFPNNACTSSYGAMNTAQANNS 87
           +++ DDL  +L W++P++P SNHQ+RPPSLR+K+ IK+L  N   TS             
Sbjct: 23  SSLEDDLEGILTWVNPNEPGSNHQMRPPSLRVKSAIKSLL-NGVVTSE------------ 69

Query: 88  IVNEGNTNKELQLQFISTFKEYYIFQVRYHFFLHFSSINYLKDIQRWENYYEFPLRYVSI 147
                         FI    +Y IFQ R HFFL++ S+ Y KD+Q+ E YYEFP RYV+I
Sbjct: 70  -------------SFIDLLGKYMIFQTRKHFFLNYQSLLYFKDVQKLERYYEFPTRYVNI 116

Query: 148 FDLNVNGWTLELNSLRHYLLNRNTKFKNNLRTRLNKLIIDDDFDLASNLIRWLNSANGSL 207
           F  +   W  E++ LR+YL+ +N+  KNN++ RL +L+ +DDFD+A  +  WL  A G L
Sbjct: 117 F--SSEEWCDEMSGLRNYLIRQNSGLKNNIQLRLEQLVHEDDFDMACKIYEWLCQAEGRL 174

Query: 208 SSMDLIVNALFDKISMFCEINMSGVWNKRFMIMETFNKFINQYWSQFSELIGCPEDDHEL 267
              +++V+ L  K+ +F   NM+  W +RF IME +N F+  YWS F  ++ C EDDHE+
Sbjct: 175 LP-EILVDVLLSKVKLFASKNMNSAWTQRFTIMEAYNLFVTNYWSVFCRMLQCMEDDHEI 233

Query: 268 TTTVFNCFESNFLRIRTKEIFDICVLAYPGSKITLLELKKIMKDFKDYTNIVTTFLSDFK 327
           T  ++ CFE  F+RIRT ++FDI V  +P +K TLLEL+ ++K    YT ++T FL  F+
Sbjct: 234 TNEIYRCFEEEFIRIRTSQVFDIFVTGFPTTKPTLLELRSVLKTSVKYTELITEFLYQFE 293

Query: 328 KHILNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYAIL 387
             +LNPSITT + LLSYV+ IK+ L++D + R    +T FV+PY  ER   V   LYA+L
Sbjct: 294 SKMLNPSITTAEILLSYVRAIKSILIVDVSFRYFQLLTNFVRPYLMERHDTVATFLYAML 353

Query: 388 DLPEEELKEKISFKVDMKALLLLVETLHDSDIDQITNTPKSKDKNKGGSFPWNLHVKGKK 447
            L   +L  K S    M     L   L  S      + P S    + G+ P   H     
Sbjct: 354 GLDASDLSSKNSTSTHMSIASQLSAELRGS------HQPISSSTAERGNLPHGKHALSMN 407

Query: 448 EKNGSSSITQSMLYEHILNYYLTWVPEPNDMIPGNIKSSSIKTNLFEVLLDLXXXXXXXX 507
               +        Y+ I++YYL W PEP D I  N   + I   LF+++++L        
Sbjct: 408 PYEPA--------YQQIIDYYLHWNPEPADSIQANNDQALISKELFDIIVELFDSKDVIV 459

Query: 508 XXXXNLLTDRLFTLKFYKLDNKWSRCLKLIREKIVKSTETNQTNYIANGIIGLPQTTAPA 567
                L T +L  L+ YKL++ W + LK++++K+   T ++   +               
Sbjct: 460 REFLGLFTRKLLGLRGYKLESNWVQSLKVVKKKLDFKTYSSAQEF--------------- 504

Query: 568 ADADLSNINSIDVMLWDIKCSEELCLKMHEVAGLDPAIYPKFISLLYWKHNGDTNNANEL 627
                SNIN+IDVML D+K SEELC  MHE  GL   I PKF+S L+W  + D  +A   
Sbjct: 505 -----SNINNIDVMLRDVKHSEELCSLMHEKLGLSDRIIPKFVSYLFWNAHSDF-SALPK 558

Query: 628 TFHLPGNLENELQKYSDIYSQLKPGRKLQLCKDQGKIEMELDFNDGRKLVLDVSLEQCSV 687
              LP  LE ++  Y   Y+ +K GRKL+L  +Q  +E++L   DGR L  +V+L++  V
Sbjct: 559 DHPLPKELEADINNYKKAYTNVKKGRKLRLHPEQSIVELQLRLADGRDLNYEVTLDEALV 618

Query: 688 INQFNST-DGEPIYLSLEQLSEPLNIAPARLLDLLNFWIQRGVL--SEENGVYSVIEYSR 744
           ++  +S  DG     ++E++ +  N+  +++   L FW++  +L  S E   YSV E   
Sbjct: 619 LSYLSSNGDG-----TVEEIVKQTNLDISQVEKSLKFWVKSSILRYSTETSRYSVEERQN 673

Query: 745 TDFNQT---QIEFPMKNENNNNELRDETEVERKCELILERSLPFIEGMLANLGAMKLNKI 801
            D       Q    + N  ++ +L+ +  ++      +++ LPFI+GML NLG++K +KI
Sbjct: 674 VDVKHAVERQSSSEIVNATDSVDLQQQQFIDS-----MQKVLPFIKGMLTNLGSLKADKI 728

Query: 802 HSFLKITVPKNWGYNRITLLQLEKYLNVLADEGKLKYITNGSYELEK 848
           HSFLK+ VPK  GY+  T  QL+ YLN L +E KL    NG++ L K
Sbjct: 729 HSFLKMAVPKEIGYS-ATPSQLQLYLNALVEESKLVKTPNGAFRLAK 774

>Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {ON}
           YLR127C (APC2) - subunit of the anaphase promoting
           complex (APC) [contig 171] FULL
          Length = 776

 Score =  523 bits (1347), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 302/822 (36%), Positives = 454/822 (55%), Gaps = 76/822 (9%)

Query: 30  ITDDLNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLFPNNACTSSYGAMNTAQANNSIV 89
           + DDL S+L W++P++P SNHQLRPPSLR+K+ IK L                      +
Sbjct: 25  VDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKIL----------------------I 62

Query: 90  NEGNTNKELQLQFISTFKEYYIFQVRYHFFLHFSSINYLKDIQRWENYYEFPLRYVSIFD 149
           NE      L        ++Y IFQ R HFF H+ S+ + KD+Q+ E YYEFPLR+V +F 
Sbjct: 63  NENGNGPAL----TDILRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLF- 117

Query: 150 LNVNGWTLELNSLRHYLLNRNTKFKNNLRTRLNKLIIDDDFDLASNLIRWLNSANGSLSS 209
            N   W  E+N LR+YL+++N  F  N R RL +L+++DDF++A  L  WL  A G L +
Sbjct: 118 -NREEWAEEINGLRNYLISKNLVFNRNARLRLRQLVLEDDFEMACKLYEWLCRAEGRLLT 176

Query: 210 MDLIVNALFDKISMFCEINMSGVWNKRFMIMETFNKFINQYWSQFSELIGCPEDDHELTT 269
             L+V+A+  K+  F   +M   W+KRF+ +E +N FI++YWS  S+++ CPEDDH++T 
Sbjct: 177 -HLLVDAVLSKVKAFALKHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVTN 235

Query: 270 TVFNCFESNFLRIRTKEIFDICVLAYPGSKITLLELKKIMKDFKDYTNIVTTFLSDFKKH 329
            ++ CFE  F+RIRT++ F I V  YP S+ TLLEL+ ++K    YT +VT  LS F+  
Sbjct: 236 EIYRCFEEEFIRIRTQQAFKIFVTGYPESEPTLLELRSVLKTPAKYTQLVTELLSQFEAR 295

Query: 330 ILNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYAILDL 389
           +LNPSITT + LLSYVK IK+ L +D + R    +T FV+P+  ER+  V   LYA+L L
Sbjct: 296 MLNPSITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLGL 355

Query: 390 PEEELKEKISFKVDMKALLLLVETLHDSDIDQITNTPKSKDK-NKGGSFPWNLHVKGKKE 448
              E +              L   L DS      + P  +   +K    P +        
Sbjct: 356 DASETRGPKPTGAHASIASQLSAELKDS------HQPIFRSALDKSAQSPVD-------- 401

Query: 449 KNGSSSITQSMLYEHILNYYLTWVPEPNDMIPGNIKSSSIKTNLFEVLLDLXXXXXXXXX 508
            + +S   +  +Y+ ++N+YL W PEP+D I  N   + +   LF+++++L         
Sbjct: 402 -DMASVNPKEPVYQQVINFYLHWTPEPSDSIQANNSDTLMNKGLFDIIVELFDSKDIIIG 460

Query: 509 XXXNLLTDRLFTLKFYKLDNKWSRCLKLIREKIVKSTETNQTNYIANGIIGLPQTTAPAA 568
               L TD+L  LK Y+L+  W + LK+++ +      +N     A G+           
Sbjct: 461 EFLTLFTDKLLDLKGYRLEQNWVKSLKILKNRFDFKNYSN-----AQGV----------- 504

Query: 569 DADLSNINSIDVMLWDIKCSEELCLKMHEVAGLDPAIYPKFISLLYWKHNGDTNNANELT 628
               SNIN+IDVML D+K SEELC +MH V  +   + P FIS L+W + G   +     
Sbjct: 505 ----SNINNIDVMLRDVKHSEELCAQMHSVPEISREVIPMFISYLFW-NAGSKFSTLPKD 559

Query: 629 FHLPGNLENELQKYSDIYSQLKPGRKLQLCKDQGKIEMELDFNDGRKLVLDVSLEQCSVI 688
             LP  LE+E++KY D+Y+Q+KPGRKL+L ++Q  + ++L F D R +  +VS+++ SV+
Sbjct: 560 CRLPSQLESEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLHFADKRVMDFEVSMDKSSVL 619

Query: 689 NQFNSTDGEPIYLSLEQLSEPLNIAPARLLDLLNFWIQRGVL--SEENGVYSVIEYSRTD 746
                T G    +S +++ E   +  A++   L FW+   VL    +  +YS +E   TD
Sbjct: 620 ACVAETTG----ISRDKIVEATGLEKAQVDQNLRFWLDASVLRFDSKTSLYSSLERQDTD 675

