Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_10.1748.264ON45645621890.0
Smik_12.1498.264ON46046017150.0
YLR090W (XDJ1)8.264ON45945917090.0
Skud_12.1588.264ON45545916760.0
NDAI0B020008.264ON4334537861e-100
TDEL0F039108.264ON4294187553e-95
ZYRO0C01606g8.264ON4324247528e-95
SAKL0H16984g8.264ON4354247511e-94
Kpol_543.408.264ON4144397394e-93
NCAS0B050308.264ON4334337397e-93
TPHA0A017908.264ON4394577145e-89
AGR084C8.264ON4274636944e-86
Ecym_43068.264ON4344496902e-85
KLTH0G13640g8.264ON4144356831e-84
KLLA0F19184g8.264ON5124606658e-81
CAGL0L12276g8.264ON4524536302e-76
Kwal_56.237828.264ON4144216254e-76
KNAG0G020508.264ON4324525812e-69
NDAI0D010302.243ON4113903952e-42
KAFR0J009402.243ON4114363846e-41
TBLA0E038102.243ON4103853846e-41
TPHA0C031102.243ON4074033784e-40
Kpol_1003.122.243ON4083903776e-40
YNL064C (YDJ1)2.243ON4094013653e-38
NCAS0G030002.243ON4104263654e-38
KNAG0I019002.243ON4093923601e-37
CAGL0J09966g2.243ON4073873583e-37
TDEL0C046002.243ON4114003575e-37
Skud_14.2682.243ON4104013565e-37
KLLA0F03333g2.243ON4093983559e-37
Smik_14.2632.243ON4094013549e-37
Suva_14.2772.243ON4094013513e-36
ADL257C2.243ON4103883504e-36
ZYRO0A01496g2.243ON4124063496e-36
Ecym_32812.243ON4093853462e-35
TDEL0C043502.218ON4623933454e-35
SAKL0E09306g2.218ON4614043402e-34
KLTH0G08756g2.218ON4624423367e-34
Kwal_23.48302.243ON4113963331e-33
SAKL0E08734g2.243ON4113903312e-33
KLTH0G09394g2.243ON4113943232e-32
Kwal_23.30612.218ON4584473146e-31
KNAG0M020202.218ON4603782864e-27
AER427W2.218ON4704082778e-26
SAKL0H05258g8.730ON3683672702e-25
TPHA0G006308.730ON3933742661e-24
KAFR0A041608.730ON3783812641e-24
KLLA0C07260g8.730ON3683472613e-24
Kwal_26.90248.730ON3753632447e-22
Ecym_62368.730ON3743792431e-21
Kpol_1002.1222.218ON5032822423e-21
NDAI0E008708.730ON3763672384e-21
CAGL0F03729g8.730ON3613582375e-21
KLLA0E07899g2.218ON4954712405e-21
Smik_14.2492.218ON5332712416e-21
Suva_13.3978.730ON3753692351e-20
Skud_14.2532.218ON5322642381e-20
YNL077W (APJ1)2.218ON5282552326e-20
TDEL0B037908.730ON3733692252e-19
KNAG0G028808.730ON3783662252e-19
Suva_14.2622.218ON5362542256e-19
TPHA0C029802.218ON5542442212e-18
KLTH0D12496g8.730ON3752762172e-18
YMR214W (SCJ1)8.730ON3773722154e-18
ZYRO0C15048g2.218ON4912732174e-18
Smik_13.4228.730ON3783752121e-17
NCAS0B005308.730ON3753742121e-17
ZYRO0A06226g8.730ON3773752121e-17
Skud_13.3838.730ON3753072102e-17
Ecym_53842.218ON5032542078e-17
AER346W8.730ON3673592058e-17
CAGL0J10296g2.218ON4794182061e-16
NCAS0G028502.218ON4942582051e-16
TBLA0E036602.218ON4482501792e-13
CAGL0H03707g1.398ON349681773e-13
TPHA0D005508.61ON4863041767e-13
NDAI0F024502.218ON5302701758e-13
NDAI0G042501.398ON363681739e-13
YNL007C (SIS1)1.398ON352681721e-12
Suva_14.3411.398ON359681712e-12
TPHA0B037601.398ON355681702e-12
NDAI0C026101.398ON340681692e-12
AAL008W1.398ON349681692e-12
TBLA0C014801.398ON353681692e-12
KAFR0H031501.398ON359681667e-12
ZYRO0E04598g1.398ON357681658e-12
Kwal_0.2071.398ON353681658e-12
Kpol_457.151.398ON357671659e-12
NCAS0G036101.398ON327681649e-12
NCAS0C048901.398ON367681641e-11
KLTH0H12100g1.398ON350681641e-11
Kpol_1064.408.730ON3872441651e-11
SAKL0D08778g1.398ON348681641e-11
KLLA0D04818g1.398ON354681641e-11
TDEL0B059601.398ON369681632e-11
KAFR0C031608.61ON4982681642e-11
Smik_14.3211.398ON366681622e-11
Skud_14.3201.398ON368681622e-11
KNAG0H016801.398ON363681603e-11
Ecym_12921.398ON347681579e-11
TDEL0H022907.217ON387661552e-10
TDEL0G028002.350ON225711474e-10
YMR161W (HLJ1)2.350ON224711474e-10
TBLA0B034908.730ON3842501524e-10
KLTH0F09944g2.350ON233681475e-10
KLLA0E04423g7.217ON428661491e-09
KLTH0A03740g7.217ON395661481e-09
Smik_13.3612.350ON224711441e-09
TPHA0C012607.217ON380661472e-09
Ecym_43727.217ON579661482e-09
TPHA0C045902.350ON233711432e-09
Smik_14.1062.15ON593661482e-09
TBLA0D042407.217ON389661462e-09
YNL227C (JJJ1)2.15ON590641482e-09
Skud_13.3232.350ON224711422e-09
CAGL0J07370g2.15ON623641482e-09
Kwal_23.3578singletonOFF85671323e-09
Kpol_1070.227.217ON380661435e-09
NCAS0E029307.217ON387661435e-09
ZYRO0F15400g2.15ON525641446e-09
CAGL0J02750g7.217ON382671427e-09
KNAG0I008602.350ON219711387e-09
ZYRO0A07502g2.350ON238711388e-09
NCAS0D009602.350ON224711378e-09
TBLA0E024907.217ON366661419e-09
TBLA0G001702.15ON659641421e-08
CAGL0H04499g2.350ON232711371e-08
Kpol_1072.48.698ON661691411e-08
AFR507W8.61ON474661411e-08
Suva_13.3402.350ON225711361e-08
NDAI0H031802.350ON229711361e-08
NDAI0F038002.15ON638641412e-08
Kwal_47.181337.217ON393661392e-08
Suva_14.1162.15ON600641402e-08
TPHA0L007907.157ON446661392e-08
Skud_14.1102.15ON596641392e-08
TBLA0J009701.185ON586641392e-08
KLTH0B08338g2.15ON590641392e-08
Smik_5.1737.217ON391661373e-08
SAKL0E06050g2.350ON232681343e-08
Kwal_23.44202.15ON592641383e-08
NDAI0E045607.217ON394661373e-08
TPHA0G014808.698ON660691383e-08
YER048C (CAJ1)7.217ON391661373e-08
Ecym_56262.350ON243681334e-08
Kpol_526.62.350ON228711334e-08
KAFR0A016201.297ON665661374e-08
TBLA0J018707.157ON470661356e-08
Suva_8.3038.698ON664691366e-08
Skud_5.1587.217ON391661347e-08
KNAG0F008602.15ON626641357e-08
KLLA0E01629g2.350ON231711317e-08
TPHA0A028101.185ON492651357e-08
TBLA0B093802.350ON227711307e-08
KNAG0L013307.217ON396661348e-08
SAKL0E14234g2.15ON678641358e-08
KLLA0D06402g1.297ON631661358e-08
KNAG0I007407.157ON425661348e-08
Smik_15.4378.698ON663691359e-08
Kpol_529.212.15ON622661349e-08
CAGL0L00957g7.217ON373641321e-07
NCAS0G013602.15ON616661331e-07
NDAI0D005001.113ON190801271e-07
Skud_15.4208.698ON665691331e-07
Skud_9.1817.157ON421671321e-07
KAFR0A079502.15ON551641331e-07
ABL194C2.15ON552681321e-07
YOR254C (SEC63)8.698ON663691331e-07
Smik_9.2037.157ON432661321e-07
KAFR0B048902.350ON220711282e-07
KAFR0H023108.698ON655691322e-07
Kwal_14.24521.297ON607711322e-07
Suva_5.1507.217ON391661302e-07
SAKL0F08052g7.217ON393671302e-07
Suva_9.2137.157ON431661302e-07
TBLA0C027201.297ON715671312e-07
Suva_6.448.61ON5071461302e-07
NCAS0C012208.698ON669691313e-07
KNAG0B052401.297ON668661303e-07
KNAG0J018408.698ON650691303e-07
KLLA0D19602g2.15ON620661303e-07
AFL190C2.350ON235681253e-07
TPHA0O019402.15ON598641293e-07
ZYRO0D16390g7.217ON398661284e-07
KNAG0G011308.61ON500641294e-07
ZYRO0D10934g8.698ON663811294e-07
YIR004W (DJP1)7.157ON432661285e-07
KAFR0L007407.217ON364661275e-07
SAKL0C03476g1.113ON165661215e-07
SAKL0D06226g1.297ON615671285e-07
Suva_12.1851.113ON168641215e-07
KLTH0H10032g1.297ON607711286e-07
CAGL0G07469g8.698ON668691276e-07
CAGL0C04565g1.113ON175751217e-07
Smik_10.1681.297ON649761277e-07
TDEL0E005002.15ON581641268e-07
Kpol_1027.131.297ON641661268e-07
Skud_10.1691.297ON644761261e-06
YJL073W (JEM1)1.297ON645731251e-06
AFR639W1.113ON156641181e-06
CAGL0H02827g1.297ON656771251e-06
ZYRO0F15972g1.113ON162641181e-06
KNAG0B018901.92ON370701231e-06
ADR015W7.157ON436661232e-06
TBLA0B037308.698ON693691242e-06
SAKL0F04444g7.157ON429661222e-06
KLLA0C09823g8.698ON669731232e-06
KAFR0B047807.157ON423651222e-06
ADR124C1.297ON611721222e-06
NDAI0A028207.157ON482671223e-06
TBLA0A011007.157ON434671213e-06
KLLA0D13464g7.157ON433661213e-06
TDEL0H032107.157ON411671195e-06
CAGL0J01936g7.157ON425661195e-06
Ecym_14508.61ON492661205e-06
NCAS0A093201.297ON635671205e-06
ADL111W7.217ON578631205e-06
KAFR0F018101.185ON555641195e-06
ZYRO0G03850g7.157ON418641186e-06
Skud_10.3191.113ON168641137e-06
KLTH0F03124g1.113ON162641128e-06
Suva_6.1481.297ON642731189e-06
NCAS0A132107.157ON414661171e-05
NDAI0C002001.92ON276711151e-05
Kpol_499.307.157ON408661161e-05
ZYRO0G21230g1.297ON584671171e-05
NCAS0I028301.185ON491641161e-05
SAKL0H05984g8.698ON658661171e-05
KNAG0C024501.185ON544641161e-05
TBLA0D026008.61ON510661161e-05
TPHA0B041901.113ON168741102e-05
TDEL0A064308.698ON666691162e-05
KNAG0A056502.350ON175661102e-05
KLLA0B07271g1.185ON653791152e-05
TBLA0A055601.92ON312731132e-05
CAGL0I06226g1.185ON455641142e-05
Kwal_55.209657.157ON421661133e-05
ZYRO0F03652g8.61ON462641133e-05
ZYRO0G18436g1.185ON503641143e-05
Ecym_10971.92ON270771113e-05
Ecym_44697.157ON433661133e-05
YJL162C (JJJ2)1.185ON583641133e-05
NDAI0K012308.698ON680691133e-05
Ecym_63181.297ON624721134e-05
Kwal_33.138601.185ON578641124e-05
Smik_10.3851.113ON172641074e-05
KLTH0F02596g1.92ON282731104e-05
KLTH0F13398g7.157ON419661115e-05
KAFR0G009101.113ON163641065e-05
SAKL0C02904g1.92ON281721095e-05
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_10.174
         (456 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...   847   0.0  
Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...   665   0.0  
YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...   662   0.0  
Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...   650   0.0  
NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264    307   e-100
TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...   295   3e-95
ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...   294   8e-95
SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...   293   1e-94
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...   289   4e-93
NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264    289   7e-93
TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...   279   5e-89
AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...   271   4e-86
Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...   270   2e-85
KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...   267   1e-84
KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...   260   8e-81
CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...   247   2e-76
Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...   245   4e-76
KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...   228   2e-69
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...   156   2e-42
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...   152   6e-41
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...   152   6e-41
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...   150   4e-40
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...   149   6e-40
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...   145   3e-38
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...   145   4e-38
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...   143   1e-37
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...   142   3e-37
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...   142   5e-37
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...   141   5e-37
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...   141   9e-37
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...   140   9e-37
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...   139   3e-36
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...   139   4e-36
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...   139   6e-36
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...   137   2e-35
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...   137   4e-35
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...   135   2e-34
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...   134   7e-34
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...   132   1e-33
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...   132   2e-33
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...   129   2e-32
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...   125   6e-31
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...   114   4e-27
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...   111   8e-26
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...   108   2e-25
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...   107   1e-24
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...   106   1e-24
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...   105   3e-24
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...    99   7e-22
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...    98   1e-21
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...    98   3e-21
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...    96   4e-21
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...    96   5e-21
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...    97   5e-21
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...    97   6e-21
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...    95   1e-20
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...    96   1e-20
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...    94   6e-20
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...    91   2e-19
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...    91   2e-19
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...    91   6e-19
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    90   2e-18
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...    88   2e-18
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...    87   4e-18
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...    88   4e-18
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...    86   1e-17
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730       86   1e-17
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...    86   1e-17
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...    86   2e-17
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...    84   8e-17
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...    84   8e-17
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...    84   1e-16
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218     84   1e-16
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...    74   2e-13
CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...    73   3e-13
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...    72   7e-13
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...    72   8e-13
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...    71   9e-13
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...    71   1e-12
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...    70   2e-12
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...    70   2e-12
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}               70   2e-12
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...    70   2e-12
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...    70   2e-12
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...    69   7e-12
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...    68   8e-12
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...    68   8e-12
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...    68   9e-12
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398      68   9e-12
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398     68   1e-11
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...    68   1e-11
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....    68   1e-11
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...    68   1e-11
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...    68   1e-11
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...    67   2e-11
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...    68   2e-11
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...    67   2e-11
Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...    67   2e-11
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...    66   3e-11
Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...    65   9e-11
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    64   2e-10
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    61   4e-10
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    61   4e-10
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...    63   4e-10
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    61   5e-10
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    62   1e-09
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    62   1e-09
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    60   1e-09
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    61   2e-09
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    62   2e-09
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    60   2e-09
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    62   2e-09
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    61   2e-09
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    62   2e-09
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    59   2e-09
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    62   2e-09
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    55   3e-09
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    60   5e-09
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     60   5e-09
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    60   6e-09
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    59   7e-09
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    58   7e-09
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    58   8e-09
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    57   8e-09
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    59   9e-09
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    59   1e-08
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    57   1e-08
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    59   1e-08
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    59   1e-08
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    57   1e-08
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      57   1e-08
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      59   2e-08
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    58   2e-08
