Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_10.1758.266ON29929915280.0
Skud_12.1598.266ON29429711931e-166
Smik_12.1508.266ON29229711581e-160
YLR091W (GEP5)8.266ON29329711341e-157
TDEL0F039308.266ON2802893482e-38
NDAI0B020108.266ON2812892897e-30
SAKL0H16940g8.266ON3033012705e-27
KAFR0B027408.266ON2562852581e-25
NCAS0B050408.266ON2732872538e-25
Kwal_56.237778.266ON2672502467e-24
KLTH0G13596g8.266ON2672242414e-23
ZYRO0C01562g8.266ON2772742391e-22
Kpol_392.48.266ON2812932363e-22
Ecym_43048.266ON2892881793e-14
AGR082C8.266ON2662771773e-14
KLLA0F19228g8.266ON3052271688e-13
KNAG0G020608.266ON2862951572e-11
TPHA0J007608.266ON249109920.003
CAGL0H04609g7.418ON276377741.2
Skud_12.3606.74ON77945711.9
CAGL0L12320g8.266ON27843683.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_10.175
         (299 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W...   593   0.0  
Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W...   464   e-166
Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W...   450   e-160
YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protei...   441   e-157
TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.26...   138   2e-38
NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.26...   115   7e-30
SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa] ...   108   5e-27
KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.26...   103   1e-25
NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.26...   102   8e-25
Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {O...    99   7e-24
KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa] ...    97   4e-23
ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {O...    97   1e-22
Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON} com...    96   3e-22
Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON} ...    74   3e-14
AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON} Sy...    73   3e-14
KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON} conse...    69   8e-13
KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.26...    65   2e-11
TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.2...    40   0.003
CAGL0H04609g Chr8 complement(433499..441790) [8292 bp, 2763 aa] ...    33   1.2  
Skud_12.360 Chr12 complement(638225..640564) [2340 bp, 779 aa] {...    32   1.9  
CAGL0L12320g Chr12 (1332269..1333105) [837 bp, 278 aa] {ON} weak...    31   3.9  

>Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W
           (REAL)
          Length = 299

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/299 (96%), Positives = 288/299 (96%)

Query: 1   MISQANSLLLPFIDSLPLHQITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQ 60
           MISQANSLLLPFIDSLPLHQITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQ
Sbjct: 1   MISQANSLLLPFIDSLPLHQITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQ 60

Query: 61  DLRTSLKALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGK 120
           DLRTSLKALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGK
Sbjct: 61  DLRTSLKALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGK 120

Query: 121 LISLTSKGNWLKADWTTLFQVKNPWVRTXXXXXXXXXXXAQNSIAELDAFTAERTFLVKS 180
           LISLTSKGNWLKADWTTLFQVKNPWVRT           AQNSIAELDAFTAERTFLVKS
Sbjct: 121 LISLTSKGNWLKADWTTLFQVKNPWVRTPPPPPSPSLSLAQNSIAELDAFTAERTFLVKS 180

Query: 181 LGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFV 240
           LGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFV
Sbjct: 181 LGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFV 240

Query: 241 ENPPLSTANELALMTVFDDGTLERRHTRLYMRACARAYTIANADSDNEPLTFRCTHWVD 299
           ENPPLSTANELALMTVFDDGTLERRHTRLYMRACARAYTIANADSDNEPLTFRCTHWVD
Sbjct: 241 ENPPLSTANELALMTVFDDGTLERRHTRLYMRACARAYTIANADSDNEPLTFRCTHWVD 299

>Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W
           (REAL)
          Length = 294

 Score =  464 bits (1193), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 229/297 (77%), Positives = 247/297 (83%), Gaps = 4/297 (1%)

Query: 1   MISQANSLLLPFIDSLPLHQITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQ 60
           M S+   +LLPFI+SLPLH+ITKTALTT L  I SD+KFKEIAVPLTESLQVYEKAQR Q
Sbjct: 1   MTSRIKGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQ 60

Query: 61  DLRTSLKALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGK 120
           DLRTSLKALESI++QTHFQWNNPRPRHA LFQKH++FLLSHWPFENHRSLVDSI A NGK
Sbjct: 61  DLRTSLKALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGK 120