Query: 747 FNQTQIEFPMKNENNNNELRDETEVERKCELILERSLPFIEGMLANLGAMKLNKIHSFLK 806
            N ++ E  M+ E+      D    +++    +E+  PFI GML NLG +K+ KIHSFLK
Sbjct: 676 -NASEREAQMRAEDQARSAFDSQ--QQQFVESMEKVWPFIRGMLTNLGTLKVEKIHSFLK 732

Query: 807 ITVPKNWGYNRITLLQLEKYLNVLADEGKLKYITNGSYELEK 848
           + VPK  G+N  T  QLE YL +L DE KL    N +++L K
Sbjct: 733 VAVPKEIGFNATT-AQLEAYLRLLVDENKLVCSANNAFKLVK 773

>TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.321
           YLR127C
          Length = 842

 Score =  484 bits (1246), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 303/856 (35%), Positives = 458/856 (53%), Gaps = 80/856 (9%)

Query: 31  TDDLNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLFPNNACTSSYGAMNTAQANNSIVN 90
           +DD++SLL W++P+DPKSNHQL+PP++R+K +IK +  +      Y ++ T         
Sbjct: 25  SDDIDSLLDWLNPNDPKSNHQLKPPTIRLKKVIKKILLDVNTLGDYDSIETLN------- 77

Query: 91  EGNTNKELQLQFISTFKEYYIFQVRYHFFLHFSSINYLKDIQRWENYYEFPLRYVSIFDL 150
                        S  + YYIFQVR +FF +  SI Y KDI + E YYEFP+ +V IF  
Sbjct: 78  -------------SLLRYYYIFQVRLNFFSNLQSITYFKDIIKLEKYYEFPILHVPIFLN 124

Query: 151 NVNGWTLELNSLRHYLLNRNTKFKNNLRTRLNKLIIDDDFDLASNLIRWLNSANGSL-SS 209
           N   W  ELN +RHYLL  N  F++NL  RL KL+ +DDFDLA  +I+W N AN SL SS
Sbjct: 125 NNYIWETELNKIRHYLLRTNLTFRSNLINRLKKLVKEDDFDLAQEIIKWSNEANFSLLSS 184

Query: 210 MDLIVNALFDKISMFCEINMSGVWNKRFMIMETFNKFINQYWSQFSELIGCPEDDHELTT 269
             +I+NAL DKI+M+ +   +  W++RF+IMET+NKFIN+YWS F+ L+ C EDDHE+T 
Sbjct: 185 KQIILNALLDKITMYADKQFTNAWSQRFIIMETYNKFINKYWSNFAVLLNCAEDDHEITK 244

Query: 270 TVFNCFESNFLRIRTKEIFDICVLAYPGSKITLLELKKIMKDFKDYTNIVTTFLSDFKKH 329
            ++  FE  FLRIR++EIFDICV++YP SK T++EL+ ++   K  TNI+   LS+F+  
Sbjct: 245 VLYKYFEKQFLRIRSEEIFDICVISYPDSKPTIMELRGLLTQSKISTNILIRLLSEFQLK 304

Query: 330 ILNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYAILDL 389
           +LN SI T   L++Y+KT+K+ L+LDPT R L S T+F  PY Q++  ++ +LL+AILDL
Sbjct: 305 VLNLSIPTCTILIAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQKSDIIYILLFAILDL 364

Query: 390 PEEELKEKISFKVDMKALLLLVETLHDSDIDQITNTPKSKDKNKGGSFPWNLHVKGKKEK 449
             +++K     KVD   L LL E L +S      N     D +   +     + K   + 
Sbjct: 365 RTDDIKTNPIVKVDQNLLKLLSEELRESHFGINLNF---SDVDISDNLENGNNNKNISQL 421

Query: 450 NGSSSITQSMLYEHILNYYLTWVPEPNDMIPGNIKSSSIKTNLFEVLLDLXXXXXXXXXX 509
           + +   +  +LY  ILN  LTW+PE   + P        K NL ++L  +          
Sbjct: 422 DYAGQESSQLLYSQILNRALTWLPESKLVSPNKSIKMMRKKNLLDILFAIFDDHELFLKR 481

Query: 510 XXNLLTDRLFTLKFYKLDNKWSRCLKLIREKIVKSTETNQTNYIANGIIGLPQTT---AP 566
              LL  +LF +K Y L+  W +CL+L +           T +  N +   P +T     
Sbjct: 482 FVELLKQKLFVIKGYNLEESWVQCLRLFK-----------TKFSPNSLDDAPTSTNLETL 530

Query: 567 AADADLSNINSIDVMLWDIKCSEELCLKMHEVAGLDPAIYPKFISLLYWKHNGDTNNANE 626
             + D   + +IDVMLWD++ S++L  +MH +  LD  I  K IS LYW++  D  N   
Sbjct: 531 TGNNDSMYMTNIDVMLWDMRGSKKLTEQMHLIDELDNRINLKIISSLYWQY--DMKNEKR 588

Query: 627 LTFH-----LPGNLENELQKYSDIYSQLKPGRKLQLCKDQGKIEMELDFNDGRKLVLDVS 681
            T++     +   L N+L KYS +YS+LKPGR L L  DQ  IE++ +F D R +  + +
Sbjct: 589 KTYYGLLNKMDQTLFNQLDKYSKLYSRLKPGRVLNLLTDQSTIEIDFNFEDNRTVTCECT 648

Query: 682 LEQCSVINQFNSTDGEPIYLSLEQLSEPLNIAPARLLDLLNFWIQRGVLSEENGVYSVIE 741
            E    I  F   +G   Y +LE+LS   +     L   L FW+ + +L  +   Y  +E
Sbjct: 649 FENYMSICPFLENEGTSSY-TLEELSIITSFGLEDLKISLKFWLDQKILYFDGKTYRPLE 707

Query: 742 YSRTDFNQTQIEFPMKNENN------NNEL-------RDETEVERKCELILERSLP---- 784
           Y   D ++  IE P  N  N      NN L       +    ++R  +  + +  P    
Sbjct: 708 Y--LDRSEIIIESPESNNVNSVMSITNNPLNGFAILGKGNDTIDRPSQENITKCTPDHDK 765

Query: 785 --------------FIEGMLANLGAMKLNKIHSFLKITVPKNWGYNRITLLQLEKYLNVL 830
                         ++  +L NLG   + K+++ L+ T   +    +++ + LE  +  L
Sbjct: 766 TFNATSQEVSKIKEYVLSILTNLGEQNIEKLYNVLQ-TTSHDTAIKKVSSVTLENIVTEL 824

Query: 831 ADEGKLKYITNGSYEL 846
            + G++  + NG Y+L
Sbjct: 825 VENGQILCLPNGLYQL 840

>TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {ON}
           Anc_8.321 YLR127C
          Length = 732

 Score =  454 bits (1169), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 257/737 (34%), Positives = 426/737 (57%), Gaps = 52/737 (7%)

Query: 27  HTNITDDLNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLFPNNACTSSYGAMNTAQANN 86
           + +I+D+L +LLIW+ P+DP SNH L PP+L++K IIK + P++              +N
Sbjct: 26  YKDISDELETLLIWLDPNDPNSNHHLHPPTLQLKTIIKQITPSSDIYKD--------PSN 77

Query: 87  SIVNEGNTNKELQLQFISTFKEYYIFQVRYHFFLHFSSINYLKDIQRWENYYEFPLRYVS 146
           SI N  N    L+L        +Y++QVR +FF    +I   KD+ + E YY+FPL+++ 
Sbjct: 78  SIKN--NIQNWLKL--------FYVYQVRTYFFKKIDNIRQYKDMIKLEKYYQFPLQFIP 127

Query: 147 IFDLNVNGWTLELNSLRHYLLNRNTKFKNNLRTRLNKLIIDDDFDLASNLIRWLNSANGS 206
           +F      W  EL SLRHY+L++N +F   +   L +LI ++DF+ + +++ W+   + +
Sbjct: 128 LFTFQ--EWCFELLSLRHYILHQNKEFTQKIILELRQLIKEEDFETSLDIVTWIREVDSN 185

Query: 207 LSSMDLIVNALFDKISMFCEINMSGVWNKRFMIMETFNKFINQYWSQFSELIGCPEDDHE 266
           L S + I++ L +KI+++CE  M G W +R+++MET+N F+  YW  F++L+ C ED+H+
Sbjct: 186 LLSENFILDILLEKITLYCEQTMKGNWTRRYLVMETYNTFMMNYWLNFTQLLNCKEDNHK 245

Query: 267 LTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKITLLELKKIMKDFKDYTNIVTTFLSDF 326
           +T  +F  FE  F++IR +EIF IC+L+YP +K TLLEL+ ++  +  +  +V  FLS F
Sbjct: 246 ITNILFKYFEKQFIKIRIQEIFKICILSYPDTKPTLLELRNLLVTYNFFQKLVVNFLSAF 305

Query: 327 KKHILNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYAI 386
           ++ +L P+I T+D LL+Y++T+K+F +LDP+GR L+SIT ++ P+F+ERK L  +LL+AI
Sbjct: 306 ERIVLTPTINTIDCLLAYIRTVKSFQILDPSGRYLYSITNYINPHFRERKMLAPILLHAI 365

Query: 387 LDLPEEELKEKI-SFKVDMKALLLLVETLHDSDIDQITNTPKSKDKNKGGSFPWNLHVKG 445
           L LP+ +L+  I   KV   +L L++  L D ++  I NT  S  KN    F   L  K 
Sbjct: 366 LALPKIDLENAIYPIKVSSISLKLIINELEDPELG-IENT--STKKNSIKKFNEILSPKR 422

Query: 446 KKEKNGSSSI------------TQSMLYEHILNYYLTWVPEPNDMIPGNIKSSSIKTNLF 493
               N S  +              ++L + ++  +LTWVP PND+   + K     TNL 
Sbjct: 423 FNNHNSSEYLPDLLQNTSSEDSNSTLLVQKVVKQFLTWVPIPNDIATNDTKKLYSSTNLL 482

Query: 494 EVLLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDNKWSRCLKLIREKIVKSTETNQTNYI 553
           ++LL++             LL+ RL   K YKL+ KW  CL+L+R++    ++      +
Sbjct: 483 DILLNIFESKEFLLTEFSKLLSKRLLITKNYKLEGKWGACLQLLRKRFSSGSDNYTNTNL 542

Query: 554 ANGIIGLPQTTAPAADADLSNINSIDVMLWDIKCSEELCLKMHEVAGLDPAIYPKFISLL 613
           A+        T    + +   I +++VML D+  S ELC   H   G++  +YPKFIS  
Sbjct: 543 AD--------TDNLVNGENLKITNMNVMLSDLNYSSELCKIFHHANGVNTRVYPKFISSH 594