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    59   2e-08
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    58   2e-08
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    58   2e-08
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    58   2e-08
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    58   2e-08
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    57   3e-08
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    56   3e-08
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    58   3e-08
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             57   3e-08
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    58   3e-08
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    57   3e-08
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    56   4e-08
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    56   4e-08
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    57   4e-08
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    57   6e-08
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    57   6e-08
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    56   7e-08
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    57   7e-08
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    55   7e-08
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    57   7e-08
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    55   7e-08
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    56   8e-08
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    57   8e-08
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    57   8e-08
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    56   8e-08
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    57   9e-08
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    56   9e-08
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    55   1e-07
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    56   1e-07
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    54   1e-07
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    56   1e-07
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    55   1e-07
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    56   1e-07
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    55   1e-07
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    56   1e-07
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    55   1e-07
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    54   2e-07
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    55   2e-07
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    55   2e-07
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    55   2e-07
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    55   2e-07
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    55   2e-07
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    55   2e-07
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    55   2e-07
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     55   3e-07
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    55   3e-07
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    55   3e-07
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    55   3e-07
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    53   3e-07
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    54   3e-07
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    54   4e-07
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...    54   4e-07
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    54   4e-07
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    54   5e-07
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    54   5e-07
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    51   5e-07
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    54   5e-07
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    51   5e-07
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    54   6e-07
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    54   6e-07
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    51   7e-07
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    54   7e-07
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    53   8e-07
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    53   8e-07
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    53   1e-06
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    53   1e-06
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    50   1e-06
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    53   1e-06
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    50   1e-06
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    52   1e-06
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    52   2e-06
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    52   2e-06
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    52   2e-06
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    52   2e-06
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               52   2e-06
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    52   2e-06
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    52   3e-06
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    51   3e-06
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    51   3e-06
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    50   5e-06
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    50   5e-06
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    51   5e-06
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    51   5e-06
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    51   5e-06
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    50   5e-06
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    50   6e-06
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    48   7e-06
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    48   8e-06
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    50   9e-06
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    50   1e-05
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         49   1e-05
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    49   1e-05
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    50   1e-05
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    49   1e-05
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    50   1e-05
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    49   1e-05
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...    49   1e-05
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    47   2e-05
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    49   2e-05
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    47   2e-05
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    49   2e-05
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    48   2e-05
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    49   2e-05
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    48   3e-05
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    48   3e-05
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    49   3e-05
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    47   3e-05
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    48   3e-05
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    48   3e-05
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    48   3e-05
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    48   4e-05
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    48   4e-05
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    46   4e-05
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    47   4e-05
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    47   5e-05
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    45   5e-05
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    47   5e-05
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    45   5e-05
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    47   6e-05
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    47   7e-05
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    47   7e-05
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...    47   7e-05
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    47   8e-05
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    47   8e-05
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    47   8e-05
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    47   9e-05
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    47   1e-04
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    47   1e-04
AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON} Syn...    46   1e-04
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    46   2e-04
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       45   2e-04
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    45   2e-04
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    45   2e-04
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    43   3e-04
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    44   3e-04
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    45   3e-04
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    45   3e-04
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    45   3e-04
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    45   3e-04
NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON} ...    44   3e-04
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    44   3e-04
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    45   3e-04
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    45   4e-04
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    45   4e-04
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    45   4e-04
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    44   4e-04
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    44   5e-04
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    44   5e-04
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    44   5e-04
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    44   6e-04
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    44   6e-04
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    44   6e-04
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    44   6e-04
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    42   6e-04
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    44   6e-04
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    42   7e-04
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    44   8e-04
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    43   0.001
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    44   0.001
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    43   0.001
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    42   0.001
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    43   0.001
TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4 Y...    43   0.001
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    43   0.002
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    42   0.002
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    42   0.002
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    42   0.002
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    42   0.002
KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON...    40   0.003
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    42   0.003
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    41   0.003
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    42   0.003
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    42   0.003
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    42   0.004
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    41   0.004
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    41   0.005
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    41   0.005
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    41   0.005
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    40   0.008
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    39   0.012
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    39   0.014
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    39   0.015
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    39   0.015
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    38   0.021
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    39   0.026
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    38   0.029
KLTH0G01122g Chr7 (80433..81317) [885 bp, 294 aa] {ON} similar t...    38   0.031
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    39   0.033
KAFR0H00980 Chr8 (180369..181181) [813 bp, 270 aa] {ON} Anc_3.35...    38   0.040
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    37   0.051
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    36   0.063
TDEL0C04920 Chr3 complement(889534..890448) [915 bp, 304 aa] {ON...    37   0.10 
CAGL0D01584g Chr4 (167879..168781) [903 bp, 300 aa] {ON} similar...    37   0.11 
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    36   0.12 
CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly s...    36   0.16 
Kwal_33.13451 s33 complement(229605..230468) [864 bp, 287 aa] {O...    36   0.17 
Suva_16.388 Chr16 complement(682753..683655) [903 bp, 300 aa] {O...    35   0.22 
KLLA0A04840g Chr1 complement(430541..431113) [573 bp, 190 aa] {O...    35   0.24 
Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig ...    35   0.27 
KLLA0C02541g Chr3 complement(226721..227533) [813 bp, 270 aa] {O...    34   0.48 
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    34   0.49 
TDEL0D06160 Chr4 complement(1111817..1112701) [885 bp, 294 aa] {...    34   0.67 
CAGL0K09416g Chr11 complement(931067..932143) [1077 bp, 358 aa] ...    34   0.72 
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    33   0.81 
NCAS0A01690 Chr1 (330511..331077) [567 bp, 188 aa] {ON} Anc_4.10...    33   0.93 
ZYRO0C16126g Chr3 complement(1261370..1262215) [846 bp, 281 aa] ...    33   1.0  
Suva_7.50 Chr7 (88923..90002) [1080 bp, 359 aa] {ON} YGL211W (REAL)    33   1.1  
KNAG0D01780 Chr4 (297877..299016) [1140 bp, 379 aa] {ON} Anc_7.2...    33   1.1  
AFR246C Chr6 complement(883072..883938) [867 bp, 288 aa] {ON} Sy...    33   1.1  
Smik_16.302 Chr16 complement(552646..553554) [909 bp, 302 aa] {O...    33   1.2  
KLLA0B08459g Chr2 (751178..752065) [888 bp, 295 aa] {ON} similar...    33   1.3  
KNAG0D02880 Chr4 complement(522593..523372) [780 bp, 259 aa] {ON...    33   1.3  
KLLA0B00737g Chr2 complement(58094..59209) [1116 bp, 371 aa] {ON...    33   1.7  
Suva_7.261 Chr7 complement(449983..450537) [555 bp, 184 aa] {ON}...    32   1.7  
YGL018C Chr7 complement(459110..459664) [555 bp, 184 aa] {ON}  J...    32   1.7  
Smik_7.272 Chr7 complement(451118..451672) [555 bp, 184 aa] {ON}...    32   2.1  
Ecym_7225 Chr7 complement(466300..466908) [609 bp, 202 aa] {ON} ...    32   2.3  
NDAI0A05220 Chr1 (1180958..1181935) [978 bp, 325 aa] {ON} Anc_3....    32   2.4  
NDAI0B06200 Chr2 complement(1506799..1507749) [951 bp, 316 aa] {...    32   2.9  
YFR041C Chr6 complement(237368..238255) [888 bp, 295 aa] {ON}  E...    32   3.0  
KAFR0F04170 Chr6 complement(820185..821306) [1122 bp, 373 aa] {O...    32   3.1  
Kwal_14.1136 s14 complement(211335..212195) [861 bp, 286 aa] {ON...    32   3.2  
Skud_7.269 Chr7 complement(462239..462793) [555 bp, 184 aa] {ON}...    31   3.7  
Skud_7.57 Chr7 (97816..98934) [1119 bp, 372 aa] {ON} YGL211W (REAL)    32   3.9  
KNAG0A04320 Chr1 complement(591254..595846) [4593 bp, 1530 aa] {...    32   4.2  
Kpol_376.12 s376 complement(19211..20083) [873 bp, 290 aa] {ON} ...    32   4.3  
Skud_6.132 Chr6 complement(232394..233278) [885 bp, 295 aa] {ON}...    32   4.3  
SAKL0F01298g Chr6 (108332..109231) [900 bp, 299 aa] {ON} similar...    31   5.3  
YPR061C Chr16 complement(675977..676882) [906 bp, 301 aa] {ON}  ...    31   5.5  
AER437C Chr5 complement(1473621..1474742) [1122 bp, 373 aa] {ON}...    31   5.6  
SAKL0B07568g Chr2 complement(649545..650396) [852 bp, 283 aa] {O...    31   5.6  
YGL211W Chr7 (92512..93591) [1080 bp, 359 aa] {ON}  NCS6Protein ...    31   5.8  
NDAI0D03610 Chr4 (859564..860136) [573 bp, 190 aa] {ON} Anc_4.10...    30   6.0  
Smik_7.52 Chr7 (87317..88396) [1080 bp, 359 aa] {ON} YGL211W (REAL)    31   6.3  
KLTH0E15268g Chr5 complement(1353439..1354302) [864 bp, 287 aa] ...    31   6.5  
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    31   6.5  
NCAS0B06610 Chr2 complement(1252742..1253965) [1224 bp, 407 aa] ...    31   7.0  
ZYRO0E09108g Chr5 complement(728771..729667) [897 bp, 298 aa] {O...    31   7.3  
NCAS0E00590 Chr5 (101606..102700) [1095 bp, 364 aa] {ON} Anc_3.5...    31   7.8  
NDAI0I02920 Chr9 complement(689825..690928) [1104 bp, 367 aa] {O...    31   7.8  
Skud_16.346 Chr16 complement(640855..641760) [906 bp, 301 aa] {O...    30   8.0  
TPHA0A05830 Chr1 complement(1324010..1325143) [1134 bp, 377 aa] ...    31   8.5  
KLTH0G01694g Chr7 (124053..125174) [1122 bp, 373 aa] {ON} simila...    30   8.7  
Kwal_47.19072 s47 complement(1086331..1087452) [1122 bp, 373 aa]...    30   9.2  
Smik_7.361 Chr7 complement(598202..599089) [888 bp, 295 aa] {ON}...    30   9.2  
SAKL0F01848g Chr6 (154310..155434) [1125 bp, 374 aa] {ON} simila...    30   9.4  
Suva_12.16 Chr12 (21243..22130) [888 bp, 295 aa] {ON} YFR041C (R...    30   9.5  