Query: 121 LISLTSKGNWLKADWTTLFQVKNPWVRTXXXXXXXXXXXAQNSIAELDAFTAERTFLVKS 180
           L S+ SKG WLKADWTTLFQVKN WV+T           A +  A LDAFT ERTFLV S
Sbjct: 121 LNSMASKGTWLKADWTTLFQVKNTWVQT----PPASTSPAYHGGANLDAFTPERTFLVNS 176

Query: 181 LGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFV 240
           LGNHYKFLV NSHLSYNHKKYP P VQIPIRNALGE+S  KQI+KLF+RQL QIYTSLFV
Sbjct: 177 LGNHYKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFV 236

Query: 241 ENPPLSTANELALMTVFDDGTLERRHTRLYMRACARAYTIANADSDNEPLTFRCTHW 297
           ENPPLS  NELALM VF D +L+RRH RLYMRACARAYT  N+DS  EPLTFRCT W
Sbjct: 237 ENPPLSADNELALMAVFHDDSLDRRHKRLYMRACARAYTTVNSDSTIEPLTFRCTQW 293

>Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W
           (REAL)
          Length = 292

 Score =  450 bits (1158), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 220/297 (74%), Positives = 242/297 (81%), Gaps = 7/297 (2%)

Query: 1   MISQANSLLLPFIDSLPLHQITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQ 60
           M S+ N LLLP I S+PLHQITK AL T LTD  SD+KFKEIAVPLT+ LQV+EKAQR Q
Sbjct: 1   MASRVNDLLLPVIQSIPLHQITKNALVTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQRRQ 60

Query: 61  DLRTSLKALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGK 120
           DLRT+LKALESI+YQTHF+WNNPRPRHA LFQKHYHFLL+HWPFENHR LVDSI A  GK
Sbjct: 61  DLRTALKALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGK 120

Query: 121 LISLTSKGNWLKADWTTLFQVKNPWVRTXXXXXXXXXXXAQNSIAELDAFTAERTFLVKS 180
           L S+ SK  WLKADW TLFQVKNPWV+T              S  +LDAFT ER FLV S
Sbjct: 121 LNSIPSKTTWLKADWATLFQVKNPWVQTPPTPKNL-------SETDLDAFTPERAFLVNS 173

Query: 181 LGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFV 240
           LGN YKFL+ NSHLSYNHKKYPSP VQIPIRNALGE+SPPKQIS+LF+RQLA IYTSLF 
Sbjct: 174 LGNQYKFLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFE 233

Query: 241 ENPPLSTANELALMTVFDDGTLERRHTRLYMRACARAYTIANADSDNEPLTFRCTHW 297
           ENPPLS AN++ALM +F+D T++RR  RLYMRACARAYTI NADS  EPLTFRCT W
Sbjct: 234 ENPPLSPANDIALMAIFNDKTMDRRFKRLYMRACARAYTITNADSTIEPLTFRCTQW 290

>YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protein
           of unknown function, required for mitochondrial genome
           maintenance; detected in highly purified mitochondria in
           high-throughput studies; null mutant has decreased
           levels of cardiolipin and phosphatidylethanolamine
          Length = 293

 Score =  441 bits (1134), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 215/297 (72%), Positives = 235/297 (79%), Gaps = 7/297 (2%)

Query: 1   MISQANSLLLPFIDSLPLHQITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQ 60
           M SQ N+LLLP I+S PLHQITK ALTT LT   SD+KFKEIAVPLT+SLQ+YEKAQR Q
Sbjct: 1   MASQVNALLLPVIESTPLHQITKVALTTTLTSKQSDYKFKEIAVPLTKSLQLYEKAQRRQ 60

Query: 61  DLRTSLKALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGK 120
           DLR SLKALESI+YQTHFQWNNP PRHAHLFQKHYHFLL+HWPFENHR LVDSI   NGK
Sbjct: 61  DLRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGK 120

Query: 121 LISLTSKGNWLKADWTTLFQVKNPWVRTXXXXXXXXXXXAQNSIAELDAFTAERTFLVKS 180
           L S +S+  WLKADW TLF VKNPWV+T              S  +LD FT ER FL+ S
Sbjct: 121 LNSTSSRSVWLKADWITLFNVKNPWVQTPPSLMRL-------SGTDLDTFTPERIFLINS 173