Query: 614 YWKHNGD---TNNANELT--FHLPGNLENELQKYSDIYSQLKPGRKLQLCKDQGKIEMEL 668
           YW    D   +N  NE T  F +P +L    ++Y+ +Y  L  GRK+ +  ++G IE++L
Sbjct: 595 YWVDLDDENVSNGPNEETNHFQIPPSLLGYFEEYAKLYEDLNEGRKVDIWPNEGVIEIKL 654

Query: 669 DFNDGRKLVLDVSLEQCSV---INQFNSTDGEPIYLSLEQLSEPLNIAPARLLDLLNFWI 725
            F DGR L +D +L Q ++   I + N+        ++ +LS PLN++   + +L++FW+
Sbjct: 655 SFEDGRVLEIDATLPQYALLQYIQEKNAIMQNNQGFTVNELSVPLNLSLQNVTELVDFWL 714

Query: 726 QRGVLSEENGVYSVIEY 742
           ++ VL + +  YS++EY
Sbjct: 715 KKNVLKKVDDKYSILEY 731

>CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa]
           {ON} similar to uniprot|Q12440 Saccharomyces cerevisiae
           YLR127c APC2 component of the anaphase promoting complex
          Length = 783

 Score =  447 bits (1151), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 278/829 (33%), Positives = 446/829 (53%), Gaps = 89/829 (10%)

Query: 31  TDDLNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLFPNNACTSSYGAMNTAQANNSIVN 90
            ++ N LL W+ P   K NHQL+PP+L +K +I+ L   +                    
Sbjct: 27  AEEWNVLLQWLDPAG-KKNHQLKPPNLLVKTMIEKLLLGSN------------------- 66

Query: 91  EGNTNKELQLQFISTFKEYYIFQVRYHFFLHFSSINYLKDIQRWENYYEFPLRYVSIFDL 150
                     Q +S  ++YY +Q R +F+  +  I  L +++R E +  FPL+Y+ IF+ 
Sbjct: 67  --------DYQLLSNIQDYYCWQCRVYFYNEYKRIETLNELKRIERHVLFPLKYIPIFEG 118

Query: 151 NVNGWTLELNSLRHYLLNRNTKFKNNLRTRLNKLIIDDDFDLASNLIRWLNSANGSLSSM 210
           N N    E+    +YLL  N K  +    RL   +++DDF+LA+ ++ + +       S 
Sbjct: 119 N-NRVENEVRLFGNYLLKTNKKVMSRAVERLRNRMLEDDFELATEIVDYFDYCQTD--ST 175

Query: 211 DLIVNALFDKISMFCEINMSGVWNKRFMIMETFNKFINQYWSQFSELIGCPEDDHELTTT 270
            ++++ + DKI  FC+++ +  WNKR++IMETFN+FI+QYW Q S L+ C ED+H +T T
Sbjct: 176 SIVLDIILDKIEQFCQLHYTRKWNKRYLIMETFNQFISQYWDQLSSLLFCQEDNHTITNT 235

Query: 271 VFNCFESNFLRIRTKEIFDICVLAYPGSKITLLELKKIMKDFKDYTNIVTTFLSDFKKHI 330
           ++  FE  F+ IRT EIFDIC+      + TLLEL+K +    D+  +V   LS F   +
Sbjct: 236 LYKYFEKQFISIRTNEIFDICISNPASVQPTLLELRKEISTVNDFNCVVVELLSKFNLKV 295

Query: 331 LNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYAILDLP 390
           +NPSI T DAL  Y++TIK F +LDP+GR L +I+++VKP+F++RK LV++LL+++L L 
Sbjct: 296 INPSIVTADALFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLD 355

Query: 391 EEELKEKISFKVDMKALLLLVETLHDSDIDQITNTPKSKDKNKGGSFPWNLHVKGKKEKN 450
           E +    +  +V  + L  L   L D++I   T           GSF         KE++
Sbjct: 356 ETDQLNTMPSQVSEEKLTALTNELKDTEICSYTEESDDVVDPMIGSFS--------KEED 407

Query: 451 GSSSITQSMLYEHILNYYLTWVPE-PNDMIPGNIKSSSIKTNLFEVLLDLXXXXXXXXXX 509
                  SM+ E ++  Y+ W+PE P     G +  S  K +LF++LL+L          
Sbjct: 408 -------SMVLEQVIKRYMEWIPEVPTSFGKGIL--SDHKLDLFDILLELLESKETLVIE 458

Query: 510 XXNLLTDRLFTLKFYKLDNKWSRCLKLIREKIV-KSTETNQTNYIANGIIGLPQTTAPAA 568
             NLLT +L  L+ Y LD KWS+ L L++++   +STET                     
Sbjct: 459 FKNLLTKKLLDLRGYTLDKKWSKFLSLLKKRFDNRSTET-------------------MD 499

Query: 569 DADLSNINSIDVMLWDIKCSEELCLKMH-EVAGLDPAIYPKFISLLYWKHNGDTNNANEL 627
           + DL+NIN+ID+ML DI  S ++   M  ++   +  +YPK +S LYW +N DT  +   
Sbjct: 500 EEDLNNINTIDIMLRDIYKSRQIATDMQLDLHNTNVKVYPKIVSALYWSNNSDT-QSKAG 558

Query: 628 TFHLPGNLENELQKYSDIYSQLKPGRKLQLCKDQGKIEMELDFNDGRKLVLDVSLEQCSV 687
            F + G LE+ L+ YS  YSQ + G+KL+L +D G + + L F DGR +    SL Q SV
Sbjct: 559 DFEMDGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLSFLDGRTVHCKASLRQYSV 618

Query: 688 INQFNSTDGEPIY----LSLEQLSEPLNIAPARLLDLLNFWIQRGVLSEENGVYSVIEYS 743
           +  F S   +  +    L++ +L     +   ++ D+L +W+ + VL   +G Y  +E+ 
Sbjct: 619 LTLFKSPKHDSNFPTEGLTISELCARSGMQSKQMADILRYWVSKDVLYFSDGKYRTLEFL 678

Query: 744 RTDFNQTQIEFPMKNENNNNELRDETEVER------KCELILERSLPFIEGMLANLGAMK 797
           R   + T    P        ++ +E+ VER      K E  +ER+LP+I+ +L NLG +K
Sbjct: 679 RWKGDSTYAAIP--------DVLEESVVERSSQHEDKQENHVERALPYIKDILLNLGTLK 730

Query: 798 LNKIHSFLKITVPKNWGYNRITLLQLEKYLNVLADEGKLKYITNGSYEL 846
           ++K+H+ L+  +PK+  Y+ +   QL+ YL+ L +EG L   +N SY+L
Sbjct: 731 IDKLHALLQSAMPKDSHYSTVNQKQLQDYLDTLVEEGVLSSASNDSYKL 779

>KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.321
           YLR127C
          Length = 817

 Score =  397 bits (1021), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 288/879 (32%), Positives = 445/879 (50%), Gaps = 112/879 (12%)

Query: 14  ITDELQTLSSYIFHTNITDDLNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLFPNNACT 73
           ++DE Q L   + +    +DL+ LL+W+SP    + HQ +PPSLRIK  I+ +     C 
Sbjct: 1   MSDE-QILHMMLPNAKFAEDLDRLLLWLSP----AEHQCKPPSLRIKKSIQRI---RECF 52

Query: 74  SSYGAMNTAQANNSIVNEGNTNKELQLQFISTFKEYYIFQVRYHFFLHF-SSINYLK--D 130
                                  +L   F +   + YI  +R+ F  +   + N LK  D
Sbjct: 53  -----------------------QLSSDFTNCLVKLYIDLIRFEFISYMKENANCLKFND 89

Query: 131 IQRWENYYEFPLRYVSIFDLNVNGWTLELNSLRHYLLNRNTKFKNNLRTRLNKLIIDDDF 190
           + + EN  E P  ++   +     +   L+ LRHYLL+ +  FK  L T +  LI++DDF
Sbjct: 90  VLKLENRIEHPRLFIPELEFE---YFKNLHMLRHYLLDSDKSFKTALCTSIENLIMEDDF 146

Query: 191 DLASNLIRWLNSANG-SLSSMDLIVNALFDKISMFCEINMSGVWNKRFMIMETFNKFINQ 249
             A+ ++ W++SA    LS  DL+++ L  KI+  C  ++ G W +RF+++ETFN FI  
Sbjct: 147 YSATIILDWIDSAYSIDLSPKDLVLDMLVKKIAGICSGSIRGSWTRRFIVIETFNDFIEV 206

Query: 250 YWSQFSELIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKITLLELKKIM 309
           YWS F++L+ CPE+DHELT TVF CFE  F+ IR  EIF+I   AYP SK T+LEL+K+M
Sbjct: 207 YWSHFAQLLKCPENDHELTKTVFKCFEREFINIRINEIFEIFTSAYPESKPTILELRKVM 266

Query: 310 KDFKDYTNIVTTFLSDFKKHILNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTFVK 369
           K  KD   +  TFL  FK  +LNP +TT+DAL SY+K IK FL+LDP GR L+ +TTFVK
Sbjct: 267 KAPKDLQRLTYTFLDTFKDEMLNPCVTTIDALTSYLKAIKGFLLLDPAGRYLNLVTTFVK 326

Query: 370 PYFQERKHLVNVLLYAILDLPEEELKE-KISFKVDMKALLLLVETLHDSDIDQITNTPKS 428
           PYFQ++  L+N+LLYAILDL  ++ ++  IS+   +  L L +    +  I+ +    + 
Sbjct: 327 PYFQDKSDLINILLYAILDLKPKDFEDLNISYIPGLNKLSLDMREDPEFSIENV----EP 382

Query: 429 KDKNKGGSFPWNLHVKGKKEKNGSSSITQSMLYEHILNYYLTWVPEP------NDMIPGN 482
            D N   + P NL   G    +   ++ Q    +HI+  ++ WVPEP      ND   GN
Sbjct: 383 NDNNYKRTVP-NLESIGANSLHDKGTLIQ----DHIMKQFMMWVPEPNMNNLENDHDNGN 437

Query: 483 -----------IKSSSIKTNLFEVLLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDNKWS 531
                      + S     NL ++LLDL            NLLT + F L+ Y++D  W 
Sbjct: 438 DFEEDNNDVTAVNSIFYNVNLLDILLDLFESKEIFIGKFVNLLTIKFFKLQNYRVDPNWQ 497