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
           (REAL)
          Length = 456

 Score =  847 bits (2189), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/456 (91%), Positives = 415/456 (91%)

Query: 1   MSGSDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAA 60
           MSGSDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAA
Sbjct: 1   MSGSDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAA 60

Query: 61  YEILSDPEKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEG 120
           YEILSDPEKKSHYDLY                            AHEANDFPNEHEMYEG
Sbjct: 61  YEILSDPEKKSHYDLYGDDNGTGGGDEFGDDDFMNFFNNFFNNGAHEANDFPNEHEMYEG 120

Query: 121 NETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECES 180
           NETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECES
Sbjct: 121 NETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECES 180

Query: 181 CGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVI 240
           CGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVI
Sbjct: 181 CGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVI 240

Query: 241 TVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQD 300
           TVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQD
Sbjct: 241 TVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQD 300

Query: 301 LYVSITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRG 360
           LYVSITVSLSEALTGFEK             SIKPGKVIRPGDIIKITNEGWPILDHPRG
Sbjct: 301 LYVSITVSLSEALTGFEKFLTRTFDDRLLTLSIKPGKVIRPGDIIKITNEGWPILDHPRG 360

Query: 361 QCGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSN 420
           QCGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSN
Sbjct: 361 QCGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSN 420

Query: 421 FQIIHSDDLPEGMKTFNPKPQTSAHQKASSSYCPMQ 456
           FQIIHSDDLPEGMKTFNPKPQTSAHQKASSSYCPMQ
Sbjct: 421 FQIIHSDDLPEGMKTFNPKPQTSAHQKASSSYCPMQ 456

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
           (REAL)
          Length = 460

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/460 (70%), Positives = 364/460 (79%), Gaps = 4/460 (0%)

Query: 1   MSGSDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAA 60
           MSGSD + +LYDVLGVT +ASVQEIKTAYRKLALKHHPDK VDQ+SKE+NE KFKEITAA
Sbjct: 1   MSGSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAA 60

Query: 61  YEILSDPEKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXA---HEANDFPNEHEM 117
           YEILSDPEKKSHYDLY                                HE NDFP E++ 
Sbjct: 61  YEILSDPEKKSHYDLYGDDYGTAGSTGADGFGDDDFMNFFNNFFNSGDHEGNDFPREYDT 120

Query: 118 YEGNETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEME 177
           YE ++  SSKDIDID+  T+KDLYMGKKLKFELKRQI+C  C GSGWK KKK+HVTHE+E
Sbjct: 121 YEEDKCKSSKDIDIDIFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVE 180

Query: 178 CESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKK 237
           CESCGGKGSKERLKRFGPGLVASQWV CEKCHGKGKY KRPKN KNFCPDC  VGLQ KK
Sbjct: 181 CESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKK 240

Query: 238 EVITVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGN 297
           E+ITVNV PGHHFNDV+T+KGMADEE+DK+ CGDL FHLVEK E+L+QKQ+ +K F  G+
Sbjct: 241 EIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGS 300

Query: 298 LQDLYVSITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDH 357
            +DLY S T+SLSEALTGFEK             SIKPG+VIRPGD+IKITNEGWPI+D 
Sbjct: 301 AEDLYTSATISLSEALTGFEKFLTRTFDDRLLTLSIKPGRVIRPGDVIKITNEGWPIMDD 360

Query: 358 PRGQCGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDN-SPINSE 416
           PRGQ GDLYVF+ IEFPPDNWFNEKSELLAIKT LPSS+S    TT NTG D+ +PIN+E
Sbjct: 361 PRGQRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNE 420

Query: 417 TVSNFQIIHSDDLPEGMKTFNPKPQTSAHQKASSSYCPMQ 456
           T+SNFQII+ ++LPEGMK FN + Q SAHQKA SSYCPMQ
Sbjct: 421 TISNFQIINMEELPEGMKIFNSESQNSAHQKAKSSYCPMQ 460

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putative
           chaperone, homolog of E. coli DnaJ, closely related to
           Ydj1p; the authentic, non-tagged protein is detected in
           highly purified mitochondria in high-throughput studies
          Length = 459

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/459 (69%), Positives = 365/459 (79%), Gaps = 3/459 (0%)

Query: 1   MSGSDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAA 60
           MSGSD  DRLYDVLGVTR+A+VQEIKTAYRKLALKHHPDK VDQDSKE+NE KFKEITAA
Sbjct: 1   MSGSDRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAA 60

Query: 61  YEILSDPEKKSHYDLYXXXXXXXXXXXXX---XXXXXXXXXXXXXXXAHEANDFPNEHEM 117
           YEILSDPEKKSHYDLY                               +H+ N+FP E++ 
Sbjct: 61  YEILSDPEKKSHYDLYGDDNGAASSGGANGFGDEDFMNFFNNFFNNGSHDGNNFPGEYDA 120

Query: 118 YEGNETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEME 177
           YE   +TSSKDIDID+S T+KDLYMGKKLKF+LKRQ+IC KC GSGWK K+K+HVTH++E
Sbjct: 121 YEEGNSTSSKDIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVE 180

Query: 178 CESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKK 237
           CESC GKGSKERLKRFGPGLVASQWVVCEKC+GKGKYTKRPKN KNFCPDC  +GL  KK
Sbjct: 181 CESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKK 240

Query: 238 EVITVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGN 297
           E+ITVNV PGHHFNDV+TVKGMADEEIDK  CGDL FHL EK E+L+QKQ+ +K F  G 
Sbjct: 241 EIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGA 300

Query: 298 LQDLYVSITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDH 357
            +DLY SIT+SLSEALTGFEK             S+KPG+V+RPGD IKI NEGWPILD+
Sbjct: 301 GEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDN 360

Query: 358 PRGQCGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSET 417
           P G+CGDLYVFV IEFPPDNWFNEKSELLAIKT+LPSS+S  S+ TVNT  D++  N+ET
Sbjct: 361 PHGRCGDLYVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNET 420

Query: 418 VSNFQIIHSDDLPEGMKTFNPKPQTSAHQKASSSYCPMQ 456
           +SNF+IIH+DDLPEG++ F P+ Q SAHQKA SSYC +Q
Sbjct: 421 ISNFRIIHTDDLPEGIRPFKPEAQDSAHQKARSSYCCIQ 459

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
           (REAL)
          Length = 455

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/459 (69%), Positives = 360/459 (78%), Gaps = 7/459 (1%)

Query: 1   MSGSDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAA 60
           MS SD  +RLY VLGVTR+A VQEIKTAYRKLALKHHPDK VDQDSK++NE KFKEITAA
Sbjct: 1   MSDSDRNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAA 60

Query: 61  YEILSDPEKKSHYDLYXXXXXXXXXXXXX---XXXXXXXXXXXXXXXAHEANDFPNEHEM 117
           YEILSDPEKKSHYDLY                                HE N F NE++M
Sbjct: 61  YEILSDPEKKSHYDLYGDDNGTANGGGTDGFGNDDFMNFFNNFFNDGGHEGNGFSNEYKM 120

Query: 118 YEGNETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEME 177
           YE N++ SSKDIDID+S TMKDLYMGKKL+F+LKRQ++C KC GSGWK KK+VHVTHE+E
Sbjct: 121 YEDNDSASSKDIDIDISLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVE 180

Query: 178 CESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKK 237
           CESCGGKGSKERLKRFGPGLVASQWV+CEKCHGKGKY K PKN KNFCPDC  VGLQ KK
Sbjct: 181 CESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKK 240

Query: 238 EVITVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGN 297
           EVITV V PGHHFNDV+T++GMADEEI KA CGDL FHL E+ ED   KQV +K FG GN
Sbjct: 241 EVITVIVAPGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGN 300

Query: 298 LQDLYVSITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDH 357
           ++D YVS+T+SLSEALTGFEK             SIKPG+VIRPGD++KITNEGWPILD 
Sbjct: 301 MEDSYVSVTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDD 360

Query: 358 PRGQCGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSET 417
            RG+CGDLYVF+ IEFPPDNWFNEKSELL IKT+LPSS+S    ++  +G  N  IN+ET
Sbjct: 361 ARGRCGDLYVFIHIEFPPDNWFNEKSELLGIKTNLPSSSS----SSCASGDANDLINNET 416

Query: 418 VSNFQIIHSDDLPEGMKTFNPKPQTSAHQKASSSYCPMQ 456
           VSNFQIIH+DDLPEG+KTF PKPQ  AH+KA S+YCPMQ
Sbjct: 417 VSNFQIIHTDDLPEGVKTFKPKPQNPAHKKARSAYCPMQ 455

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  307 bits (786), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/453 (38%), Positives = 260/453 (57%), Gaps = 44/453 (9%)

Query: 10  LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEK 69
           LY +LGVT  A+  EIK AYRKLAL++HPDK +D + +E NE KFKEIT+AYEILSD EK
Sbjct: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63

Query: 70  KSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPN------EHEMYEGNET 123
           ++HYDLY                               ANDF N      +++ Y   + 
Sbjct: 64  RAHYDLYGDANENEYNN-------------------QNANDFFNFETDQPDYDSY-AFDN 103

Query: 124 TSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVT--HEMECESC 181
             SKD+ I L  ++++LY GK  KF+ KR IIC +C+G GW+ +K  +VT  HE+EC+ C
Sbjct: 104 DKSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKC 163

Query: 182 GGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVIT 241
            G G KER +   PG V +  + CE CHGKG+   +P + KN C +C   GL  + + + 
Sbjct: 164 NGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLL 223

Query: 242 VNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDL 301
           V+VP G    D + ++  AD+EI K+  GD+I  ++E+   +      ++K       D 
Sbjct: 224 VSVPRGLQNKDTIRIENEADQEIGKSKTGDIIL-VIEEDTTMPSDVHFIRKG-----TDF 277

Query: 302 YVSITVSLSEALTGF-EKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRG 360
            + +++SL+EALTGF +K             S+  GKVIRPG+IIKI  EGWP+  +P+ 
Sbjct: 278 VMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPV--NPQA 335

Query: 361 -QCGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVS 419
            + GDLYV + IEFPPDNWF+EKS++  ++  LPS      N  +N+   + P+N+ETV+
Sbjct: 336 SKFGDLYVIIKIEFPPDNWFSEKSDIQLLRNVLPSGI----NGMMNSWKIDDPLNTETVT 391

Query: 420 NFQIIHSDDLPEGMKTFNPKPQTSAHQKASSSY 452
            F I+  ++LP+ +   N +       ++ ++Y
Sbjct: 392 TFDIL--EELPDTLNESNNRSAYDTGDQSDANY 422

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.264
           YLR090W
          Length = 429

 Score =  295 bits (755), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 161/418 (38%), Positives = 232/418 (55%), Gaps = 24/418 (5%)

Query: 10  LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEK 69
           LY++LGV  +A+  EIK AYRK AL+HHPDK  D+  +E +E +FKEI AAYE+L D EK
Sbjct: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63

Query: 70  KSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFP-NEHEMYEGNETTSSKD 128
           ++ YD Y                             H     P N ++ Y   +   S D
Sbjct: 64  RARYDKYGDADGSDFFNGPNEFEDAAFMNFF-----HSFGSNPQNAYDHYGEQKVDRSAD 118