Query: 181 LGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFV 240
           LGNHYKFL+ NSHLSYNHKKYPSP VQIP+RNALGE+SP KQI++LFARQL+ IY SLF+
Sbjct: 174 LGNHYKFLIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFI 233

Query: 241 ENPPLSTANELALMTVFDDGTLERRHTRLYMRACARAYTIANADSDNEPLTFRCTHW 297
           ENPPLS  NELAL  VF D T+ERR  RLYMRACARAYT  NADS  EPL F CT W
Sbjct: 234 ENPPLSPENELALTAVFYDETVERRLRRLYMRACARAYTTTNADSTTEPLMFHCTRW 290

>TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.266
           YLR091W
          Length = 280

 Score =  138 bits (348), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 94/289 (32%), Positives = 139/289 (48%), Gaps = 31/289 (10%)

Query: 1   MISQANSLLLPFIDSLPLHQITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQ 60
           M  Q    LL  ++ LPLH  T   L  +L       + K + +PL + +   E + RA+
Sbjct: 1   MTQQLVQPLLKALEKLPLHSKTLDLLACKL----KGDELKTVIIPLAKLVSNLE-SSRAE 55

Query: 61  DLRTSLKALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGK 120
             R  +KALESI+Y THF W +P P H  +FQ HY  +L HWP+E HRS+++    ++  
Sbjct: 56  TQR--IKALESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTS 113

Query: 121 LISLTSKGNWLKADWTTLFQV---KNPWVRTXXXXXXXXXXXAQNSIAELDAFTAERTFL 177
           L     +  W  +  T L      KNPW+              +++I        +R  L
Sbjct: 114 L-----RYRWEDSSKTVLSMAEYSKNPWI--------------EDNILSKKLTIIQRDLL 154

Query: 178 VKSLGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTS 237
             S+ +HY FL  N  L  N +  P P+V+IP+R  LG      +I  LF  ++A  Y  
Sbjct: 155 FHSVFSHYLFLKANPRLCNNGRNLPIPIVEIPMR-PLGNDIAVSRIKNLFKSKVAHTYRI 213

Query: 238 LFVENPPLSTANELALMTVFDDGTLERRHTRLYMRACARAYTIANADSD 286
           L +ENP LS  +E  L  +  D +  R+  RLY  +C RAY +   D +
Sbjct: 214 LAIENPVLSRGSENILSEIISDAS-SRKQRRLYQASCKRAYVMEYDDGE 261

>NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.266
           YLR091W
          Length = 281

 Score =  115 bits (289), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 90/289 (31%), Positives = 133/289 (46%), Gaps = 31/289 (10%)

Query: 3   SQANSLLLPFIDSLPLHQITKTALTTRL--TDIHSDFKFKEIAVPLTESLQVYEKAQRAQ 60
           S+    LL  + +LPLH  T   L  +    +I +   FK   +PL   +  YEKAQ + 
Sbjct: 6   SKLTKTLLSSLQNLPLHSNTLAQLERKCLTRNIKATKSFK---IPLLTLINSYEKAQASG 62

Query: 61  DLRTSLKALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGK 120
             + S K LESI+Y T+F+W N    H   FQ+ Y  LL+ WP   H S +DS       
Sbjct: 63  QSKLSNKTLESIIYHTYFEWTNDLASHLKPFQRQYSTLLTFWPHIYH-SKIDS------- 114

Query: 121 LISLTSKGNWLKADWTTLFQVKNPWVRTXXXXXXXXXXXAQNSIAELDAFTAERTFLVKS 180
                 K N +   W      KN                 Q+ + +   F      + K 
Sbjct: 115 ------KKNSIILTWNKSSNSKN-----MLRELLSHLNYTQSLVPQKKDFQV----IFKK 159

Query: 181 LGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFV 240
           +  HY FL  N  L  N K+ PSP+V+IP+ NA+G   P K+I+ L   ++A+ +  L +
Sbjct: 160 IYQHYIFLSLNPSLCSNGKRLPSPIVEIPM-NAMGYDIPKKRINNLLRSKIARTWNYLAI 218

Query: 241 ENPPLSTANELALMTVFDDGTL--ERRHTRLYMRACARAYTIANADSDN 287
            NP L+  NE  L  + +  +    R+  +LY RAC+ +Y I N D +N
Sbjct: 219 TNPILNLENEAQLDEIINGSSAIKSRQLRKLYRRACSNSYVIKNEDDNN 267

>SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 303

 Score =  108 bits (270), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 91/301 (30%), Positives = 127/301 (42%), Gaps = 43/301 (14%)

Query: 9   LLPFIDSLPLHQITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQDLRTS--L 66
           LL F++ LPL         TR  D+       E  V L  S  +    Q+  D + +   
Sbjct: 7   LLNFLECLPL--------DTRTLDL------LEGTVKLCSSALLDTLEQKLFDYQANENS 52

Query: 67  KALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGKLISLTS 126
           K+LE IVY T+F WNN  P H   F+++YH L  HWP+E HR L+     +   +  + +
Sbjct: 53  KSLEWIVYNTYFHWNNTTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWN 112

Query: 127 KGNWLKADWTTLFQVKNPWVRTXXXXXXXXXXXAQNSIAELDAFTAER------------ 174
             N  K   +++   +NPW R              N I    A   E+            
Sbjct: 113 DNN--KKVLSSMRFERNPWCRNDPLEQLNAFNV--NKILNYQALEEEKNRGSMLSTLPKI 168

Query: 175 -----TFLVKSLGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFAR 229
                T L   +  HY FL  N  L    KK P P+V+IP++  LG+  P  +I  LF R
Sbjct: 169 SQLELTLLFHEIFQHYMFLKRNPKLCKYGKKLPIPIVEIPMK-PLGQDIPLVRIRNLFKR 227

Query: 230 QLAQIYTSLFVENPPLSTANELALMTVF-----DDGTLERRHTRLYMRACARAYTIANAD 284
           + A  +  L  ENP LS  NE  L+ +            R+  RLY RAC  +Y I    
Sbjct: 228 KAAATWKLLAEENPVLSLENEALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYVICEDR 287

Query: 285 S 285
           S
Sbjct: 288 S 288

>KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.266
           YLR091W
          Length = 256

 Score =  103 bits (258), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 81/285 (28%), Positives = 130/285 (45%), Gaps = 52/285 (18%)

Query: 13  IDSLPLHQITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQDLRTSLKALESI 72
           I+ LPLHQ  KT L  + T   +D     +A+PL   +  YE   ++       K LESI
Sbjct: 24  IEGLPLHQ--KTLLQLQDTLKRND----ALAIPLLRDVVSYETTGKS-------KFLESI 70

Query: 73  VYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGKLISLTSKGNWLK 132
           +Y+ +FQW N  P H       Y  L S+WP E H    ++ P    + ISL        
Sbjct: 71  IYRLYFQWLNEVPSHLKPLLNQYEHLKSNWPIERHIKFKNAEP----EAISL-------- 118

Query: 133 ADWTTLFQVKNPWVRTXXXXXXXXXXXAQNSIAELDAFTAERTFLVKSLGNHYKFLVTNS 192
                    +N W+R              N    +D  T++   ++K + NH+++L  N 
Sbjct: 119 ---------RNAWMR--------------NKATAVDLSTSD--GVIKPILNHFRYLRVNE 153

Query: 193 HLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFVENPPLSTANELA 252
                 KK   P++++P+ N  G   P  +++ L  +++A +  SL  +NP LS   E  
Sbjct: 154 D-RLCKKKVGLPILEVPL-NVFGTEIPECRVNNLLKKRIAHVKKSLLEDNPMLSPKLEDT 211

Query: 253 LMTVFDDGTLERRHTRLYMRACARAYTIANADSDNEPLTFRCTHW 297
           L ++ +D    R   R+Y+R+C+RAYT  +   D+  +TF    W
Sbjct: 212 LHSIINDSKNTRALKRVYLRSCSRAYTGESNPKDSSNITFHIIDW 256

>NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.266
           YLR091W
          Length = 273

 Score =  102 bits (253), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 81/287 (28%), Positives = 122/287 (42%), Gaps = 37/287 (12%)

Query: 1   MISQANSLLLPFIDSLPLHQITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQ 60
           M     + LL  + ++PLH+ T   L  ++   +         VPL + L  YE+    +
Sbjct: 1   MEKSVTTTLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQE 60

Query: 61  DLRTSLKALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSL---VDSIPAQ 117
           D R   K LESI Y T+F WNNP P H  +FQK+   L  +WP   HR +    DSI  Q
Sbjct: 61  DKRGIEKVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRGMDTKRDSIIVQ 120

Query: 118 NGKLISLTSKGNWLKADWTTLFQVKNPWVRTXXXXXXXXXXXAQNSIAELDAFTAERTFL 177
             K    ++ G+ L        Q                              +AE   +
Sbjct: 121 WAK----SNNGDALLKGTMNHIQ---------------------------PGASAEELLM 149

Query: 178 VKSLGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTS 237
            K +  HY FL  N+ ++ N K+   P+V +P+ N++GE  P  ++  LF ++++    +
Sbjct: 150 FKKIFQHYIFLTLNARITSNAKRLQPPLVGVPM-NSMGETIPQVRVKNLFRKKVSWTANA 208

Query: 238 LFVENPPLSTANELALMTVF--DDGTLERRHTRLYMRACARAYTIAN 282
           L   NP L+  N   L  +   D     R   RLY RA   A+ IA 
Sbjct: 209 LCALNPVLNVENHGFLDEIINADYENTSRSLRRLYQRASKNAHVIAG 255

>Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {ON}
           YLR091W - Hypothetical ORF [contig 173] FULL
          Length = 267

 Score = 99.4 bits (246), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 113/250 (45%), Gaps = 25/250 (10%)

Query: 37  FKFKEIAVPLTESLQVYEKAQRAQDLRTSLKALESIVYQTHFQWNNPRPRHAHLFQKHYH 96
            K  E  +   ESL+  E A R  + +   K LE+I++ T+F W N  P+H   F++HY+
Sbjct: 18  LKLIEKRLERAESLRFLELA-RQYEAKKDYKTLENIIHHTYFSWENEIPQHIKAFREHYN 76

Query: 97  FLLSHWPFENHRSLVDSIPAQNGKLISLTSKGNWLKADWTTLFQVKNPWVRTXXXXXXXX 156
            L   WP+E HR+++     ++  +  L S GN        +      W R         
Sbjct: 77  ELRDFWPYECHRTILGMQSPKSQSIRFLWSAGN--PRVLAAMRYGSYGWNREG------- 127

Query: 157 XXXAQNSIAELDAFTAERTFLVKSLGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGE 216
                  + EL     ERT     +  H+ FL     L  N K    P+V+IP++  LG+
Sbjct: 128 ---GGERLTEL-----ERTLRFHEIFQHFLFLQRRPQLCKNRKHLSVPIVEIPMK-PLGQ 178

Query: 217 ISPPKQISKLFARQLAQIYTSLFVENPPLSTANELALMTVFDDGTLERRHT------RLY 270
                +I  LF R++A ++  L V+NP LS  NE  LM + +   L +  T      RLY
Sbjct: 179 NIADVRIKNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQLPQGQTSSRMLKRLY 238

Query: 271 MRACARAYTI 280
            RAC  AY I
Sbjct: 239 QRACRGAYVI 248

>KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 267

 Score = 97.4 bits (241), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 109/224 (48%), Gaps = 28/224 (12%)

Query: 65  SLKALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGKLISL 124
           S K+LESIV+ T+F W N    H   F++HY  L  HWP+E HRS++             
Sbjct: 45  SSKSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSILSMD---------- 94

Query: 125 TSKGNWLKADWTTLFQVKNPWVRTXXXXXXXXXXXAQ--NSIAELDAFTAERTFLVKSLG 182
           T K   ++  W++     +P V +            +  + + EL     +RT     + 
Sbjct: 95  TPKTQSIRFLWSS----NSPKVLSKMSYEKYAHDTEERPSRLTEL-----QRTVQFHEVF 145

Query: 183 NHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFVEN 242
            H+ FL +  HL    K    P+V+IP++  LG+  P  ++  LF R++A ++  L +++
Sbjct: 146 QHFLFLKSRPHLCKTRKGLAVPIVEIPMK-PLGQNIPEVRVRNLFKRKIAYVWKVLALDS 204

Query: 243 PPLSTANELALMTVFD------DGTLERRHTRLYMRACARAYTI 280
           P LS  NEL+L  + D      D + +R   RLY RAC  AYTI
Sbjct: 205 PALSRQNELSLAKIIDSPQLPEDVSSKRELKRLYQRACRGAYTI 248

>ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {ON}
           weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 277