Query: 532 RCLKLIREKIVKSTETNQTNYIANGIIG---------LPQTTAPAADADLSNI----NSI 578
           +CL+LI  K   S  +       +  IG         + +     A  D+  I    N I
Sbjct: 498 KCLELINSKFNSSNISMDEKMEEDVAIGTVNPTNENYVDEKRKTNASNDMEEIQISLNKI 557

Query: 579 DVMLWDIKCSEELCLKM------HEVAGLDPAIYPKFISLLYWKHNGDTNNANELTFHLP 632
           +VML DI+ SE+   ++      + +   +  I PKFIS LYW +  +    N     L 
Sbjct: 558 EVMLNDIRHSEKFSFQISSELNRYGLRSNNVGIKPKFISPLYWDYEDNELGVNNF---LK 614

Query: 633 GNLENE-----LQKYSDIYSQLKPGRKLQLCKDQGKIEMELDFNDGRKLVLDVSLEQCSV 687
            N+ +E     + +Y+  Y  +  G  L  CK +  IE+E+ FNDG      V+  Q  V
Sbjct: 615 ENVFDEECTKAILQYASEYCSINKGFALHYCKGKEMIEVEISFNDGAIKGFLVNASQYYV 674

Query: 688 INQFNSTDGEPIYLSLEQLSEPLNIAPARLLDLLNFWIQRGVLSEENGVYSVIEYSRTDF 747
           +  F++ + +    S+    E    +   ++D L FW+++ VL  E G Y    YSR D 
Sbjct: 675 LTLFDTGNEKLTIESILTAGEAKR-SKNEIIDALKFWVEKNVLVYEGGYY----YSR-DL 728

Query: 748 NQTQIEFPMKNENNNNELRDETEVERKCELILERSLPFIEGMLANLGAMKLNKIHSFLKI 807
           +       ++N   N   R +       +L+++ +LP+I+ ML + G +  ++I +FLK 
Sbjct: 729 HS------IENSKGNTTTRTD-------DLLVKEALPYIKTMLESFGNLSASRIQNFLKA 775

Query: 808 TVPKNWGYNRITLLQLEKYLNVLADEGKLKYITNGSYEL 846
           T+P     + I +  +   L+ L  +G L   ++GSY+L
Sbjct: 776 TLPAAQDSDHI-ITDIHSVLDTLVSDGILFKNSSGSYKL 813

>NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.321
           YLR127C
          Length = 811

 Score =  394 bits (1011), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 277/887 (31%), Positives = 438/887 (49%), Gaps = 134/887 (15%)

Query: 10  DLKIITDELQTLSSYIFHTNITDDLNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLFPN 69
           DL  I   L+      FH      L SLL+W+ P+  K   Q +PP+L +K+ I      
Sbjct: 6   DLPTIITSLREQVERQFHPQ----LESLLLWLDPNSSKGTRQNKPPTLELKDCI------ 55

Query: 70  NACTSSYGAMNTAQANNSIVNEGNTNKELQLQFISTFKEYYIFQVRYHFFLHFSSINYLK 129
                            +++  G +  E   +F    +EYY++ V++HF  +   I+ LK
Sbjct: 56  -----------------NLLRAGYSQDE---KFKMWLREYYLYVVKFHFMKNVDEISVLK 95

Query: 130 DIQRWENYYEFPLRYVSIFDLNVNGWTLELNSLRHYLLNRNTKFKNNLRTRL-------N 182
           D +  E  Y +PL+++ + D      +  + S +HYL+++N  F+ NL T+        N
Sbjct: 96  DFKLLEMIYIYPLQFMDLVD--STDISNLVKSFKHYLIDKNVTFRKNLITKFKDCFLVGN 153

Query: 183 KLIIDDDFDLASNLIRWLNSANGSLSSMDLIVNALFDKISMFCEINMSGVWNKRFMIMET 242
           +   + +F     +I W+  + G LS+ DLI++A   KI +F    M G  N++F++MET
Sbjct: 154 QFEFEYEFANIVEIIHWIQDSEGVLSATDLILDASLTKIEIFAREQMIGKLNQKFIVMET 213

Query: 243 FNKFINQYWSQFSELIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKITL 302
           FNKFI+ YW   ++LIG  EDDH+LT  ++  FE  F++IR +EI  I V  YP +K T+
Sbjct: 214 FNKFIDIYWKNLTQLIGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQDYPQTKPTI 273

Query: 303 LELKKIMKDFKDYT---------------NIVTTFLSDFKKHILNPSITTVDALLSYVKT 347
           LELK I+      T                ++  FL  FK+  LNP I T+D L +YVK 
Sbjct: 274 LELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTIDVLNAYVKA 333

Query: 348 IKAFLVLDPTGRCLHSITTFVKPYFQERK-HLVNVLLYAILDLPEEELKEKISFKV--DM 404
            K+FL+LDP+G  L+SI  FVKPY +  +  +V++LLYA+L+L  ++L E    K   DM
Sbjct: 334 TKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVDILLYALLNLKSKDLIELNCEKTTYDM 393

Query: 405 KALLLLVETL------HDSDIDQITNTPKSKDKNKGGSFPWNLHVKGKKEKNGSSSITQS 458
           +++ LL + L      H  D+D    +P+  ++ +  + P                    
Sbjct: 394 RSIELLSKELSNDHSKHAGDVDYKKFSPEGTNEFENSTLP-------------------- 433

Query: 459 MLYEHILNYYLTWVPE--PNDMIPGNIKSSSIKTNL--FEVLLDLXXXXXXXXXXXXNLL 514
             YE +   +L W P   P      + + +S+  N+   + + +              LL
Sbjct: 434 --YEQVYTDFLNWKPSITPISESSNDDEFASLGKNITPIDYVFNALESKDKLISEFLKLL 491

Query: 515 TDRLFTLKFYKLDNKWSRCLKLIREKIVKSTETNQTNYIANGIIGLPQTTAPAADADLSN 574
           T +L  +K Y+++++W +CLK++++K+     T+  N + +  I              S+
Sbjct: 492 TIKLLHMKGYEVEDRWQKCLKILQDKV-----TSDKNIVNDESIT-------------SD 533

Query: 575 INSIDVMLWDIKCSEELC-LKMHEVA-GLDPAIYPKFISLLYWKHNGDTNNANELTFHLP 632
           IN+I +ML DI  S+E    K+ E     +  ++PKFIS LYWK        +E  F L 
Sbjct: 534 INTILIMLHDISISKESSNEKISEFQNSSEMQLFPKFISKLYWKF----KRQSEYQFPLD 589

Query: 633 GNLENELQKYSDIYSQLKPGRKLQLCKDQGKIEMELDFNDGRKLVLDVSLEQCSVINQF- 691
             L  +L KY   Y    PG KL+L    G   + L F DGRKL +D + EQ +V++ F 
Sbjct: 590 SKLRKKLSKYMKSYHHSHPGMKLKLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLSAFH 649

Query: 692 NSTDGEPIYLSLEQLSEPLNIAPARLLDLLNFWIQRGVLSEENGVYSVIEY--------- 742
           N  D     LS+ QLS  L + P R+   L FWI + VL  +N  Y++ EY         
Sbjct: 650 NDKDDSSQVLSINQLSTMLKMDPERVRAHLQFWINKKVLCHQNDYYTIQEYLNNQELSSG 709

Query: 743 ----SRTDFNQTQIEFPMKNENNNNELRDETEVERKCELILERSLPFIEGMLANLGAMKL 798
               + +    +Q   P K     N L D  E       IL R  P+I  M  NLG++K+
Sbjct: 710 PTVITSSILPLSQERMPFKRSVPTNVLNDPKE-------ILHRVYPYINDMFTNLGSLKV 762

Query: 799 NKIHSFLKITVPKNWGYNRITLLQLEKYLNVLADEGKLKYITNGSYE 845
           +KIHSFL ++VP+   Y+++T+ QLE YL+ L +E +L  + +GS++
Sbjct: 763 DKIHSFLNMSVPRGLHYSKVTVTQLEAYLDQLVEEEQLIVLPDGSFK 809

>KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {ON}
           Anc_8.321 YLR127C possible pseudogene; NNN added to
           avoid internal stop codon
          Length = 797

 Score =  336 bits (862), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 251/856 (29%), Positives = 414/856 (48%), Gaps = 101/856 (11%)

Query: 21  LSSYIFHTNITDDLNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLFPNNACTSSYGAMN 80
           L  Y+      DDL  ++ W+ P      H   PPSLR+K  I+++    +         
Sbjct: 12  LKRYLATEQEQDDLERVMGWIHP----QAHACHPPSLRMKKAIRSVLGKAS--------- 58

Query: 81  TAQANNSIVNEGNTNKELQLQFISTFKEYYIF-QVRYHFFLHFSSINYLKDIQRWENYYE 139
                         +++ ++ +I   K+ Y+  QV+  F          K IQ  E+   
Sbjct: 59  ------------ELDRQFKIYYIDVIKQEYLCDQVKREF----------KHIQVLESKLV 96

Query: 140 FPLRYVSIFDLNVNGWTLE--LNSLRHYLLNRNTKFKNNLRTRLNKLIIDDDFDLASNLI 197
           +P+ Y+    ++ +   +E  + SLRHYL++ +   +N+L      L+ DDDF+    +I
Sbjct: 97  YPVTYLPFLSIS-DQLAIEQTICSLRHYLVDNDDNLRNSLVAEFETLMQDDDFESGYQII 155

Query: 198 RWLNSANGSL-SSMDLIVNALFDKISMFCEINMSGVWNKRFMIMETFNKFINQYWSQFSE 256
            WL +AN  L    +L ++ +  KIS  C+  M   W  +F++M TFNKFIN YWS  ++
Sbjct: 156 EWLYTANAKLLRPWNLALDTIVSKISTLCDNEMRRNWEAKFLVMNTFNKFINLYWSHLAK 215

Query: 257 LIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKITLLELKKIMKDFKDYT 316
            +   ED+H+ T  ++ CFE  F+RIRT+EIF+I V +Y  +K T+LEL+  M  ++  +
Sbjct: 216 FLHLSEDNHDFTKVLYKCFEKEFVRIRTEEIFEIVVESYQAAKTTILELRTFMSGYERLS 275

Query: 317 NIVTTFLSDFKKHILNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERK 376
            +V  FL  FK  +LNPS+ TV+AL+++++++K F++LDP  R +H+IT FVKP+F +R 
Sbjct: 276 KLVNQFLKQFKIKVLNPSVNTVEALVAFIRSVKCFVILDPRARHMHTITNFVKPFFHQRG 335

Query: 377 HLVNVLLYAILDLPEEELKEKISFKVDMKALLLLVETLHDSDIDQITN-TPKSKDKNKGG 435
             V ++LYAILDL + + +     K+ +  +  L E  H+   D   N   K +      
Sbjct: 336 DAVQIILYAILDLRDVDFE-----KMGVSPVKGLSELSHELREDPYVNINAKCQTPTPSP 390

Query: 436 SFPWNLHVKGKKEKNGSSSI---------TQSMLYEHILNYYLTWVPE-----PNDMIPG 481
           S   + H+      N SSS+         T  ++Y+ +LN +             D +  
Sbjct: 391 SKISSPHL------NDSSSMDVDDKLDDGTTDLVYKQVLNQFXXRGHHETNQGTRDYVGV 444

Query: 482 NIKSS--SIKTNLFEVLLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDNKWSRCLKLIRE 539
           N+K S  S +TNL + L +L             LLT +LF L  Y L+  W+ C +LI+ 
Sbjct: 445 NVKFSQRSNRTNLLDPLFELFDKKDELLSCFLKLLTLKLFKLSGYTLEPNWNECYQLIKR 504

Query: 540 KIVKSTETNQTNYIANGIIGLPQTTAPAADAD---LSNINSIDVMLWDIKCSEELCLKMH 596
           K+ K    +       G +      AP +  +   L ++N IDVML D++ + ++  ++H
Sbjct: 505 KVTKGDVGD------GGPLSRDTADAPVSSNNEQVLLSLNKIDVMLHDLRENAKITRRLH 558

Query: 597 EVAGLDPAIYPKFISLLYWKHNGD--TNNANELTFHLPGNLENELQKYSDIYSQLKPGRK 654
             + L+  ++PKFIS  YW +  D  T   N     +   LE ++ +Y   + +LK GR 
Sbjct: 559 RTSMLNGNVFPKFISSQYWSYRDDTFTKAGNRDQIKIDPVLETDILQYGGRFCELKYGRM 618

Query: 655 LQLCKDQGKIEMELDFNDGR-KLVLDVSLEQCSVINQFNSTDGEPIYLSLEQLSEPLNIA 713
           ++LCK++   E+EL  NDG    V  V   + SVI ++ +T G     +  +L E   + 
Sbjct: 619 VRLCKEKTIFEIELTVNDGEVPQVFKVDAMKYSVIEKY-ATGGPRAGYTPTELCELCGMD 677

Query: 714 PARLLDLLNFWIQRGVLSEENGVYSVIEYSRTDFNQTQIEFPMKNENNNNELRDETEVER 773
            A +   L +W+  G+L   +  Y         +  T    P  N          T +E 
Sbjct: 678 IADVQTSLTYWVNAGLLRLSSSGY---------YESTSETGPPPNRG--------TPLEA 720

Query: 774 KCELILERSL-PFIEGMLANLGAMKLNKIHSFLKITVPKNWGYNR-ITLLQLEKYLNV-L 830
                L+  +  FI GML +LG +   +IH +L  TVP    Y   +T+LQL+ YL+  +
Sbjct: 721 STREFLDGVVWTFIRGMLESLGTLSCAEIHEYLAATVPATIRYQETVTMLQLQGYLDYNV 780

Query: 831 ADEGKLKYITNGSYEL 846
                L+    G Y+L
Sbjct: 781 QSTHLLQQTPEGEYKL 796

>Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 511
           aa] {ON} ANNOTATED BY YGOB -
          Length = 511

 Score =  318 bits (815), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 210/533 (39%), Positives = 296/533 (55%), Gaps = 45/533 (8%)

Query: 331 LNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYAILDLP 390
           +NPSITTVDAL++YVKT+K+FL LDP+G+ LHSI+TFV PY QER  LV+VLLYAILDL 
Sbjct: 1   MNPSITTVDALIAYVKTVKSFLTLDPSGKYLHSISTFVNPYLQERNDLVSVLLYAILDLQ 60

Query: 391 EEELKEKISFKVDMKALLLLVETLHDSDIDQITNTPKSKDKNKGGSFPWNLHVKGKKEKN 450
            E  +E+    +D  +L++L + L D +           DKN+    P N        K+
Sbjct: 61  SENFQEEAQNILDADSLVILSDELRDPEFGIEGELNIDLDKNELTGQPSN--------KS 112

Query: 451 GSSSITQSMLYEHILNYYLTWVPEPNDMIPGNIKSSSIKTNLFEVLLDLXXXXXXXXXXX 510
           G S    S+LY  ++   L WVPE + +     K   ++ NL ++LL++           
Sbjct: 113 GDS----SLLYRQVITQMLNWVPESSKIDSKRQKMIGLRKNLLDILLEIFENNEVFIAEF 168

Query: 511 XNLLTDRLFTLKFYKLDNKWSRCLKLIREKIVKSTETNQTNYIANGIIGLPQTTAPAADA 570
             LLT +L  LK+YKLD++WS+CLKL++EK   ++          G   +         +
Sbjct: 169 LKLLTKKLLKLKYYKLDSRWSKCLKLLKEKFKGNSA---------GTTSISTNIGNVTGS 219

Query: 571 DLSNINSIDVMLWDIKCSEELCLKMHEVAGLDPAIYPKFISLLYWKHNGDT----NNANE 626
           DL  IN+IDVMLWD+K S +L  +MH++ GLD  I PKFIS LYW    ++    NNA +
Sbjct: 220 DLVYINNIDVMLWDLKTSGDLTSRMHQIEGLDRRIQPKFISSLYWDQAKESKSKGNNAKQ 279

Query: 627 LTFHLPGNLENELQKYSDIYSQLKPGRKLQLCKDQGKIEMELDFNDGRKLVLDVSLEQCS 686
               +   L  +L+KY  +YS+LKPGR L L KD G +E+E  F DGR +  D +LEQ +
Sbjct: 280 T--QIDPLLSTQLEKYIRVYSELKPGRTLHLLKDHGTVELEFTFEDGRTISCDATLEQSN 337

Query: 687 VINQFNSTDGEPIYLSLEQLSEPLNIAPARLLDLLNFWIQRGVLSEENGVYSVIEYSRTD 746
           +IN F+    E   LSLEQL     I    L  +L FW+   VL  +  +Y ++EY    
Sbjct: 338 IINYFSEAVSEN-GLSLEQLHILSGIESTGLKKILQFWVDEKVLYFDGQLYRILEY---- 392

Query: 747 FNQTQIEFP--------MKNENNNNELRDETEVERKCEL-----ILERSLPFIEGMLANL 793
            +Q +I           +K E   N L   +      ++      L    P+I+GML NL
Sbjct: 393 LDQPEIIVQSLTHTGEVLKEEQKLNPLSSSSITSDIDQMNKIHETLNNVWPYIKGMLTNL 452

Query: 794 GAMKLNKIHSFLKITVPKNWGYNRITLLQLEKYLNVLADEGKLKYITNGSYEL 846
           G++KL KIHSFL+ TVPK+  YN IT+  LE YLN L ++  L+ + +GSY L
Sbjct: 453 GSLKLEKIHSFLRATVPKDVNYNSITVSSLEVYLNSLVEDDVLELLASGSYRL 505

>AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR127C (APC2)
          Length = 709

 Score =  322 bits (826), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 220/743 (29%), Positives = 364/743 (48%), Gaps = 84/743 (11%)

Query: 29  NITDDLNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLFPNNACTSSYGAMNTAQANNSI 88
           ++ D++ ++L WM P+D  +NHQ+RPPSLRIKN I+ L                      
Sbjct: 24  SLKDEIEAVLEWMDPNDDHNNHQMRPPSLRIKNSIRLLRLGEQAP--------------- 68

Query: 89  VNEGNTNKELQLQFISTFKEYYIFQVRYHFFLHFSSINYLKDIQRWENYYEFPLRYVSIF 148
              G T        +   ++  + Q+R HFF H+  +    D+ + E YYEFPLRYV++F
Sbjct: 69  ---GTT--------VGLLRQCAVSQMRQHFFRHWERLEQYTDMVKLERYYEFPLRYVAVF 117

Query: 149 DLNVNGWTLELNSLRHYLLNRNTKFKNNLRTRLNKLII-DDDFDLASNLIRWLNSANGSL 207
               +    EL  LR YLLN N  F+ N+  R+  LI+ DDDF+ A+ L +W+    G  
Sbjct: 118 --TEDEVAAELVGLRKYLLNGNPGFRANMEARIRALILQDDDFETAARLYKWIVQGLGH- 174

Query: 208 SSMDLIVNALFDKISMFCEINMSGVWNKRFMIMETFNKFINQYWSQFSELIGCP-EDDHE 266
             +  ++  L  KI++FC   M G  ++R++IME FN FI + W+QF +L+  P  DD E
Sbjct: 175 PMVKFVIEVLTQKIALFCRNRMDGNVDQRYLIMEVFNSFIARCWAQFIQLLQFPTADDPE 234

Query: 267 LTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKITLLELKKIMK-DFKDYTNIVTTFLSD 325
           L   ++ CFE  F+ ++T+E+F   +  +P SK  LLE+K ++K D  +   +V    +D
Sbjct: 235 LNNLIYRCFEKKFIELKTQELFHQIIPKFPMSKPALLEMKSVIKGDTAELDRLVAQIYND 294

Query: 326 FKKHILNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYA 385
           F K +L PS+TTV+ LL YVKTIK  +V+DPTGR ++  T+ +KP  +ER  L+  +L A
Sbjct: 295 FHKELLVPSVTTVEILLYYVKTIKCLMVVDPTGRSMNRFTSKLKPKIKERSDLIISVLCA 354

Query: 386 ILDLPEEELKEKISFKVDMKALLLLVETLHDSDIDQITNTPKSKDKNKGGSFPWNLHVKG 445
           IL+L  +E+ E IS K  +     L+  L     +    T  S   +KG +  +++  + 
Sbjct: 355 ILELDSDEIHEVIS-KNTLTENPQLLSQLSKELKNSTALTFHSMSTSKGKAAIYSVAFER 413

Query: 446 KKEKNGSSSITQSMLYEHILNYYLTWVPEPNDMIPGNIKSSS----------IKTNLFEV 495
           +               + ++  +L W PEP      + K+ +          +  ++ EV
Sbjct: 414 Q---------------DQLVKQFLEWTPEPGPFTADDAKALNSDDDGAETLELPKDVLEV 458