Query: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVT--HEMECESCGGKGS 186
           + + L+ +M D Y GK  KF+ KR ++C +C GSGW+ ++  HV    ++EC+ CGG+G 
Sbjct: 119 VQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWR-RRNDHVVPPPQVECKKCGGQGF 177

Query: 187 KERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPP 246
           K+R++R  PG   ++ + C  C GKGK   +P N KN C  C   G+  + + +TV++P 
Sbjct: 178 KQRIRRLAPGFATTENITCPTCDGKGKCASKPNNDKNKCKKCVGTGVTTESKSLTVSLPR 237

Query: 247 GHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSIT 306
           G   +D + +KG AD+E+ K+  G+L+F + E  E  +   +    F      DL   +T
Sbjct: 238 GSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGF------DLITHLT 291

Query: 307 VSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLY 366
           +SL+EA+TGF K              I PGKVIRPG+II+I +EGWPI        GDLY
Sbjct: 292 LSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPI---DTTTSGDLY 348

Query: 367 VFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSNFQII 424
           V V IEFPPDNWF+E+S+L  +K  LP  T+       N   ++ P N+ETV+N  I+
Sbjct: 349 VVVHIEFPPDNWFSERSDLTQVKNVLPGETNN------NAAVEDDPGNTETVTNINIV 400

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {ON}
           similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 432

 Score =  294 bits (752), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 167/424 (39%), Positives = 233/424 (54%), Gaps = 22/424 (5%)

Query: 10  LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEK 69
           LYD LGV+++A+  EIK AYRKLAL+HHPDK  D   +E +E +FKEITAAYE+LSD EK
Sbjct: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62

Query: 70  KSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKDI 129
           +S YD Y                                           G++   S D+
Sbjct: 63  RSKYDTYGDTADGPDFEDESFMNFFTQFNSGFGFNGGGGG---GFPGAQPGDD--RSDDV 117

Query: 130 DIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKER 189
            + L  +M D Y GK  KF+ KR+I+C KC+GSGW+ ++      +  C+SC G+G KE+
Sbjct: 118 QVPLKVSMADCYNGKVFKFQSKRKIVCEKCEGSGWR-RRSGGPPPQTNCKSCQGRGYKEQ 176

Query: 190 LKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGHH 249
           L+R  PG+VA Q V C  CHGKGKY  +P + KN C  C   G+  + + +TV++P G  
Sbjct: 177 LRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSR 236

Query: 250 FNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVSL 309
             D +  +G AD+E+ K+  GDLIF + E  E  +  ++  + +      DL  +I++SL
Sbjct: 237 HGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGY------DLITNISISL 290

Query: 310 SEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLYVFV 369
           +EA+TG ++             S   GKVI PG IIK+  EGWP+  H   + GDLYV V
Sbjct: 291 AEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHAT-KFGDLYVLV 349

Query: 370 DIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSNFQIIHSDDL 429
           DI FP DNWF EKS+LL I+  LPS  +       N      P N+E VS+ +++  D L
Sbjct: 350 DIVFPRDNWFAEKSDLLKIRNILPSEAA-------NNDVKADPGNTEQVSDMKLV--DQL 400

Query: 430 PEGM 433
           P+ M
Sbjct: 401 PDYM 404

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 435

 Score =  293 bits (751), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 172/424 (40%), Positives = 239/424 (56%), Gaps = 19/424 (4%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           +LY+VLGV  +AS  EIK AYRKLAL+HHPDK  D+  +E +E KFKEITAAYEILSD +
Sbjct: 3   KLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDED 62

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKD 128
            +  YD+Y                                 D P +    E N +  + D
Sbjct: 63  SRKKYDVYGDDAPGASGGGGDPFGDDDFMNFFRTYAGGGFYDEPRQPYPEEENRSVRTSD 122

Query: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKE 188
             I L  +MK+LY GK  KF  KR ++C +CQGSG + K + H    + C+SC G G KE
Sbjct: 123 ARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKE 182

Query: 189 RLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGH 248
           R+KR   G V  + V CE+C+GKG+ T  P   ++ C  C    +  +++ +TV +P G 
Sbjct: 183 RIKRVAQGFVIRETVKCERCNGKGRTT--PTKPEDHCKKCHGKCVISEEKTLTVYIPRGS 240

Query: 249 HFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVS 308
              D+V ++G AD+E DK V GDL+F + E PE        +++ G     DL+  + +S
Sbjct: 241 RNGDIVKLEGEADQEPDK-VTGDLLFVIEENPE----TSTNLERRG----DDLHTRLKIS 291

Query: 309 LSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLYVF 368
           LSEA+TGFEK              I  GKVIRPG+ I++ NEGWP LD    + GD+YV 
Sbjct: 292 LSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWP-LDDSGNKFGDMYVQ 350

Query: 369 VDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSNFQIIHS-D 427
           V IEFPPDNWF+EKS++  ++T LP     P+    +TG  N   N+ETV ++ ++ S D
Sbjct: 351 VHIEFPPDNWFSEKSDVEVLRTLLPEV---PNARVADTGDLN---NTETVIDYSVVKSAD 404

Query: 428 DLPE 431
           +LP+
Sbjct: 405 ELPD 408

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
           (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score =  289 bits (739), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 172/439 (39%), Positives = 241/439 (54%), Gaps = 47/439 (10%)

Query: 1   MSGSD--SKDR-LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEI 57
           MS +D  S+DR  Y++LGV  +A+ +EIK  YRKLAL++HPDKS+D+  K +NE KFK+I
Sbjct: 1   MSDTDGSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDI 60

Query: 58  TAAYEILSDPEKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHE- 116
           TAAY+ LSD +K++ YD                               +  +DF N H+ 
Sbjct: 61  TAAYQTLSDEDKRNEYD------------------------NKKNFEPYFESDFANNHDG 96

Query: 117 MYEGNETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKK--KVHVTH 174
            Y     + SKDI ++LS    +LY GK +KF   R  IC  C G GW+ KK  K +V  
Sbjct: 97  NYNSRYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPP 156

Query: 175 EMECESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQ 234
           E+EC+ C G+G K    +  PG   +Q V+C  C G GKY K+P + KNFC DC    L 
Sbjct: 157 EIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLI 216

Query: 235 YKKEVITVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFG 294
              + I V++P G    D + +KG ADEE+ K   GDLIF + E    +      ++++G
Sbjct: 217 KIDDPIVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINE----IIDSNNDLERYG 272

Query: 295 GGNLQDLYVSITVSLSEALTGFE-KXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWP 353
                 L     +SL+EA+TGFE K             S   GKVIRPGDI+++ NEGWP
Sbjct: 273 ----NHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWP 328

Query: 354 ILDHPRGQCGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPI 413
            +D      G+LYV ++IEFPPDNW NEK++++ I+  LP+  ++ +N          PI
Sbjct: 329 -MDKYGASFGNLYVILEIEFPPDNWINEKNDIIKIRNILPNEKTKRNNIV-------DPI 380

Query: 414 NSETVSNFQIIHSDDLPEG 432
           NSE +S F+I+ S    EG
Sbjct: 381 NSEYISTFEIVKSLPQEEG 399

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  289 bits (739), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 177/433 (40%), Positives = 246/433 (56%), Gaps = 38/433 (8%)

Query: 10  LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQ--DSKELNETKFKEITAAYEILSDP 67
           LY VLGV   A+  +IK AYRKLAL+HHPDK V+   D +E +E KFKEI+AAYEILSD 
Sbjct: 4   LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63

Query: 68  EKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSK 127
           +K++HYDLY                              E ++ P+ H  YE  +   S 
Sbjct: 64  DKRAHYDLYGSEEEQQRQQRQYDPFESFFN--------FEQDEEPSRH--YE--DPKRSP 111

Query: 128 DIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKK--KVHVTHEMECESCGGKG 185
           D+ I L  T+++LY GK  KF+ KR +IC  C+G GW+ +K  +V V  E+EC+ C G+G
Sbjct: 112 DVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQG 171

Query: 186 SKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVP 245
             E+++   PG    +   C++C GKGK+  +  + KN C  C   GL  + +V+TV+VP
Sbjct: 172 FTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVP 231

Query: 246 PGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEK---PEDLQQKQVLMKKFGGGNLQDLY 302
            G    D + V   AD+E+ K   GDLIF + E    P+D+Q    L +K  G N     
Sbjct: 232 RGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQ----LERK--GSNFM--- 282

Query: 303 VSITVSLSEALTGF-EKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQ 361
             + +SL+EALTGF +K             SI PGKVIRPG+IIKI  EGWP L+    +
Sbjct: 283 TELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWP-LNGEATK 341

Query: 362 CGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSNF 421
            GDLY+ V+IEFPPDNWF EKS+L  IK  LP STS  +  +      + P+N+E +  F
Sbjct: 342 FGDLYISVNIEFPPDNWFTEKSDLTQIKNILPRSTSDKTKLS------DDPLNTELLLKF 395

Query: 422 QIIHSDDLPEGMK 434
           +++ +  LP+ +K
Sbjct: 396 EVLET--LPDTLK 406

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {ON}
           Anc_8.264 YLR090W
          Length = 439

 Score =  279 bits (714), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 169/457 (36%), Positives = 248/457 (54%), Gaps = 46/457 (10%)

Query: 10  LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELN-----ETKFKEITAAYEIL 64
           LY +L V    +  E+K  YRKLALK+HPDK    D  E +     E KFKEI +AYEIL
Sbjct: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71

Query: 65  SDPEKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETT 124
           SD EK+  YDL                             A++ +D+ +      GN+T 
Sbjct: 72  SDEEKRKQYDL-----------------------QKNFRDANQGSDYGDGINTAFGNQT- 107

Query: 125 SSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKK--KVHVTHEMECESCG 182
            SKDI I L  T+KDLY GK +++++KR +IC KC G GW+++K  K +V    EC++C 
Sbjct: 108 -SKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCD 166

Query: 183 GKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITV 242
           G G K+  ++  PG    Q +VC+ C GKG+Y K+P + KNFC  C   G+    E ITV
Sbjct: 167 GAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITV 226

Query: 243 NVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLY 302
           N+P G    D + +   AD+E+ K   GDLIF L    E++  +Q  +K++G    +DL 
Sbjct: 227 NIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVL----EEIDDEQTALKRYGD---KDLI 279

Query: 303 VSITVSLSEALTGF-EKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQ 361
             +T+SL++A+TGF EK             SI  GKVIR GDI+K+  EGWP L+    +
Sbjct: 280 TELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWP-LNKNATR 338

Query: 362 CGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSD---NSPINSETV 418
            GDLY+  +IEFP DNW +E ++++ I+  LP+ +   ++   +   D   N  +NSE +
Sbjct: 339 SGDLYIKFNIEFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDI 398

Query: 419 SNFQIIHSDDLPEGMKTFNPKPQTSAHQKASSSYCPM 455
           SN+  +   DLP+ + T +       H   S+++  M
Sbjct: 399 SNYDFVK--DLPDIIDTSHNNGAEYGHNGDSANFTEM 433

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR090W
           (XDJ1)
          Length = 427

 Score =  271 bits (694), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 168/463 (36%), Positives = 238/463 (51%), Gaps = 56/463 (12%)

Query: 10  LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEK 69
           LY+VLG+   AS QE+K AYR+LAL++HPDK  D+  +E +E KFKEI+AAY +LSD +K
Sbjct: 5   LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64

Query: 70  KSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPN-----------EHEMY 118
           ++ YD +                             H  +DF N           +HE  
Sbjct: 65  RAEYDQF----------------GTVDGGYGHDEFGHGDDDFMNFFRYGAGRHGYQHEED 108

Query: 119 EGNETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMEC 178
           +  E   + D  + L  T K LY+GK  +F+ +R+++C +C GSG   +K+      + C
Sbjct: 109 DFEEVGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGL--RKRAAARPMIRC 166

Query: 179 ESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKE 238
           E C G+G KER+ R GPGL++ + V C  C GKGK  + P    + C  C    +  ++ 
Sbjct: 167 EGCEGQGYKERISRIGPGLISRERVSCADCGGKGK--RIPTTAADNCKKCTGKCVVQEES 224

Query: 239 VITVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPE---DLQQKQVLMKKFGG 295
           +I+V VP G    D +   G +D E  K   GDL+F + E+ +    L++K         
Sbjct: 225 IISVYVPRGSQHGDRLRYPGQSDMEPGKET-GDLVFVIDEQTDVSSSLERKGT------- 276

Query: 296 GNLQDLYVSITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPIL 355
               DLY ++ +SL+EALTGF +             +I  GKV+RPG+ +K TNEGWPI 
Sbjct: 277 ----DLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIE 332