 Score = 96.7 bits (239), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 85/274 (31%), Positives = 125/274 (45%), Gaps = 32/274 (11%)

Query: 13  IDSLPLHQITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQDLRTSLKALESI 72
           I  LPLH  T+  L     +  S +K   +A  ++E    +EK           K LE++
Sbjct: 17  IRQLPLHIETQKVLEFYCRN--SSYKSLLVAQDISE----FEK-------HNDHKYLEAL 63

Query: 73  VYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGKLISLTSKGNWLK 132
           + +THF W+NP P     FQ ++  L +HWP+E  RSL+     +      L   G  L 
Sbjct: 64  IQKTHFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWRDGKELA 123

Query: 133 ADWTTLFQVKNPWVRTXXXXXXXXXXXAQNSIAELDAFTAERTFLVKSLGNHYKFLVTNS 192
              + L   K+ W               +N I  L     + T L+ S+ + Y FL +++
Sbjct: 124 L--SNLRFEKHRWA-------------DENIIERLSP--EQGTQLLHSIFHQYFFLKSHA 166

Query: 193 HLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFVENPPLSTANELA 252
            L YN++K P P+V+IP+R  +G      +I  LF R+ A ++  L  EN PLST NE  
Sbjct: 167 RLCYNNRKIPVPIVEIPLR-PMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNEQL 225

Query: 253 LMTVFDDGTLERRHTRLYMRACARAYTIANADSD 286
           L  +       R   RLY RA  RAY + N   D
Sbjct: 226 LGEIITKSE-TRSMRRLYQRASRRAYVVTNEGKD 258

>Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON}
           complement(4596..5441) [846 nt, 282 aa]
          Length = 281

 Score = 95.5 bits (236), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 81/293 (27%), Positives = 135/293 (46%), Gaps = 38/293 (12%)

Query: 8   LLLPFIDSLPLHQITKTALTTRLTDIH-SDFKFKEIAVPLTESLQVYEKAQRAQDLRTSL 66
           +LL  ++ LPLH+ T   L  R   IH +D  F E  V +   L  YE ++    +    
Sbjct: 14  ILLESLERLPLHKPTLDILERR---IHVADLPFMEEYVGI---LNEYEISKINSKVENES 67

Query: 67  KALESIVYQTHFQWNNPR-PRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGKLISLT 125
           +ALE IV +TH  WNN + P H   F+ HY  LL HWP+E H  +++      G LI L 
Sbjct: 68  RALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGSLIYLC 127

Query: 126 SKG-----NWLKADWTTLFQVKNPWVRTXXXXXXXXXXXAQNSIAELDAFTAERTFLVKS 180
                   N+ K+      Q+ N W                NS+ +      +R  +   
Sbjct: 128 LNNDDRFFNFYKS------QINNKWF---------------NSVDQYKLTDEQRVSIYND 166

Query: 181 LGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFV 240
           +     FL  ++ +S  +K    P+V++P++  +G   P  +I  LF +++  I+  L +
Sbjct: 167 IFKQIFFLKRHTTISEVNKNM-VPIVEVPLK-PIGCDIPACRIKNLFNKKVDYIWKLLSL 224

Query: 241 ENPPLSTANELALMTVFDDGTLERRHTRLYMRACARAYTIANADSDNEPLTFR 293
            +P +S ++E  +M + +D    RR  RLY R+   +Y     D++   +T+R
Sbjct: 225 SSPAISLSHEKIIMNILEDTKDNRRINRLYRRSLKNSYVF--DDTNPIEITYR 275

>Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON}
           similar to Ashbya gossypii AGR082C
          Length = 289

 Score = 73.6 bits (179), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 69/288 (23%), Positives = 117/288 (40%), Gaps = 24/288 (8%)

Query: 2   ISQANSLLLPFIDSLPLHQITKTALTTRLTDI-HSDFKFKEIAVPLTESLQVYEKAQRAQ 60
           +   N  +L  +  LPLH  TK  +   +  +   +FK  ++  P+   L          
Sbjct: 1   MGGMNRKVLEIVSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYL---------- 50

Query: 61  DLRTSLKALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGK 120
            L   +  L  +++  +F+  NP+  H   F+++   L   WP+E H  L+         
Sbjct: 51  -LSGEVSYLRRVIFDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDS 109