Query: 496 LLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDNKWSRCLKLIREKIVKSTETNQTNYIAN 555
           +  +             L+T+ +  +  Y L+ KWS+ LK + +K  K+ +    +    
Sbjct: 459 VFQVFDSPEVLINEFIQLVTNHMLQMDGYVLNAKWSQLLKTVMKKYFKNNKQVLKSM--- 515

Query: 556 GIIGLPQTTAPAADADLSNINSIDVMLWDIKCSEELCLKMHEVAGLDPAIYPKFISLLYW 615
                          + SN+ ++ VM  D++ S        ++  + P +YPK IS LYW
Sbjct: 516 --------------CEESNLVNVFVMWSDLEKSATFQTWSTKLQLVPPNVYPKIISYLYW 561

Query: 616 KHNGDTNNANELTFHLPGNLENELQKYSDIYSQLKPGRKLQLCKDQGKIEMELDFNDGRK 675
           K    +   +   + +   L     +    +    PGRKL+  KDQG ++++L F DGR 
Sbjct: 562 KIGRRSPYGD---YAVAPGLAAIFDQMEKAFETRSPGRKLRFQKDQGSVDLQLVFEDGRH 618

Query: 676 LVLDVSLEQCSVINQFNSTDGEPIYLSLEQLSEPLNIAPARLLDLLNFWIQRGVLS-EEN 734
               VSL + +VI+ F     +   LS+  ++   N++P  + D++ FW    VL   +N
Sbjct: 619 WSSRVSLPKYTVIDLFQR---QACPLSVTDIAAHTNMSPRLVEDIIQFWCHEHVLHLNKN 675

Query: 735 GVYSVIE--YSRTDFNQTQIEFP 755
            +Y ++E   S     Q+Q   P
Sbjct: 676 DLYEILENHNSAIASRQSQASVP 698

>Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGL193W
          Length = 689

 Score =  317 bits (811), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 225/734 (30%), Positives = 371/734 (50%), Gaps = 85/734 (11%)

Query: 30  ITDDLNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLFPNNACTSSYGAMNTAQANNSIV 89
           + DDL +LL W++P+D  +NHQ+R PSLRIKN IK L  ++A                  
Sbjct: 25  LRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKLLKLDDAE----------------- 67

Query: 90  NEGNTNKELQLQFISTFKEYYIFQVRYHFFLHFSSINYLKDIQRWENYYEFPLRYVSIFD 149
                    Q+  +   +++ + Q+RYHFF ++ S+   KD+ R E YYEFPL+YV +F 
Sbjct: 68  ---------QVFLLQLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLF- 117

Query: 150 LNVNGWTLELNSLRHYLLNRNTKFKNNLRTRLNKLIID-DDFDLASNLIRWLNSANGSLS 208
                 + EL  LR YLLNRN+ F+NN+ +R+  LI++ DDF+++S L +W+    G   
Sbjct: 118 -TAEELSNELIGLRKYLLNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWMVQGLGH-P 175

Query: 209 SMDLIVNALFDKISMFCEINMSGVWNKRFMIMETFNKFINQYWSQFSELIGCP-EDDHEL 267
            +  +++ L +KI +FC+  M G  +++ +I E FN FI++ W+QF +L+  P EDD EL
Sbjct: 176 MVKFVIDLLTNKIELFCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQEL 235

Query: 268 TTTVFNCFESNFLRIRTKEIFDICVLAYPGSKITLLELKKIMKDF-KDYTNIVTTFLSDF 326
              ++ CFE+ F+ ++TKE+FD  +  +P SK +LLE+K ++K   ++   +V    +DF
Sbjct: 236 NNLIYRCFENKFIEMKTKELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRLVAQICNDF 295

Query: 327 KKHILNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYAI 386
              +L PS+TT++ LL YVK IK  +V+DPTGR ++  T  +KP  +ER  L+  +L AI
Sbjct: 296 HSELLIPSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCAI 355

Query: 387 LDLPEEELKEKISFKVDMKALLLLVETLHDSDIDQITNTPKSKDKNKGGSFPWNLH-VKG 445
           L+L ++E+ E IS     K  L    T +   +DQ++       K    S   N H V  
Sbjct: 356 LELTKDEIHEVIS-----KNTL----TENPQLLDQLS-------KELKNSTALNFHSVTT 399

Query: 446 KKEKNGSSSITQSMLYEHILNYYLTWVPEP-----------NDMIPGNIKSSSIKTNLFE 494
            K K    S+ Q      ++  +L W PEP           N+      ++  +  ++ E
Sbjct: 400 IKSKAAIYSVAQER-QNPLVKQFLEWTPEPGPFNEDISKLGNNDTDDTTETLELPKDVLE 458

Query: 495 VLLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDNKWSRCLKLIREKIVKSTETNQTNYIA 554
           V+  +             L+T+ +  ++ Y L  KWS+ LK + +K  K+ +      + 
Sbjct: 459 VVFQVFDSPEILINEFIKLITNHMLQMEGYILSAKWSQLLKTLMKKYFKNNKQ-----VL 513

Query: 555 NGIIGLPQTTAPAADADLSNINSIDVMLWDIKCSEELCLKMHEVAGLDPAIYPKFISLLY 614
             I             + SN+ ++ VM  D++ S        ++  +   +YPK IS LY
Sbjct: 514 KSI------------CEESNLVNVFVMWSDLEKSASFQNWSTKLQLIPSNVYPKIISYLY 561

Query: 615 WKHNGDTNNANELTFHLPGNLENELQKYSDIYSQLKPGRKLQLCKDQGKIEMELDFNDGR 674
           WK +  +   +   + +   L    Q+    +    PGRKL+   DQG +E+ L F+DGR
Sbjct: 562 WKISRKSLYGD---YRISSALAIIFQQMEKAFEMKSPGRKLRFQNDQGTVEIALTFDDGR 618

Query: 675 KLVLDVSLEQCSVINQFNSTDGEPIYLSLEQLSEPLNIAPARLLDLLNFWIQRGVL-SEE 733
                VSL + +VI  F      P  L    + +  ++A   +  ++ +W Q  VL S  
Sbjct: 619 HWSNKVSLPKYTVIELFQKV---PRGLRTADIVQQTDMAQHHVEAIVQYWCQEHVLYSTG 675

Query: 734 NGVYSVIEYSRTDF 747
           +  Y ++E +   F
Sbjct: 676 DDCYRILERADVAF 689

>NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.321
           YLR127C
          Length = 911

 Score =  298 bits (762), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 272/937 (29%), Positives = 447/937 (47%), Gaps = 177/937 (18%)

Query: 34  LNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLFPNNACTSSYGAMNTAQANNSIVNEGN 93
           L ++L+W++P++  +       ++ +KN I      N   S+YG                
Sbjct: 30  LQTMLLWLNPNETTTQSATTM-TIDLKNCI------NIIVSTYG---------------- 66

Query: 94  TNKELQLQFISTFKEYYIFQVRYHFFL--HFSSINYLKDIQRWENYYEFPLRYVSIFDL- 150
             K+ Q++ +  FK+YY F ++ HF       ++  +++  + EN Y  PLR+   +DL 
Sbjct: 67  --KDDQIRLL--FKKYYSFVIKLHFMKDNRPKNMTSIREFHKLENLYLTPLRFT--YDLI 120

Query: 151 NVNGWTLELNSLRHYLLNRNTKFKNNLRTRLNKLII-DDDFDLASNL------IRWLNSA 203
           + N     +N  + YL+N N  F+ N+   +  L + +D F+   N+      + WLN A
Sbjct: 121 DTNEMQSLINIFKRYLINNNFTFRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLNDA 180

Query: 204 NGSLSSMDLIVNALFDKISMFCEINMSGVWNKRFMIMETFNKFINQYWSQFSELI----- 258
           NG++S +DL+++ L  KI  FC+  M+G+WN RF+IME FN FINQYW   S+L      
Sbjct: 181 NGNVSPIDLLLDLLLRKIEKFCQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQF 240

Query: 259 --GCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKITLLELKKIM------- 309
             G  E+DH LT  ++  F   F++IR  E   I V  +P S  T++ELK ++       
Sbjct: 241 DYGDVENDHALTNLIYYFFTQQFIKIRINESLKIMVSNFPISTPTIIELKNVLITSSMPR 300

Query: 310 --------KDFKDYTNI--------VTTFLSDFKKHILNPSITTVDALLSYVKTIKAFLV 353
                     F+D TN+        V  FL DF++  LNP I T+  + + VK   +FL+
Sbjct: 301 ENVSTTATTTFRD-TNLSEEYLKLFVKKFLKDFQRKFLNPCIPTIPLIRALVKMTNSFLI 359

Query: 354 LDPTGRCLHSITTFVKPYFQER-KHLVNVLLYAILDLPEEEL-KEKISFKVDMKALLLLV 411
           LDP G+ L +I   +KP  Q R   +VN+LLYA+L+L E EL K   +   D+++  +LV
Sbjct: 360 LDPRGQLLTTIILTLKPLIQRRTTDIVNILLYAMLNLNEMELHKLGCNIDFDIESFNILV 419

Query: 412 ETLHDSDIDQI----------------TNTPKSKDKNKGGSFPWNLHVKGKKEKNGSSSI 455
             L+ + I  +                T T  S ++      P+  +VK     N    +
Sbjct: 420 SELYPTIIKSMNQNQNNPSVVPYTTAGTGTTCSNERITNDDIPYQ-NVKDMANANTMEYL 478

Query: 456 T----QSMLYEHILNYYLTWVPEPNDMIPGNIK--------SSSIKT-NLFEVLLDLXXX 502
                ++  +  +   YL WVP  N +     K        +S I++ +  + L      
Sbjct: 479 ARRKPETKPFFDLFKQYLEWVPPMNKIYDSTSKNTVVDDEETSRIRSRHAIDYLFRFFDS 538

Query: 503 XXXXXXXXXNLLTDRLFTLK-FYKLDNKWSRCLKLIREKIVKSTETNQTNYIANGIIGLP 561
                     LLT++    K +Y LDN W  CL L++EK      +N +N          
Sbjct: 539 IDLLLSEYLKLLTEKFIHSKNYYTLDNNWLWCLNLLKEK------SNSSN---------- 582