Query: 356 DHPRGQCGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINS 415
           D  R   GD+YV V IEFP DNWFNEK+EL AI+  LP     PS  T        P N+
Sbjct: 333 DGAR--FGDMYVQVLIEFPKDNWFNEKAELDAIRNILPGLADAPSTKT------EDPSNT 384

Query: 416 ETVSNFQII-HSDDLPEGMKTFNPKPQTSAHQK-ASSSYCPMQ 456
           E V  + II +   LP+ +   N       H+  A +  CPMQ
Sbjct: 385 EEVRAYSIIANHTGLPDYLDRENQGYSRQQHESTAGTPECPMQ 427

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
           similar to Ashbya gossypii AGR084C
          Length = 434

 Score =  270 bits (690), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 164/449 (36%), Positives = 242/449 (53%), Gaps = 21/449 (4%)

Query: 10  LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEK 69
           LY VLG+   A+ QE+K AYR LAL +HPDK  D+  +  +E KFKEI+AAY+ILSD +K
Sbjct: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64

Query: 70  KSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKDI 129
           +S YD Y                             + A  +  ++E  E   +  +KD 
Sbjct: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRY-GQYEDAEQKTSQKTKDF 123

Query: 130 DIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKER 189
            + L  + K LY+GK  +F+LKR ++C KC+G G + K+  H    M+C  C G+G KER
Sbjct: 124 VVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLR-KRAAHCM-PMKCGICDGRGFKER 181

Query: 190 LKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGHH 249
           + R  PG ++ + V C++C GKG    R  +  + C  C    +  +  ++T+ VP GH 
Sbjct: 182 VSRISPGFISRERVPCDECDGKGTVVSR--DPSDNCKKCHGKCVIVENSILTLYVPRGHR 239

Query: 250 FNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVSL 309
             D + + G AD E  K   GDL+F +    +++      +++ G     DL+ SIT+SL
Sbjct: 240 HADTIRIDGQADMEAGKET-GDLVFEI----DEITDPDAELERKG----TDLHCSITISL 290

Query: 310 SEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLYVFV 369
           +EALTGF +             +I  GKV+RPG+ +K TNEGWPI +  R   GDLYV V
Sbjct: 291 AEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSR--FGDLYVKV 348

Query: 370 DIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSNFQIIH-SDD 428
           +IEFP DNW NEKSEL AIK  LP      SN+    G D  P N+E ++++ +I  S  
Sbjct: 349 NIEFPKDNWLNEKSELEAIKHILP-GLKNSSNSHQGDGDD--PANTEDINSYYVIQDSSR 405

Query: 429 LPEGMKTFNPKPQTSAH-QKASSSYCPMQ 456
           LP+ +     +     + ++ ++S CP+Q
Sbjct: 406 LPDYLAQEGQQRSNQQYGERNTASECPVQ 434

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 414

 Score =  267 bits (683), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 153/435 (35%), Positives = 239/435 (54%), Gaps = 28/435 (6%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           Y+ LGV  +A+  EIK AYR+LAL+HHPDK  D+  ++ +E KFKE+ AAYE+LS+ EK+
Sbjct: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKDID 130
            +YD Y                               +N + +E+E  +   +  + D  
Sbjct: 64  QNYDTYGDTNGFSGDYSGFQDGDFASFFGN-----FASNRYQDEYEA-QSPPSPRTDDAH 117

Query: 131 IDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKERL 190
           + +  TM++LY GK ++F+ KR ++C +C+G+G + + +    H   C  C G G K+RL
Sbjct: 118 VPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRAR----HASACSQCEGHGVKQRL 173

Query: 191 KRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGHHF 250
           +R GPG V  + V C+KC G GK  +     ++ C  C    +  + + + V +P G   
Sbjct: 174 RRLGPGFVTREIVQCDKCKGLGKNLRS----EDMCKKCHGKRVTPESKNLNVYIPRGSRH 229

Query: 251 NDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVSLS 310
            D V +KG ADEE  K + GDL+F + E           +++ G     DLY  IT+SLS
Sbjct: 230 GDRVVLKGEADEEPGK-IPGDLVFDIAE-----NSASSSLERRGS----DLYAKITISLS 279

Query: 311 EALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLYVFVD 370
           +ALTGFEK              +  G+V+RPG+ ++I NEGWP LD    + GD+YV +D
Sbjct: 280 DALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWP-LDDQGSKFGDMYVQID 338

Query: 371 IEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSNFQIIHS-DDL 429
           IEFPPD+WF+E+S++ +++  LP + S  + +  N  S + P N+ET   F I+ S ++L
Sbjct: 339 IEFPPDHWFSERSDVKSLQNLLPQAVSSSATSDFN-ASASDPANTETPLKFSIVKSAEEL 397

Query: 430 PEGM-KTFNPKPQTS 443
           P+ + +   P PQ +
Sbjct: 398 PQYLSEESEPGPQCA 412

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score =  260 bits (665), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 165/460 (35%), Positives = 231/460 (50%), Gaps = 58/460 (12%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           YDVLGV ++A+  EI+ AYRKLALK+HPDK +D+  +E +E  FKE+TAAYEILSDPE K
Sbjct: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGN--------- 121
           S YD+Y                             HE +DF N  + Y+           
Sbjct: 134 SRYDMYGDSAFGSGGNGFPEDD-------------HEFDDFMNFFQQYQRQQHGPHASYS 180

Query: 122 --------ETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVT 173
                   E+  + D  I    T + LYMGK + F+LKR+ +C  C G+G +  KK    
Sbjct: 181 NRHQYGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLR--KKHFQK 238

Query: 174 HEMECESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGL 233
            E+ C SC G+G KER+ R   G +     VC+ C GKG+Y  R K+  + C  C   GL
Sbjct: 239 PEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRY--RKKSASDTCKHCSGKGL 296

Query: 234 QYKKEVITVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKF 293
             +++  TV +P G    D   +  MAD E  K   GD+I  +    ED  +  +  K  
Sbjct: 297 INEEKSQTVYIPRGSRHGDEFRLPQMADMEYGKET-GDVIIVI---DEDSSKSHLERKS- 351

Query: 294 GGGNLQDLYVSITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWP 353
                 DL+ ++ +SL +ALTGF               ++  GKVIRPG+  K   EGWP
Sbjct: 352 -----NDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWP 406

Query: 354 ILDHPRGQCGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPI 413
           + +      GD+YV ++IEFP DNWFNEKSE+ A++  LP   S+ +        D  P+
Sbjct: 407 LSNG--DSFGDMYVQINIEFPKDNWFNEKSEITALRNILPGLKSKDTK-------DPDPL 457

Query: 414 NSETVSNFQIIHSDD-----LPEGMKTFNPKPQTSAHQKA 448
           N+E V ++ ++HS D     L E  + +N K Q   H  A
Sbjct: 458 NTEDVLSYSVLHSHDELPDYLAEEKEKYNRKQQEEPHASA 497

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
           similar to uniprot|Q12014 Saccharomyces cerevisiae
           YLR090w
          Length = 452

 Score =  247 bits (630), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 155/453 (34%), Positives = 233/453 (51%), Gaps = 48/453 (10%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSV-----DQDSKELNETKFKEITAAYEILS 65
           Y +LGV ++AS  EIK AYRKLAL+HHPDK+      +  S +L +  FKE+TAAY++LS
Sbjct: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63

Query: 66  DPEKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYE---GNE 122
           D   ++ YD                                     P     ++   G  
Sbjct: 64  DASLRAEYD----------QKLAFEAQPYGDDDFMNFFSGFNGGSHPGHRSGFDSGRGAR 113

Query: 123 TTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKA-----KKKVHVTHEME 177
              S DI+IDL     +LY GKK+ F LKR+  C +C G+GWK+     KKK        
Sbjct: 114 RYKSDDIEIDLKVKTSELYRGKKVNFNLKRKKKCQRCDGTGWKSHASIVKKKTAKFFWNV 173

Query: 178 CESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDC---ESVGLQ 234
           CE C G+G ++RL++  PG V ++ + C +C GKGK    PK+ KN CPDC    +VG+ 
Sbjct: 174 CEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMV 233

Query: 235 YKKEVITVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFG 294
            + +V+T+N+  G    D + +KG ADE+++    GDL+  + E  E   Q  ++   + 
Sbjct: 234 EENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKE--PQYDIVRNGY- 290

Query: 295 GGNLQDLYVSITVSLSEALTGF-EKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWP 353
                DL +   + L++A+ GF EK             S K GKVIRP DI++I NEGWP
Sbjct: 291 -----DLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWP 345

Query: 354 ILDHPRG-----QCGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGS 408
             +         + GDLYV VDI FPPDNW  E ++  A++  +PS+ ++  ++T    S
Sbjct: 346 RREDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESST----S 401

Query: 409 DNSPINSETVSNFQII----HSDDLPEGMKTFN 437
             S +N E ++  +I+    + D+LP+   T++
Sbjct: 402 GESILNVENINVSEIVKEIPNCDELPKFQDTYD 434

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {ON}
           YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig 173]
           FULL
          Length = 414

 Score =  245 bits (625), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 146/421 (34%), Positives = 229/421 (54%), Gaps = 28/421 (6%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           YD LGV  +A+  EIK AYR+LAL+HHPDK  D+  +E +E KFKE+ AAYE+LS+ EK+
Sbjct: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKDID 130
            +YD Y                             +E      + E +  +    + D  
Sbjct: 64  RNYDTYGDTNGYSDSYGGFQDGDFASFFGNFASGRYE------DEEDFRAHARPRTDDAH 117

Query: 131 IDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKERL 190
           + L  TM+DLY GK ++F+  R ++C +C+G+G + + +    H   C  C G G K+RL
Sbjct: 118 VSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRAR----HASACTHCEGHGVKQRL 173

Query: 191 KRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGHHF 250
           +R GPG V  + V C KC G GK  +     ++ C  C    +  + + + V +P G   
Sbjct: 174 RRLGPGFVTRETVQCTKCRGLGKNLRS----EDLCKKCHGKRVTPETKNLNVYIPRGSRH 229

Query: 251 NDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVSLS 310
           ND + ++G ADEE  K + GDL+F + E           +++ G     DL+  I +SLS
Sbjct: 230 NDRIVLEGEADEEPGK-LTGDLVFDISE-----DSTTSNLERRG----SDLHTKIIISLS 279

Query: 311 EALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLYVFVD 370
           +ALTGFEK              I  G+VIRPG+ I + NEGWP+ D  + + G++YV ++
Sbjct: 280 DALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGK-KFGNMYVQIN 338

Query: 371 IEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSNFQIIHS-DDL 429
           IEFPPD+W++E+ E+ A++  +P STS  + ++  + ++  P+N+E +  F I+ S ++L
Sbjct: 339 IEFPPDHWYSERGEIEALRNIIPQSTSSSAASSSAS-AEPDPVNTE-MPTFDILKSAEEL 396

Query: 430 P 430
           P
Sbjct: 397 P 397

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.264
           YLR090W
          Length = 432

 Score =  228 bits (581), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 154/452 (34%), Positives = 229/452 (50%), Gaps = 32/452 (7%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           YD+LGV R+++  EI+ AYRKLALK HPDK +D + K  NE KFKEIT AYEILS+ E  
Sbjct: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNGEYV 66

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKDID 130
                                             AH     P + E    NE T      
Sbjct: 67  EE-----MEEEYEGQGYGFNFGDDFMNFFNEGRNAHPMGGHP-QREDESTNEATQ----- 115

Query: 131 IDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKK--VHVTHEMECESCGGKGSKE 188
           I++  T+KDLY GK +KF+L R +IC  C G+ W+ +K   ++    + C  C G G  E
Sbjct: 116 IEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVE 175

Query: 189 RLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGH 248
           RL    P     Q + C KC GKG+YT +P + KN C  C   GL  +K+ + V +P G 
Sbjct: 176 RLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGS 235

Query: 249 HFNDVVTVKGMADEEIDKAVCGDLIFHL-VEKPEDLQQKQVLMKKFGGGNLQDLYVSITV 307
             ++ +  K   DE++     GD++F L +    +     +L+ K G     DL+++I +
Sbjct: 236 ENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEG----TDLHMNIEI 291

Query: 308 SLSEALTGFE-KXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRG-QCGDL 365
            L EA++G + +             ++  GKV+RPGD I I  EGWP    P G + GD+
Sbjct: 292 PLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWP--KTPNGTEFGDM 349