Query: 121 LISLTSKGN-----WLKADWTTLFQVKNPWVRTXXXXXXXXXXXAQNSIAELDAFT---A 172
              L S+ N      ++ D     + + P                Q    E D  T    
Sbjct: 110 ARYLWSRNNAKVLDIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGET 169

Query: 173 ERTFLVKSLGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLA 232
           ER  L+K + +HY F+ +   L   HK  P P+V++ + + LGE  P  +I  LF ++  
Sbjct: 170 ERIALLKLIFSHYLFVKSRPTLC-GHKNLPIPIVEVGM-SPLGEDMPDVRIDNLFRKRSK 227

Query: 233 QIYTSLFVENPPLSTANELALMTVFDDGTLERRHTRLYMRACARAYTI 280
               +L  + PPLS   E  L ++  +   +R   RLY  +C  AYT+
Sbjct: 228 ATLKTLLHDFPPLSREVESLLHSIIKE--CDRSMGRLYKWSCNGAYTM 273

>AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR091W
          Length = 266

 Score = 72.8 bits (177), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 67/277 (24%), Positives = 121/277 (43%), Gaps = 33/277 (11%)

Query: 12  FIDSLPLHQITKTALTTRLTDIHSDFKFKEIAV--PLTESLQVYEKAQRAQDLRTSLKAL 69
            +  LPLH+ T   +   L+   + +  + I +  PL + L+           +   + L
Sbjct: 8   IVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLR-----------KGGHQGL 56

Query: 70  ESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGKLISLTSKGN 129
           + +V+  HFQ     P H  L ++H   L   WP+E H SL+     ++  L  L   G 
Sbjct: 57  QRLVFHVHFQLMLRAPEHLRLLRRHREELQRFWPYERHHSLLALSDVRSQSLRRLWEDGQ 116

Query: 130 WLKADWTTLFQVKNPWVRTXXXXXXXXXXXAQNSIAELDAFT-AERTFLVKSLGNHYKFL 188
             +     +   ++ W+R             +  + E  A T A+R  ++  +   Y FL
Sbjct: 117 --EEVLQQMQYCRHHWLR-------------EGDVPERYALTQAQREEVLHRVFAQYMFL 161

Query: 189 VTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFVENPPLSTA 248
                L ++ ++ P PVV+I +   LG   P  ++  LF  +   +   L+ E+P L+ A
Sbjct: 162 KQRPAL-WSVRRLPIPVVEIGM-TPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPA 219

Query: 249 NELALMTVFDDGTLERRHTRLYMRACARAYTIANADS 285
            E  ++ +  +    R   R+Y+RAC RAY + +AD+
Sbjct: 220 AEEDMLRIIAECP-TRAMRRIYLRACRRAYVL-DADA 254

>KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON}
           conserved hypothetical protein
          Length = 305

 Score = 69.3 bits (168), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 100/227 (44%), Gaps = 14/227 (6%)

Query: 67  KALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGKLISLTS 126
           K LE +VY  HF   N  P+H  + +++ + L   WP+E   S+++           L S
Sbjct: 51  KTLEKLVYSVHFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWS 110

Query: 127 KGNWLKADWTTLFQVKNPWVR---------TXXXXXXXXXXXAQNSIAELDAFTAERTF- 176
           + N    D+ +  + K  W+R                         I E+    AE+   
Sbjct: 111 RNNKDALDFLSFNRHK--WLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRLPAEKIKE 168

Query: 177 LVKSLGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYT 236
            ++ +  HY FL TN  L    KK  +P+V+I ++    +I+  + I  LF +++  I  
Sbjct: 169 TLRQIFEHYYFLKTNPKLCAT-KKLQAPIVEIGMKPDGFDIADIR-IDNLFKKKVKLISD 226

Query: 237 SLFVENPPLSTANELALMTVFDDGTLERRHTRLYMRACARAYTIANA 283
            L+ +NP L++  E  L ++ +D  L RR  RLY    +R+Y   + 
Sbjct: 227 LLYSQNPVLTSDAESILTSIVNDPDLNRRTKRLYKNVASRSYLFKDG 273

>KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.266
           YLR091W
          Length = 286

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 121/295 (41%), Gaps = 46/295 (15%)

Query: 9   LLPFIDSLPLHQITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQDLRTSLKA 68
           LL  + SLPLH +T   L+  +    S  + K +A    E+LQ +      +   T  K 
Sbjct: 8   LLRELRSLPLHSLTLARLSRHVAATKSIPRLKHVA----ETLQNFHDVPSTKK-HTQYKI 62

Query: 69  LESIVYQTHFQWNNPRPRHAHL------FQKHYHFLLSHWPFENHRSLVDSIPAQNGKLI 122
           L +++ Q + QW+N   R +HL      F++ +  L+  WP E+H SL  S         
Sbjct: 63  LTTLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQS--------- 113

Query: 123 SLTSKGNWLKADWTTLFQVKNPWVRTXXXXXXXXXXXAQNSIAELDAFTAERTFLVKSLG 182
              +KG+           +K+ WV             A    A   +   E    ++ + 
Sbjct: 114 ---TKGHA---------TLKHAWVTNNKHALQMSFDAAA---ANPTSGNIELRGSLRQIL 158

Query: 183 NHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFVEN 242
           +HY+ L  N  + +   K   PV +IP+ N  GE  P  + + L  R++  +   L  E 
Sbjct: 159 SHYQLLYNNMRM-FGKIKLQVPVAEIPL-NVFGEEIPACRTANLLQRKVGYVKRVLIEEL 216

Query: 243 PPLSTANELALMT--VFDDGTLERRHT-------RLYMRACARAYTIANADSDNE 288
           P L     +A +T  +  DG   R          RLY RA A  YT+A+   + +
Sbjct: 217 PALYNTECIAELTAIIAGDGPAARSGNYSPRQLRRLYRRAFAGCYTLASTAQEGQ 271

>TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.266
           YLR091W
          Length = 249

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (46%), Gaps = 16/109 (14%)

Query: 8   LLLPFIDSLPLH----QITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQDLR 63
           ++L  ++ LPLH     + +  + T+LT              L E L  Y  A   +   
Sbjct: 20  IILDGLNRLPLHPNTLDLLQKQVHTKLTK----------NSELIELLFDYNNAFINKQKP 69

Query: 64  TSLKALESIVYQTHFQWNNPRPRHAHL--FQKHYHFLLSHWPFENHRSL 110
             LK L+ I+++TH  +NN    + HL  F+  Y++L  +WP+E H  L
Sbjct: 70  GQLKCLQRIIFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDIL 118

>CAGL0H04609g Chr8 complement(433499..441790) [8292 bp, 2763 aa] {ON}
            similar to uniprot|P38110 Saccharomyces cerevisiae
            YBL088c TEL1
          Length = 2763

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 37/77 (48%), Gaps = 7/77 (9%)

Query: 46   LTESLQVYEKAQRAQDLRTSLKALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFE 105
            L  S Q+ EK +  +  R  LK +ES+V  +     N       + QKHYH L +H   E
Sbjct: 2124 LNGSDQLKEKQKSYRRTRQELKDIESVVKSS-----NLSNEELLVGQKHYHNLKTH--ME 2176

Query: 106  NHRSLVDSIPAQNGKLI 122
            N R  +++I     KLI
Sbjct: 2177 NDRLAIENICLTRKKLI 2193

>Skud_12.360 Chr12 complement(638225..640564) [2340 bp, 779 aa] {ON}
           YLR277C (REAL)
          Length = 779

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 216 EISPPKQISKLFARQLAQIYTSLFVENPPLSTANELALMTVFDDG 260
           E+S  KQIS+LF  Q  + +T LF++    +++NE A+  V   G
Sbjct: 696 EVSRVKQISRLFKEQFGECFT-LFLDKDEPASSNEEAINGVITIG 739

>CAGL0L12320g Chr12 (1332269..1333105) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q12393 Saccharomyces cerevisiae
           YLR091w
          Length = 278

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 21/43 (48%)

Query: 82  NPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGKLISL 124
           N  P H   +Q  YH L++ WP    R ++D++    G  + +
Sbjct: 70  NELPAHLRQYQSEYHALVASWPTVTERQILDAMELGKGMAVRI 112

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.132    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,533,306
Number of extensions: 1146832
Number of successful extensions: 3092
Number of sequences better than 10.0: 26
Number of HSP's gapped: 3142
Number of HSP's successfully gapped: 29
Length of query: 299
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 190
Effective length of database: 40,982,805
Effective search space: 7786732950
Effective search space used: 7786732950
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)