Query: 562 QTTAPAADADLSNINSIDVMLWDIKCS-----EELCLKMHEVAGLDPAIYPKFISLLYWK 616
               P  +   S IN+ID+ML D+K S     ++   K + +   D   YPK +S LYWK
Sbjct: 583 ---VPDENVK-STINTIDIMLNDMKRSASYGKDKKHTKENNMVQGDIGFYPKEVSKLYWK 638

Query: 617 HNGDTNNANELTFHLPGNLENELQ-------------KYSDIYSQL-KPGRKLQLCKDQG 662
            N  + N  +   ++ G+  + L+             K +  +++L + G+K++L KD+ 
Sbjct: 639 IN--STNIAKWRMNMKGDFFHLLKYSKTAEPNHTMDIKLNRFFNELGRKGKKMELYKDKS 696

Query: 663 KIEMELDFNDGRKLVLD-VSLEQCSVINQFNSTDGEPIYLSLE-QLSEPLNIAPARLLDL 720
            +EM++ F+DGR+L  D +++EQ  V++ F    G    L         L     +L + 
Sbjct: 697 LMEMKISFDDGRELFFDNITIEQYDVLSLFTVEKGAAFTLEKAYDFFSGLKRGKQKLEEC 756

Query: 721 LNFWIQRGV--LSEENGVYSVIEYSRTDF-----------NQTQIEFPMKNENNNNELRD 767
           + FW+ + V  L +++G Y V+E  R  F            +T I+   +   +++ +++
Sbjct: 757 IQFWVDKKVLYLDDDDGCYKVLE--RLTFLDEIKQRKKMQEETVIKSDARMGIDHDYVQE 814

Query: 768 ETE----------------VERKCELILERSLPFIEGMLANLGAMKLNKIHSFLKITVPK 811
             E                   + + IL+R  PFI GML NLG+MKL KIHSFLK+TVP+
Sbjct: 815 AAEDDDIAGFETHKDVISRANDEIKNILDRIFPFINGMLENLGSMKLEKIHSFLKMTVPR 874

Query: 812 NWGYNRITLLQLEKYLNVLADEGKLKYITNGSYELEK 848
           ++ YNRI + QLE YLN L ++ KL+  T+G+++  K
Sbjct: 875 DFEYNRIAIHQLENYLNGLVEDEKLETTTDGAFKKPK 911

>KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]
           {ON} weakly similar to uniprot|Q7LGV7 Saccharomyces
           cerevisiae YLR127C
          Length = 697

 Score =  210 bits (535), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 188/760 (24%), Positives = 339/760 (44%), Gaps = 104/760 (13%)

Query: 16  DELQTLSSYIF---HTNITDDLNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLFPNNAC 72
           DEL+ L   I     +N+ ++++ +L W++P       Q + P+LRIK  +K +   +  
Sbjct: 6   DELKLLHEKILLNLASNLEEEVDMVLAWLNP-----TFQPQIPTLRIKQCLKVVLEQSDE 60

Query: 73  TSSYGAMNTAQANNSIVNEGNTNKELQLQFISTFKEYYIFQVRYHFFLHFSSINYLKDIQ 132
            + +                              ++YY+  +R HFFL F  I   KD+ 
Sbjct: 61  RTRF----------------------------LIEQYYLTLIRTHFFLQFDDIVNWKDMI 92

Query: 133 RWENYYEFPLRYVSIFDLNVNGWTLELNSLRHYLLNRNTKFKNNLRTRLNKLIIDDDFDL 192
           + E  Y   + +  +F  +V     E+ S +  L+ +N +F+  L  +L   I+D+D   
Sbjct: 93  KLEKLYISKVEF--MFGTSVYWIKEEMISFKRLLMKKNNEFRKQLHAKLESHILDNDLVR 150

Query: 193 ASNLIRWLNSA-NGSLSSMDL-IVNALFDKISMFCEINMSGVWNKRFMIMETFNKFINQY 250
              + +WL  A +G     ++ I+N   D++S      M    + R+++M T+N FI  +
Sbjct: 151 FDQMYQWLAPAFDGQEIEFNVRIINLKVDQMSQKL---MKNKIDDRYLVMNTYNHFIKDF 207

Query: 251 WSQFSELIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKITLLELKKIM- 309
           WS+FS+L+   EDDHELT  ++  FE N+++ +  E +   V  +P S+  LLEL+ I+ 
Sbjct: 208 WSKFSKLL-IIEDDHELTAIIYQSFEKNYIKYKCDEFYTDIVPKFPASRKCLLELRSILN 266

Query: 310 KDFKDY-TNIVTTFLSDFKKHILNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTFV 368
           KD K   T ++ T    F    L  S+ T + L  Y+KT+K   ++DP G CL S++  V
Sbjct: 267 KDIKTVGTKVLETLYHGFVSRFLTSSLLTCEILYYYIKTVKCLKIIDPMGICLRSLSKAV 326

Query: 369 KPYFQERKHLVNVLLYAILDLPEEELKEKISFKVDMKALLLLVETLHDSDIDQITNTPKS 428
           + Y   R  ++  LL  I      E + KI+   D  ++ L        ++   +  P+ 
Sbjct: 327 RVYLNPRPDIIKTLLLGIFPFQNNE-RFKIASSTDGSSVHLEKLEQFSREVGDFSMGPEL 385

Query: 429 KDKNKGGSFPW-NLHVKGKKEKNGSSSITQSMLYEHILNYYLTWVPEPNDM------IPG 481
                  + PW N     +   +G          + +L  YL WVPEP  +         
Sbjct: 386 -----PTALPWFNQPHLPRCTYDGD---------DQLLKQYLNWVPEPPRIKLDVEDFAD 431

Query: 482 NIKSSSIKTNLFEVLLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDNKWSRCLKLIREKI 541
           N        +L  VLLD+             +++ +    + Y LD +W R + +     
Sbjct: 432 NDGKYVPPVDLIHVLLDVLESKRTLVDDLLGVVSGKFIESEEYSLDPEWQRIMDI----- 486

Query: 542 VKSTETNQTNYIANGIIGLPQTTAPAADADLSNINSIDVMLWDIKCSEELCLKMHEVAGL 601
                      I N + G  + T  + +ADL+++N +D+ML D++ S +   ++      
Sbjct: 487 -----------ILNHLEGTRKGTVTSEEADLTHLNDVDIMLEDLRLSSQFRNQVAHKNNS 535

Query: 602 DPAIYP--KFISLLYWKHNGDTNNANELT-FHLPGNLENELQKYSDIYSQLKPGRKLQL- 657
               +P  K +S LYW+H  + N     T +     +E  +QK + +Y +L  GR L+  
Sbjct: 536 HFENFPHIKILSKLYWRHYQNLNGRLVTTKYKWDSEMEPLIQKLTKVYERLNTGRTLKFD 595

Query: 658 CKDQGKIEMELDFNDGRKLVLDVSLEQCSVINQF-NSTDGE--PIYLS------------ 702
                ++ + +    G +    V++EQ  VI+ F N T+G   P  ++            
Sbjct: 596 TGSSSRVSINIVTKSGERRFFKVTMEQYLVISHFQNETNGRNAPGMMADCNYVIPERRYT 655

Query: 703 LEQLSEPLNIAPARLLDLLNFWIQRGVLSEE-NGVYSVIE 741
           L+ L +  ++   ++LD+L+FW Q+ ++++  +  YSV E
Sbjct: 656 LKDLHKMTSMPRQKILDILSFWQQKEIVTKHSDDSYSVQE 695

>KLTH0H11176g Chr8 complement(957667..959991) [2325 bp, 774 aa] {ON}
           weakly similar to uniprot|P47050 Saccharomyces
           cerevisiae YJL047C RTT101 Cullin family member subunit
           of a complex containing ubiquitin ligase activity binds
           HRT1 and is modified by the ubiquitin like protein RUB1
           Regulator of Ty1 Transposition Regulator of Ty1
           Transposition
          Length = 774

 Score = 40.0 bits (92), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 65/126 (51%), Gaps = 9/126 (7%)

Query: 631 LPGNLENELQKYSDIYSQLKP---GRKLQLCKDQGKIEMELDFN--DGRKLVLDVSLEQC 685
           +P +L+   QK+   Y++  P    + L L      +E++ +F   DGR L+L+++L Q 
Sbjct: 560 IPRSLDALWQKFCAFYAESDPRSTKKPLVLQNMLHHLEVQTNFKLEDGRPLMLELTLLQA 619

Query: 686 SVINQFNSTDGEPIYLSLEQLSEPLNIAPARLLDLLNFWIQRGVLSEENGVYSVIEYSRT 745
           S+++ FN + GE   L++  +   L +A   L   L  +I  G+L+ + G + V E  + 
Sbjct: 620 SILDLFNES-GE---LTVRDIESELGVAANILEPALTSFISAGLLNTDGGSFIVNEEFKP 675

Query: 746 DFNQTQ 751
           D  + +
Sbjct: 676 DIKKMK 681

>AFR617C Chr6 complement(1549456..1551771) [2316 bp, 771 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL047C
           (RTT101) and YBR259W
          Length = 771

 Score = 36.2 bits (82), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 663 KIEMELDFNDGRKLVLDVSLEQCSVINQFNSTDGEPIYLSLEQLSEPLNIAPARLLDLLN 722
           +IE      D R L LDV++ Q  +++ FN+ D     +SL+ +S    I  A L   ++
Sbjct: 600 EIETPFLLKDNRNLTLDVTMVQACILDMFNNQDS----VSLDDVSNKYGIQVAELKTAMD 655

Query: 723 FWIQRGVLSEENGVYSV 739
            ++   ++  E G Y++
Sbjct: 656 SFVSINMMKCEGGQYTI 672

>NCAS0B07310 Chr2 (1381759..1383663) [1905 bp, 634 aa] {ON}
           Anc_1.344 YBR259W
          Length = 634

 Score = 35.4 bits (80), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 52/99 (52%), Gaps = 9/99 (9%)

Query: 643 SDIYSQLKPGRKLQLCKDQGKIEME--LDFNDGRKLVLDVSLEQCSVINQFNSTDGEPIY 700
           S+  S LK  ++L+       IEM   ++ ++GR L L ++    +++NQFN  D E I 
Sbjct: 518 SERQSMLKESKQLEGAFRFNVIEMSSPIELDNGRGLTLIINFTTAAILNQFN--DFETI- 574