Query: 366 YVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSNFQIIH 425
           +V V++EFPPDNW +E++++  +   LP+  S   +    TG  N   N+E V +++I+ 
Sbjct: 350 FVHVNVEFPPDNWISERNDITTLTNVLPAGKS--DDGHAQTGDAN---NAEFVKDYEILK 404

Query: 426 SDDLPEGMKTFNPKPQTSAHQKASSSY-CPMQ 456
           + D  EG ++ N K  T++   A   Y C +Q
Sbjct: 405 ATD--EGTRSSNTK--TASRPPAQGLYKCSIQ 432

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {ON}
           Anc_2.243
          Length = 411

 Score =  156 bits (395), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 126/390 (32%), Positives = 186/390 (47%), Gaps = 38/390 (9%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           + YD+LGV+  AS  EIK AYRK ALK+HPDK+  +++ E    KFKE +AAYE+LSD E
Sbjct: 6   KFYDILGVSPSASSSEIKKAYRKFALKYHPDKNPSEEAAE----KFKEASAAYEVLSDDE 61

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKD 128
           K+  YD +                                                  +D
Sbjct: 62  KREMYDQFGPEGMNGGPGGPGGFGGFGGFGDDIFSQFFGGA----GAGAGRPRGPQRGRD 117

Query: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWK--AKKKVHVTHEMECESCGGKGS 186
           I  +LS T+++LY G+  K  L +QI+C  C+G G K  A KK        C SC G+G 
Sbjct: 118 IKHELSATLEELYKGRTAKLALNKQILCKTCEGRGGKKGAVKK--------CSSCNGQGV 169

Query: 187 KERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPP 246
           K   ++ GP L   Q   CE CHG G     PK+R   C  C +  +  +++++ V++ P
Sbjct: 170 KFVTRQMGPMLQRFQ-AECEVCHGTGDIID-PKDR---CKTCNAKKVTNERKILEVHIEP 224

Query: 247 GHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSIT 306
           G      V  KG AD+  D  + GD+IF + +KP +  Q+         G+  DL     
Sbjct: 225 GMKDGQKVVFKGEADQAPD-IIPGDVIFVVSQKPHEHFQR--------AGD--DLVYEAE 273

Query: 307 VSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLY 366
           + L  A+ G E              +I PG+VI PG    I+++G PI  +  G  G+L 
Sbjct: 274 IDLLTAIAGGE-FAIKHVSGEWLKVAIVPGEVISPGARKIISDKGMPIPKY--GGYGNLI 330

Query: 367 VFVDIEFPPDNWFNEKSELLAIKTHLPSST 396
           V  +I+FPP+++ +E+S L  ++  LP  T
Sbjct: 331 VKFNIKFPPNHFTDEES-LKKLEEILPPRT 359

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  152 bits (384), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 134/436 (30%), Positives = 196/436 (44%), Gaps = 53/436 (12%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           +LYD+LGV+  AS  EIK AYRK ALK+HPDK+  +++ E    KFKE ++AYE+LSD E
Sbjct: 6   KLYDILGVSPTASDSEIKKAYRKQALKYHPDKNPSEEAAE----KFKEASSAYEVLSDSE 61

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKD 128
           K+  YD +                                + F               +D
Sbjct: 62  KRDIYDQFGQDGLSGNGGMPGGAGGFGFGEDLF-------SQFFGGAGASRPRGPQRGRD 114

Query: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWK--AKKKVHVTHEMECESCGGKGS 186
           I  ++S ++++LY GK  K  L +QI+C  C+G G K  A KK        C SC G+G 
Sbjct: 115 IKHEISVSLEELYKGKTSKLALNKQILCKTCEGRGGKKGAVKK--------CSSCNGQGI 166

Query: 187 KERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPP 246
           K   ++ GP ++      C+ CHG G       + K+ C DC    +  +++++ VNV P
Sbjct: 167 KFVTRQMGP-MIQRFQTECDVCHGTGDII----DAKDRCKDCHGKKIANERKILQVNVDP 221

Query: 247 GHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSIT 306
           G      V  KG AD+  D  + GD+IF + EKP    Q+             DL     
Sbjct: 222 GMKNGQKVVFKGEADQAPD-IIPGDVIFVISEKPHKHFQRVG----------DDLIYEAE 270

Query: 307 VSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLY 366
           + L  A+ G E              SI PG+VI P     +  +G PI  +  G  G+L 
Sbjct: 271 IDLLTAVAGGE-FALEHVSGEWLKVSIVPGEVIAPNMRKVVEGKGMPIQKY--GGYGNLI 327

Query: 367 VFVDIEFPPDNWFNEKS-----ELLAIKTHLPSSTSRPSNTTVN--TGSDNSPI---NSE 416
           +   I+FP +++ +E +     E+L  +  LP+    P N  V+    SD +P    NS 
Sbjct: 328 IKFSIKFPENHFADEDTLKKLEEILPARKPLPTF---PKNAIVDDCVLSDYNPSRHDNSR 384

Query: 417 TVSNFQIIHSDDLPEG 432
                   HSDD  EG
Sbjct: 385 GARGGASYHSDDEDEG 400

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {ON}
           Anc_2.243 YNL064C
          Length = 410

 Score =  152 bits (384), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 120/385 (31%), Positives = 178/385 (46%), Gaps = 35/385 (9%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           + YD+LGV+  AS  EIK  YRK ALK+HPDK+   ++ E    KFKE +AAYE+LSDPE
Sbjct: 6   KFYDILGVSPTASESEIKKGYRKAALKYHPDKNPTAEAAE----KFKECSAAYEVLSDPE 61

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKD 128
           K+  YD Y                                + F               +D
Sbjct: 62  KRDVYDQYGEEGLSSGGPGGPGGFGGFGGFGDDIF-----SQFFGGGASQRPRGPQKGRD 116

Query: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKE 188
           I  +++ T+++LY G+  K  L +QI+C  C+G G KA          +C SCGG+G K 
Sbjct: 117 IKHEIAATLEELYKGRTAKLALNKQILCKSCEGRGGKADAV------KKCSSCGGQGIKF 170

Query: 189 RLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGH 248
             K+ GP ++      C+ CHG G     PK R   C  C    +  +++++ V + PG 
Sbjct: 171 VTKQMGP-MIQRFQTECDVCHGTGDIID-PKGR---CKSCHGKKIANERKILEVKIEPGM 225

Query: 249 HFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVS 308
                +  KG +D+  D  + GD++F + EKP    Q+         GN  DL     + 
Sbjct: 226 KDGQRIVFKGESDQAPD-IIPGDVVFVVNEKPHKHFQRS--------GN--DLVYLAEID 274

Query: 309 LSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLYVF 368
           L  A+ G E              +I  G+VI PG    I  +G PIL +  G  G+L + 
Sbjct: 275 LLTAIAGGE-FALEHVSGEWLKIAIVAGEVIAPGAKKVIEGKGMPILKY--GGYGNLIIQ 331

Query: 369 VDIEFPPDNWFNEKSELLAIKTHLP 393
            +I+F P+N F ++S L  ++  LP
Sbjct: 332 FNIKF-PENHFTDESNLKKLEEILP 355

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {ON}
           Anc_2.243 YNL064C
          Length = 407

 Score =  150 bits (378), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 123/403 (30%), Positives = 190/403 (47%), Gaps = 47/403 (11%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           + YD+LGV+  AS  EIK  YRK ALK+HPDK+  +++ E    KFKE +AAYE+LSD +
Sbjct: 6   KFYDLLGVSPNASETEIKKGYRKQALKYHPDKNPSEEAAE----KFKECSAAYEVLSDSQ 61

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSS-- 126
           K+  YD Y                                +D  ++     G +  S   
Sbjct: 62  KREVYDQYGEEGLNGGGAGGFPGGG-----------FGFGDDIFSQFFGGAGAQRPSGPQ 110

Query: 127 --KDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGK 184
             +DI  ++  T+++LY G+  K  L +QI+C  C+G G KA          +C SC G+
Sbjct: 111 RGRDIKHEIQNTLEELYKGRTAKLALNKQILCKTCEGRGGKA------GAVKKCTSCNGQ 164

Query: 185 GSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNV 244
           G K   ++ GP ++      C+ CHG G     PK+R   C DC+   +  +++V+ V+V
Sbjct: 165 GIKFVTRQMGP-MIQRFQTECDVCHGSGDIID-PKDR---CKDCKGKKIANERKVLEVHV 219

Query: 245 PPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVS 304
            PG      +  KG AD+  D  + GD+IF +VEKP          K+ G     DL   
Sbjct: 220 EPGMREGQKIVFKGEADQAPD-VIPGDVIFVVVEKPHK------HFKRAG----DDLLYE 268

Query: 305 ITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGD 364
             + L  A+ G E              ++ PG+VI  G    I  +G P+  +  G  G+
Sbjct: 269 AEIDLLTAIAGGEFAIQHVSGDWLKVSTV-PGEVISSGMKKVIEGKGMPVPKY--GGYGN 325

Query: 365 LYVFVDIEFPPDNWFNEKSELLAIKTHLPSST--SRPSNTTVN 405
           L V   I+FP +N+  E  +L  ++  LP+ T  S P+  +++
Sbjct: 326 LIVTFKIKFPENNFATE-DKLKELENILPARTPVSIPAKASID 367

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {ON}
           complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score =  149 bits (377), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 124/390 (31%), Positives = 182/390 (46%), Gaps = 41/390 (10%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           + YD+LGV+  AS  EIK  YRK ALK+HPDK+   ++ E    KFKE + AYE+LSD +
Sbjct: 6   KFYDLLGVSPNASESEIKKGYRKAALKYHPDKNPTDEAAE----KFKECSGAYEVLSDSQ 61

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKD 128
           K+  YD Y                                + F               KD
Sbjct: 62  KREIYDQYGEEGLSGGGPGAGFGGFGGFGDDIF-------SQFFGGAGASRPRGPQRGKD 114

Query: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWK--AKKKVHVTHEMECESCGGKGS 186
           I  ++  T+++LY G+  K  L +QI+C  C+G G K  A KK        C SCGG+G 
Sbjct: 115 IRHEIQNTLEELYKGRTAKLALNKQILCKGCEGRGGKEGAVKK--------CSSCGGQGV 166

Query: 187 KERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPP 246
           K   ++ GP ++      C+ CHG G     PK+R   C +C+   +  +++V+ V+V P
Sbjct: 167 KFVTRQMGP-MIQRFQTECDVCHGSGDIID-PKDR---CKECKGNKVANERKVLEVHVEP 221

Query: 247 GHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSIT 306
           G      VT KG AD+  D  + GD+IF + EKP          K+ G     DL     
Sbjct: 222 GMREGQKVTFKGEADQAPD-IIPGDVIFVVTEKPHK------HFKRSG----DDLLYEAE 270

Query: 307 VSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLY 366
           V L  A+ G +              +I PG+VI PG    I  +G P+  +  G  G+L 
Sbjct: 271 VDLLTAIAGGD-FAIEHVSGDWLKVTIVPGEVISPGVRKVIDGKGMPVQKY--GGYGNLI 327

Query: 367 VFVDIEFPPDNWFNEKSELLAIKTHLPSST 396
           +   I+F P+N F ++++L A++  LP  T
Sbjct: 328 ITFKIKF-PENHFADEAKLKALEDILPPRT 356

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
           YDJ1Type I HSP40 co-chaperone involved in regulation of
           the HSP90 and HSP70 functions; involved in protein
           translocation across membranes; member of the DnaJ
           family
          Length = 409

 Score =  145 bits (365), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 122/401 (30%), Positives = 183/401 (45%), Gaps = 42/401 (10%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           + YD+LGV   A+  EIK AYRK ALK+HPDK+  +++ E    KFKE +AAYEILSDPE
Sbjct: 6   KFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAE----KFKEASAAYEILSDPE 61

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKD 128
           K+  YD +                               A           G      KD
Sbjct: 62  KRDIYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQRG------KD 115

Query: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWK--AKKKVHVTHEMECESCGGKGS 186
           I  ++S ++++LY G+  K  L +QI+C +C+G G K  A KK        C SC G+G 
Sbjct: 116 IKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKK--------CTSCNGQGI 167

Query: 187 KERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPP 246
           K   ++ GP ++      C+ CHG G     PK+R   C  C    ++ +++++ V+V P
Sbjct: 168 KFVTRQMGP-MIQRFQTECDVCHGTGDIID-PKDR---CKSCNGKKVENERKILEVHVEP 222

Query: 247 GHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSIT 306
           G      +  KG AD+  D  + GD++F + E+P    ++          +  DL     
Sbjct: 223 GMKDGQRIVFKGEADQAPD-VIPGDVVFIVSERPHKSFKR----------DGDDLVYEAE 271

Query: 307 VSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLY 366
           + L  A+ G E               I PG+VI PG    I  +G PI  +  G  G+L 
Sbjct: 272 IDLLTAIAGGE-FALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKY--GGYGNLI 328

Query: 367 VFVDIEFPPDNWFNEKSELLAIKTHLPSST--SRPSNTTVN 405
           +   I+F P+N F  +  L  ++  LP     + P   TV+
Sbjct: 329 IKFTIKF-PENHFTSEENLKKLEEILPPRIVPAIPKKATVD 368

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {ON}
           Anc_2.243
          Length = 410

 Score =  145 bits (365), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 130/426 (30%), Positives = 191/426 (44%), Gaps = 41/426 (9%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           +LYDVLGV+  A   EIK AYRK ALK+HPDK+  ++  E    KFKE++AAYEILSD E
Sbjct: 6   KLYDVLGVSPTAGDSEIKKAYRKSALKYHPDKNPTEEGAE----KFKEVSAAYEILSDSE 61

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKD 128
           K+  YD +                                                  +D
Sbjct: 62  KREIYDQFGEEGLNGGGPGGPGGFGGFGGFGDDIFSQFFGG---AGAGAGRPRGPQRGRD 118

Query: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWK--AKKKVHVTHEMECESCGGKGS 186
           I  +++ T+++LY G+  K  L +QI+C  C+G G K  A KK        C SC G+G 
Sbjct: 119 IKHEIAATLEELYKGRTAKLALNKQILCKTCEGRGGKKGAVKK--------CSSCNGQGV 170

Query: 187 KERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPP 246
           K   ++ GP ++      C+ C G G     PK+R   C  C +  +  +++++ V++ P
Sbjct: 171 KFVTRQMGP-MIQRFQAECDVCSGTGDIID-PKDR---CKTCNAKKVTNERKILEVHIEP 225

Query: 247 GHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSIT 306
           G      +  KG AD+  D  + GD+IF + +KP    Q+          +  DL     
Sbjct: 226 GMKDGQNIVFKGEADQAPD-VIPGDVIFVVAQKPHKHFQR----------SGDDLVYEAE 274

Query: 307 VSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLY 366
           + L  A+ G E              SI PG+VI PG    I  +G PI  +  G  G+L 
Sbjct: 275 IDLLTAIAGGE-FALEHVSGDWLKVSILPGEVISPGSKKVIEGKGMPIPKY--GGHGNLI 331

Query: 367 VFVDIEFPPDNWFNEKSELLAIKTHLP--SSTSRPSNTTVN--TGSDNSPINSETVSNFQ 422
           V   ++FP  ++ +E S L  ++  LP     S P+N TV+    S+  P  S      Q
Sbjct: 332 VHFTVKFPQKHFADEDS-LKKLEEILPPRKKISIPANATVDDCVLSEYDPSKSSARRGGQ 390

Query: 423 IIHSDD 428
              SDD
Sbjct: 391 SYDSDD 396

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.243
           YNL064C
          Length = 409

 Score =  143 bits (360), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 120/392 (30%), Positives = 181/392 (46%), Gaps = 45/392 (11%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           +LYDVLGV+  A+  EIK AYRK+ALK HPDK+  +++ E    KFKE ++AYE+LSD +
Sbjct: 6   KLYDVLGVSVTATDVEIKKAYRKMALKFHPDKNPSEEAAE----KFKEASSAYEVLSDAD 61

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKD 128
           K+  YD +                                + F               +D
Sbjct: 62  KRDTYDQFGLEGLSGAGGMGGAGGGFGFGDDIF-------SQFFGGAGAQRPRGPQRGRD 114

Query: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWK--AKKKVHVTHEMECESCGGKGS 186
           I  +++ T+++LY GK  K  L +QI+C  C+G G K  A KK        C SC G+G 
Sbjct: 115 IKHEINVTLEELYRGKTSKLALNKQILCKTCEGRGGKKGAVKK--------CSSCNGQGI 166

Query: 187 KERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPP 246
           K   ++ GP ++      C+ CHG G     PK+R   C  C    +  +++++ V+V P
Sbjct: 167 KFVTRQMGP-MIQRFQTECDVCHGAGDIVD-PKDR---CKSCNGKKVASERKILEVHVDP 221

Query: 247 GHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSIT 306
           G      V  KG AD+  D  + GD++F + EKP    Q+        G N   L     
Sbjct: 222 GMKNGQKVVFKGEADQAPD-VIPGDVVFVINEKPHKHFQRS-------GDN---LVYEAE 270

Query: 307 VSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLY 366
           V L  A+ G E              +I PG+VI PG    I  +G P+  +  G  G+L 
Sbjct: 271 VDLLTAIAGGE-FAIEHVSGDWLKVAIVPGEVIAPGARKVIDGKGMPVAKY--GGYGNLI 327

Query: 367 VFVDIEFPPDNWFNEKS-----ELLAIKTHLP 393
           +   ++FP  ++  E++     E+L  +T LP
Sbjct: 328 IKFTVKFPEPHFTTEENLKKLEEILPQRTPLP 359

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064c YDJ1
          Length = 407

 Score =  142 bits (358), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 113/387 (29%), Positives = 175/387 (45%), Gaps = 42/387 (10%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           +LYD LGV+  AS  EIK AYRK ALK+HPDK+  +++ E    KFKE+++AYEILSD +
Sbjct: 6   KLYDTLGVSPGASDAEIKKAYRKSALKYHPDKNPSEEAAE----KFKEVSSAYEILSDSQ 61

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKD 128
           K+  YD +                                   P   +          +D
Sbjct: 62  KREVYDQFGEEGLSGNGGAGFPGGFGFGEDIFSQFFGGATGGRPRGPQ--------RGRD 113

Query: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWK--AKKKVHVTHEMECESCGGKGS 186
           I  +++ ++++LY G+  K  L +QI+C  C+G G K  A KK        C SC G+G 
Sbjct: 114 IKHEMAASLEELYKGRTAKLALNKQILCKSCEGRGGKEGAVKK--------CSSCNGQGI 165

Query: 187 KERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPP 246
           K   ++ GP ++      C+ CHG G       + K+ C  C    +  +++++ V + P
Sbjct: 166 KFVTRQMGP-MIQRFQTECDVCHGTGDII----DAKDRCKSCNGKKVDNERKILEVRIEP 220

Query: 247 GHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSIT 306
           G      +  KG AD+  D  + GD++F + EKP    Q+             DL     
Sbjct: 221 GMKDGQKIVFKGEADQAPD-VIPGDVVFVISEKPHKHFQRAG----------DDLIYEAE 269

Query: 307 VSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLY 366
           + L  AL G +               I PG+VI PG    +  +G PI  +  G  G+L 
Sbjct: 270 IDLLTALAGGQ-FALEHVSGDWLKVDIVPGEVIAPGARKIVEGKGMPIQKY--GGYGNLL 326

Query: 367 VFVDIEFPPDNWFNEKSELLAIKTHLP 393
           +  +I+F P+N F  +  L  ++  LP
Sbjct: 327 IKFNIKF-PENHFTSEENLKKLEEILP 352

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  142 bits (357), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 122/400 (30%), Positives = 177/400 (44%), Gaps = 41/400 (10%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           + YD+LGV+  A+  EIK AYRK ALK+HPDK+   ++ E    KFKE+++AYE+LSD E
Sbjct: 6   KYYDLLGVSVSATEIEIKKAYRKSALKYHPDKNPSAEAAE----KFKEVSSAYEVLSDSE 61

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKD 128
           K+  YD +                               +  F               +D
Sbjct: 62  KRQVYDQFGEEGLSGGAGGAGGFGGFGGYGDDIF-----SQFFGGAPGGGRPRGPQRGRD 116

Query: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWK--AKKKVHVTHEMECESCGGKGS 186
           I  +++ T+++LY G+  K  L +QI+C  C G G K  A KK        C SC G+G 
Sbjct: 117 IKHEIAVTLEELYKGRTAKLALNKQILCKGCNGRGGKEGAVKK--------CSSCNGQGY 168

Query: 187 KERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPP 246
           K   ++ GP ++      CE C G G     PK+R   C  C    +  +++++ V+V P
Sbjct: 169 KFVTRQMGP-MIQRFQTECEACAGTGDIID-PKDR---CKSCNGKKVANERKILEVHVDP 223

Query: 247 GHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSIT 306
           G      +  KG AD+  D  + GD+IF + EKP    Q+             DL     
Sbjct: 224 GMKDGQKIVFKGEADQAPD-VIPGDVIFVVSEKPHKNFQRVG----------DDLVYEAE 272

Query: 307 VSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLY 366
           + L  A+ G E              +I PG+VI PG    +  +G PI     G  G+L 
Sbjct: 273 IDLLTAVAGGE-FSLEHVSGDWLKVAIVPGEVISPGMRKVVEGKGMPIAKF--GGYGNLL 329

Query: 367 VFVDIEFPPDNWFNEKSELLAIKTHLP--SSTSRPSNTTV 404
           V   I FPP N F     L  ++  LP  + T+ PS   V
Sbjct: 330 VTFKINFPP-NHFTSDENLKKLEEILPPRAKTTIPSKAHV 368

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {ON}
           YNL064C (REAL)
          Length = 410

 Score =  141 bits (356), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 118/401 (29%), Positives = 183/401 (45%), Gaps = 41/401 (10%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           + YD+LGV+  A+  EIK AYRK ALK+HPDK+  +++ E    KFKE ++AYEILSD E
Sbjct: 6   KFYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAE----KFKEASSAYEILSDSE 61

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKD 128
           K+  YD +                               +  F               KD
Sbjct: 62  KRDVYDQFGEDGLSGAGGAGGFPGGGFGFGDDIF-----SQFFGGAGGAQRPRGPQRGKD 116

Query: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWK--AKKKVHVTHEMECESCGGKGS 186
           I  ++S ++++LY G+  K  L +QI+C  C+G G K  A KK        C SC G+G 
Sbjct: 117 IKHEISASLEELYKGRTAKLALNKQILCKGCEGRGGKKGAVKK--------CSSCNGQGI 168

Query: 187 KERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPP 246
           K   ++ GP ++      C+ CHG G     PK+R   C  C    ++ +++++ V+V P
Sbjct: 169 KFVTRQMGP-MIQRFQTECDVCHGTGDIVD-PKDR---CKSCNGKKVENERKILEVHVEP 223

Query: 247 GHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSIT 306
           G      +  KG AD+  D  + GD++F + E+P    ++          +  DL     
Sbjct: 224 GMKDGQRIVFKGEADQAPD-VIPGDVVFLVSERPHKSFKR----------DGDDLVYEAE 272

Query: 307 VSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLY 366
           + L  A+ G E               I PG+VI PG    I  +G P+  +  G  G+L 
Sbjct: 273 IDLLTAIAGGE-FALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKY--GGYGNLI 329

Query: 367 VFVDIEFPPDNWFNEKSELLAIKTHLPSST--SRPSNTTVN 405
           +   ++F P+N F  +  L  ++  LP  T  + P   TV+
Sbjct: 330 IKFTVKF-PENHFTAEENLKKLEEILPPRTVPAIPKKATVD 369

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 409

 Score =  141 bits (355), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 116/398 (29%), Positives = 187/398 (46%), Gaps = 41/398 (10%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           +LYD+LGV+  A   +IK AYRK ALK HPDK+  +++ E    KFKEIT+AYEILSD +
Sbjct: 6   KLYDLLGVSPGADDNQIKKAYRKSALKFHPDKNPSEEAAE----KFKEITSAYEILSDSQ 61

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKD 128
           K+  YD +                               +  F        G +    +D
Sbjct: 62  KREVYDQFGLEGLSGQGAGGPGGFGGFGEDLF-------SQFFGGGSSRPRGPQ--KGRD 112

Query: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKE 188
           I  ++  T++ L+ G+  K  L +Q+IC  C+G G K           +C +C G+G K 
Sbjct: 113 IRHEIPATLEQLFKGRTAKLALNKQLICKSCEGRGGKE------GSVKKCTACSGQGFKF 166