Query: 701 LSLEQLSEPLNIAPARLLDL---LNFWIQRGVLSEENGV 736
            +++ L + LN+   +  D    L   I+ G++ E+ GV
Sbjct: 575 -TVDSLEKKLNVTQDQYADFSVNLKKLIRYGLIKEKKGV 612

>Ecym_2336 Chr2 complement(652787..655114) [2328 bp, 775 aa] {ON}
           similar to Ashbya gossypii AFR617C
          Length = 775

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 85/199 (42%), Gaps = 19/199 (9%)

Query: 631 LPGNLENELQKYSDIYSQLKPG--RKLQLCKDQGKIEMELDFNDGRKLVLDVSLEQCSVI 688
           LP +L+  L++ + + +        + Q      ++E    F D  K +LDV++ Q  ++
Sbjct: 570 LPADLQKTLEELNSLRTNSSSPIVTQSQFALHHLEVETPFTFPDNSKFILDVTMVQACIL 629

Query: 689 NQFNSTDGEPIYLSLEQLSEPLNIAPARLLDLLNFWIQRGVLSEENGVYSVIEY------ 742
           + FN  D     ++++Q+S    I    L   +  ++  G++ +    Y  ++Y      
Sbjct: 630 DYFNDLDQ----ITVDQVSRRYGIEDFELTMAMESFVSIGMVKKVGNNYR-LDYNFTPKG 684

Query: 743 SRTDFNQTQIEFPMKNENNNNELRDETEVERKCELILERSLPFIEGMLA--NLGAMKLNK 800
           S +   + ++ +  K    + E RD T         L R+L + +  +    L A  LN+
Sbjct: 685 SASSSGKRRVPYSGKRRLKSVEKRDSTWKIEILRAALIRTLKYGQRHMTFNELKAEILNQ 744

Query: 801 IHSF----LKITVPKNWGY 815
           I  F    LKI V K+  Y
Sbjct: 745 ISGFSVGELKIAVDKSKDY 763

>TPHA0A00880 Chr1 complement(172938..175088) [2151 bp, 716 aa] {ON}
           Anc_3.151 YOL068C
          Length = 716

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 66/138 (47%), Gaps = 13/138 (9%)

Query: 256 ELIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKITLLELKKIMKDFKDY 315
           +L+G    D +L + +++C +   L++  ++  D+    +       L+ K+IM+ FKD+
Sbjct: 261 KLMGYEIRDLDLLSRIYDCTDVQSLQLTAEDQDDVIYNNFDDP----LDQKQIMRIFKDF 316

Query: 316 TNIVTTFL-SDFKKHILNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTFVKPYFQE 374
             +VT  L SDF+     P+  T  +L+  ++  K  +VL   G      T+   P F+ 
Sbjct: 317 QMVVTRVLHSDFRI----PTYLTTSSLVDILERSKNIIVLTGAGIS----TSLGIPDFRS 368

Query: 375 RKHLVNVLLYAILDLPEE 392
            +   + +    LD P++
Sbjct: 369 SQGFYSQIKNLGLDDPQD 386

>SAKL0D07458g Chr4 complement(612471..614822) [2352 bp, 783 aa] {ON}
           some similarities with uniprot|P47050 Saccharomyces
           cerevisiae YJL047C RTT101 Cullin family member subunit
           of a complex containing ubiquitin ligase activity binds
           HRT1 and is modified by the ubiquitin like protein RUB1
           Regulator of Ty1 Transposition Regulator of Ty1
           Transposition
          Length = 783

 Score = 33.5 bits (75), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 52/114 (45%), Gaps = 9/114 (7%)

Query: 631 LPGNLENELQKYSDIYSQLKPGRKLQLCKDQG-----KIEMELDFNDGRKLVLDVSLEQC 685
           LP +L +   ++ + Y+ L P  K +    Q      ++  E   ++ + L+L+V+L Q 
Sbjct: 569 LPQHLSDVWNEFLNHYNSLDPNSKKKTIMPQYTLHHLEVGTEFKLSENQYLILEVNLLQS 628

Query: 686 SVINQFNSTDGEPIYLSLEQLSEPLNIAPARLLDLLNFWIQRGVLSEENGVYSV 739
            ++  FN  D     LS  ++   L +    L   L  + + G+L   NG+Y +
Sbjct: 629 CILELFNDADT----LSFSKIKLTLQVDGFHLSQALRSFSEIGLLHSRNGIYKL 678

>TPHA0H01920 Chr8 (450069..453008) [2940 bp, 979 aa] {ON} Anc_6.266
           YMR185W
          Length = 979

 Score = 33.5 bits (75), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 68/152 (44%), Gaps = 15/152 (9%)

Query: 101 QFISTFKEYYIFQVRYHFFLHFSSINYLKDIQRWEN-------YYEFPLRYVSIFDLNVN 153
            FI+ +KE + F +    +  F   +++K   R++N       YYE  L  +  + LN+ 
Sbjct: 385 HFITNYKENHQFYLNLWIYALFLKNSHIKKPLRYDNNGLKDSSYYEIILSLIKSY-LNIT 443

Query: 154 GWTLELNSLRHYLLN---RNTKFKNNLRTRLNKLIIDDDFDLASNLIRWLNSANGSLSSM 210
           G    LN++   L N    + K++ +L T L  +++D   D+  +L     S    L+ +
Sbjct: 444 GDFGALNTIYLNLANYQHADWKYQIDLETNLAYIVVDKQQDVKEDLRITTESDTDKLTKV 503

Query: 211 DLIVNALFDKISMFCE----INMSGVWNKRFM 238
             +   + D I +F E    +N+  V    F+
Sbjct: 504 TKVFQEMDDGIDLFIEFLKLLNIDDVTTNTFL 535

>SAKL0H02640g Chr8 complement(263084..263611) [528 bp, 175 aa] {ON}
           no similarity
          Length = 175

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 44/104 (42%), Gaps = 13/104 (12%)

Query: 252 SQFSELIGCPEDD---HELTTTVFNCFESNFLRIRTK----------EIFDICVLAYPGS 298
           SQF+E  G PE     + L T++ +    +F+ I+            E   IC +  P  
Sbjct: 9   SQFAEKYGIPETVLSLYMLNTSIHSISRESFMAIKESKKRKWHETEPESKRICGIVPPAY 68

Query: 299 KITLLELKKIMKDFKDYTNIVTTFLSDFKKHILNPSITTVDALL 342
            I   +   IM D  D+ +   +   D + H +  S + VD+L+
Sbjct: 69  TIPRCDTSLIMSDITDHMSGAQSLTLDMESHDILQSDSQVDSLI 112

>Kwal_0.70 s0 complement(30290..32608) [2319 bp, 772 aa] {ON}
           YJL047C (RTT101) - Regulator of Ty1 Transposition
           [contig 76] FULL
          Length = 772

 Score = 32.3 bits (72), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 54/99 (54%), Gaps = 11/99 (11%)

Query: 642 YSDIYSQLKPGRKLQLCKDQG---KIEMELDF--NDGRKLVLDVSLEQCSVINQFNSTDG 696
           +++ Y++ +P    +L   Q     +E+E +F  +DG  LVL+++L Q S++  FN    
Sbjct: 563 FTEFYARSEPKADKKLLTLQNTLHHLEVETNFKLDDGSYLVLELTLLQTSILELFN---- 618

Query: 697 EPIYLSLEQLSEPLNIAPARLLDLLNFWIQRGVL--SEE 733
           E   LS  ++   LN++ A L   L  +I+ G+L  SEE
Sbjct: 619 EHKELSSLEIGSYLNVSGATLEVALESFIEVGLLETSEE 657

>NCAS0I01760 Chr9 (325595..326779) [1185 bp, 394 aa] {ON} Anc_3.244
           YBR042C
          Length = 394

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 12/64 (18%)

Query: 232 VWNKRFMIMETFNKFINQYWSQFSELIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDIC 291
           VW ++ +++E + K+            GC   D +L+T+V N F+ N L      +  IC
Sbjct: 333 VWQEKDLLLENYYKY------------GCFHQDEKLSTSVVNSFKINPLEFYGALLLPIC 380

Query: 292 VLAY 295
            L +
Sbjct: 381 TLMF 384

>YPL048W Chr16 (464401..465648) [1248 bp, 415 aa] {ON}  CAM1Nuclear
           protein required for transcription of MXR1; binds the
           MXR1 promoter in the presence of other nuclear factors;
           binds calcium and phospholipids; has similarity to
           translational cofactor EF-1 gamma
          Length = 415

 Score = 31.6 bits (70), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 10/72 (13%)

Query: 139 EFPLRYVSIFDLNVNGWTL-ELNSLRHYL--LNRNTKFKNNLRTRLNKLIIDDDFDLASN 195
           +FPL+ V  F +   G+ L E  ++ +YL  L+++ K K  L      L  DDD +  + 
Sbjct: 43  DFPLKKVPAF-VGPKGYKLTEAMAINYYLVKLSQDDKMKTQL------LGADDDLNAQAQ 95

Query: 196 LIRWLNSANGSL 207
           +IRW + AN  L
Sbjct: 96  IIRWQSLANSDL 107

>Suva_16.267 Chr16 (467433..468662) [1230 bp, 409 aa] {ON} YPL048W
           (REAL)
          Length = 409

 Score = 31.6 bits (70), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 56/122 (45%), Gaps = 25/122 (20%)

Query: 139 EFPLRYVSIFDLNVNGWTL-ELNSLRHYL--LNRNTKFKNNLRTRLNKLIIDDDFDLASN 195
           +FPL+ V  F +  NG+ L E  ++ +YL  L+R+ K K  L      L  +DD +  + 
Sbjct: 43  DFPLKKVPAF-VGPNGFKLTEAMAINYYLVKLSRDEKMKAQL------LGAEDDLNAQAQ 95

Query: 196 LIRWLNSAN---------------GSLSSMDLIVNALFDKISMFCEINMSGVWNKRFMIM 240
           +IRW + AN               G +      V+A  D I+   +I  + + N  +++ 
Sbjct: 96  IIRWQSLANNDFCIQMVNAVAPLKGDVPYNKKNVDAAMDAIAKMVDIFDARLKNNTYLVT 155

Query: 241 ET 242
           E+
Sbjct: 156 ES 157

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 100,982,717
Number of extensions: 4932523
Number of successful extensions: 17556
Number of sequences better than 10.0: 80
Number of HSP's gapped: 17958
Number of HSP's successfully gapped: 85
Length of query: 854
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 736
Effective length of database: 39,950,811
Effective search space: 29403796896
Effective search space used: 29403796896
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)