Query: 189 RLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGH 248
             ++ GP ++    V CE CHG G+    PK R   C  C    +  +++V+ VN+ PG 
Sbjct: 167 VTRQMGP-MIQRFQVECESCHGAGEIID-PKGR---CKVCSGKKVVNERKVLEVNIEPGM 221

Query: 249 HFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVS 308
                +  +G AD+     + GD++F + E+P  + ++         GN  DL+    + 
Sbjct: 222 KDGQRIVFQGEADQS-PGIIPGDVVFVVSEQPHPVFKRD--------GN--DLHYDAEID 270

Query: 309 LSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLYVF 368
           L  A+ G  +              I PG+VI PG +  I  +G PI  +  G  G+L + 
Sbjct: 271 LLSAIAG-GQFAVKHVSGEYLKVEIVPGEVISPGSVKVIEGKGMPIPKY--GGYGNLLIK 327

Query: 369 VDIEFPPDNWFNEKSELLAIKTHLPSST--SRPSNTTV 404
            +I+FPP ++ ++++ L  ++  LP     S P++  V
Sbjct: 328 FNIKFPPAHFTDDET-LKKLEEILPPRNVPSIPADAEV 364

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  140 bits (354), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 120/401 (29%), Positives = 182/401 (45%), Gaps = 42/401 (10%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           + YD+LGV+  A+  EIK AYRK ALK+HPDK+  +++ E    KFKE ++AYEILSD E
Sbjct: 6   KFYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAE----KFKEASSAYEILSDSE 61

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKD 128
           K+  YD +                               A           G      KD
Sbjct: 62  KREVYDQFGEEGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQRG------KD 115

Query: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWK--AKKKVHVTHEMECESCGGKGS 186
           I  ++S ++++LY G+  K  L +QI+C  C+G G K  A KK        C SC G+G 
Sbjct: 116 IKHEISASLEELYKGRTAKLALNKQILCKGCEGRGGKKGAVKK--------CSSCNGQGI 167

Query: 187 KERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPP 246
           K   ++ GP ++      C+ CHG G     PK+R   C  C    ++ +++++ V+V P
Sbjct: 168 KFVTRQMGP-MIQRFQTECDVCHGTGDIID-PKDR---CKSCNGKKVENERKILEVHVEP 222

Query: 247 GHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSIT 306
           G      +  KG AD+  D  + GD++F + E+P    ++          +  DL     
Sbjct: 223 GMKDGQRIVFKGEADQAPD-VIPGDVVFIVSERPHKNFKR----------DGDDLVYEAE 271

Query: 307 VSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLY 366
           + L  A+ G E               I PG+VI PG    I  +G PI  +  G  G+L 
Sbjct: 272 IDLLTAIAGGE-FALEHVSGDWLKVGIVPGEVISPGMRKVIEGKGMPIPKY--GGYGNLV 328

Query: 367 VFVDIEFPPDNWFNEKSELLAIKTHLPSST--SRPSNTTVN 405
           +   I+F P+N F  +  L  ++  LP     + P   TV+
Sbjct: 329 IKFTIKF-PENHFTTEENLKKLEEILPPRIVPAIPKKATVD 368

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  139 bits (351), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 117/401 (29%), Positives = 183/401 (45%), Gaps = 42/401 (10%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           + YD+LGV+  A+  EIK AYRK ALK HPDK+  +++ E    KFKE ++AYE+LSD E
Sbjct: 6   KFYDILGVSVTATDVEIKKAYRKCALKFHPDKNPSEEAAE----KFKEASSAYEVLSDSE 61

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKD 128
           K+  YD +                               A           G      +D
Sbjct: 62  KREVYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPKGPQRG------RD 115

Query: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWK--AKKKVHVTHEMECESCGGKGS 186
           I  ++S ++++LY G+  K  L +QI+C +C+G G K  A KK        C  C G+G 
Sbjct: 116 IKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKK--------CTGCNGQGI 167

Query: 187 KERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPP 246
           K   ++ GP ++      C+ CHG G     PK+R   C  C    ++ +++++ V+V P
Sbjct: 168 KFVTRQMGP-MIQRFQTECDACHGTGDIVD-PKDR---CKSCNGKKIENERKILEVHVEP 222

Query: 247 GHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSIT 306
           G      +  KG AD+  D  + GD++F + E+P    ++          +  DL     
Sbjct: 223 GMKDGQKIVFKGEADQAPD-VIPGDVVFLVSERPHKHFKR----------DGDDLVYEAE 271

Query: 307 VSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLY 366
           + L  A+ G E               I PG+VI PG    I  +G P+  +  G  G+L 
Sbjct: 272 IDLLTAIAGGE-FALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKY--GGYGNLI 328

Query: 367 VFVDIEFPPDNWFNEKSELLAIKTHLP--SSTSRPSNTTVN 405
           V   I+F P+N F  +  L  ++  LP  ++ + P   TV+
Sbjct: 329 VKFTIKF-PENHFTTEENLKKLEEILPPRATPTIPKKATVD 368

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL064C
           (YDJ1)
          Length = 410

 Score =  139 bits (350), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 107/388 (27%), Positives = 183/388 (47%), Gaps = 35/388 (9%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           +LYD+LGV+ +A+  +IK AYRK ALK+HPDK+  +++ +    KFK+IT AYEILSD +
Sbjct: 6   KLYDLLGVSPDANDAQIKKAYRKSALKYHPDKNPSEEAAD----KFKQITGAYEILSDSQ 61

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKD 128
           K+  YD +                                + F               +D
Sbjct: 62  KREMYDQFGEEGLNGGGQGGPGGFGGFGGFGEDIF-----SQFFGGGGASRPRGPQKGRD 116

Query: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKE 188
           I  D+S T+++LY G+  K  L + ++C +C+G G KA          +C SC G+G K 
Sbjct: 117 IRHDISCTLENLYKGRAAKLALNKTVLCKRCEGRGGKA------GSVKKCTSCNGQGVKF 170

Query: 189 RLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGH 248
             +  GP ++      CE C+G+G          + C DC+   +  +++++ VN+ PG 
Sbjct: 171 VTRHMGP-MIQRFQTTCEVCNGEGDVIP----AADRCKDCDGKKIASERKILEVNIQPGM 225

Query: 249 HFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVS 308
                +  +G AD++  + + GD++F + E     Q+    ++     N  +L+    + 
Sbjct: 226 KHGQKIVFQGEADQQPGQ-IPGDVVFVVNE-----QEHPRFVR-----NGDNLHYEAEID 274

Query: 309 LSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLYVF 368
           L  A+ G +               I PG+VI PG +  I  +G PI  +  G  GDL + 
Sbjct: 275 LLTAIAGGQ-FALEHVSGDWLKIDIVPGEVIAPGMVKVIEGKGMPIQKY--GSYGDLLIK 331

Query: 369 VDIEFPPDNWFNEKSELLAIKTHLPSST 396
            +++FP  ++ +E++ L  ++  LP  T
Sbjct: 332 FNVKFPKSHFADEEA-LKKLEAILPPKT 358

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {ON}
           highly similar to gnl|GLV|CAGL0J09966g Candida glabrata
           CAGL0J09966g and similar to YNL064C uniprot|P25491
           Saccharomyces cerevisiae YNL064C YDJ1 yeast dnaJ homolog
           (nuclear envelope protein) heat shock protein
          Length = 412

 Score =  139 bits (349), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 120/406 (29%), Positives = 185/406 (45%), Gaps = 50/406 (12%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           + YD+LGV+  AS  EIK AYRK ALK+HPDK+  +++ E    KFKE ++AYE+L D E
Sbjct: 6   KFYDLLGVSATASETEIKKAYRKTALKYHPDKNPSEEAAE----KFKEASSAYEVLMDAE 61

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNET----- 123
           K+  YD +                                +D  ++   + G  +     
Sbjct: 62  KREAYDQFGEEGLSGAGAAGGGFGGFGGF-------GGFGDDLFSQ--FFGGGASRPRGP 112

Query: 124 TSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWK--AKKKVHVTHEMECESC 181
              +DI  +++ T+++LY G+  K  L +QI+C  C+G G K  A KK        C SC
Sbjct: 113 QRGRDIKHEITVTLEELYKGRTSKLALNKQILCKTCEGRGGKEGAVKK--------CTSC 164

Query: 182 GGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVIT 241
            G+G K   ++ GP ++      C+ C G G     PK+R   C  C    +  +++++ 
Sbjct: 165 NGQGVKFITRQMGP-MIQRFQTECDACDGTGDII-NPKDR---CKACSGKKVANERKILE 219

Query: 242 VNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDL 301
           V+V PG      +  KG AD+  D  + GD+IF + E+P    ++          +  DL
Sbjct: 220 VHVDPGMKDGQKIVFKGEADQAPD-IIPGDVIFVVSERPHKHFRR----------DSDDL 268

Query: 302 YVSITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQ 361
                + L  A+ G E               I PG+VI PG    I  +G P+L +  G 
Sbjct: 269 VYEADIDLLTAIAGGE-FAIEHVSGDWLKVEIVPGEVISPGMRKVIEGKGMPVLKY--GG 325

Query: 362 CGDLYVFVDIEFPPDNWFNEKSELLAIKTHLP--SSTSRPSNTTVN 405
            G+L V  +I FP D+ F     +  ++  LP    TS PS   V+
Sbjct: 326 FGNLLVKFNIVFPKDH-FTSLENMKKLEEILPPRKKTSIPSKAHVD 370

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL257C
          Length = 409

 Score =  137 bits (346), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 108/385 (28%), Positives = 182/385 (47%), Gaps = 36/385 (9%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           +LYD+LGV+ +A+  +IK AYRK ALK+HPDK+   ++ +    KFK++TAAYEILSD +
Sbjct: 6   KLYDLLGVSADANDAQIKKAYRKAALKYHPDKNPSSEAAD----KFKQMTAAYEILSDSQ 61

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKD 128
           K+  YD +                                          +G      +D
Sbjct: 62  KREVYDQFGEEGLNGGGGGPGGFGGFGGFGEDIFSQFFGGGGASRPRGPQKG------RD 115

Query: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKE 188
           I  D+S T+++LY G+  K  L + ++C  C+G G K+          +C SCGG G K 
Sbjct: 116 IKHDISCTLENLYKGRTAKLALNKTVLCKSCEGRGGKS------GSVKKCSSCGGHGVKF 169

Query: 189 RLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGH 248
             ++ GP ++      CE C+G+G     PK+R   C +C    +  +++++ VN+ PG 
Sbjct: 170 VTRQMGP-MIQRFQTTCEACNGEGDVID-PKDR---CRECSGKKISNERKILEVNIEPGM 224

Query: 249 HFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVS 308
                V  +G AD++  + + GD++F + E     Q+    ++     N  +L+    + 
Sbjct: 225 KNGQKVVFQGEADQQPGQ-IPGDVVFVVNE-----QEHPKFVR-----NGDNLHYEAQID 273

Query: 309 LSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLYVF 368
           L  A+ G +               I PG+VI PG +  I  +G PI  +  G  G+L + 
Sbjct: 274 LLTAVAGGQ-FALEHVSGDWLKVDIVPGEVIAPGMVKVIEGKGMPIQKY--GSYGNLLIK 330

Query: 369 VDIEFPPDNWFNEKSELLAIKTHLP 393
            +++F P + F   ++L  ++  LP
Sbjct: 331 FNVKF-PKSHFASDADLKKLEEILP 354

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.218
           YNL077W
          Length = 462

 Score =  137 bits (345), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 119/393 (30%), Positives = 169/393 (43%), Gaps = 53/393 (13%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           RLYDVL V+ EAS  EI+ AYR LALKHHPDK+   +  E +++KF E+  AYEIL D +
Sbjct: 6   RLYDVLNVSPEASAVEIRKAYRLLALKHHPDKN---NHSEESKSKFLEVNEAYEILIDEK 62

Query: 69  KKSHYDLYXXXXXXXXXXXX-----XXXXXXXXXXXXXXXXAHEANDF------PNEHEM 117
           K+S YD Y                                    A D             
Sbjct: 63  KRSLYDQYGTIDENAIQQSMPQEDPVMSSFFNTGSPMGMGMGMSAGDLFASFFDKMSSPS 122

Query: 118 YEGNETTSSKD----IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVT 173
           + G +T  S D    I  DL  T+  LY GK  K  L R+ +C  C+G G     KV   
Sbjct: 123 FGGKKTKKSMDHGPDIKHDLKCTLSSLYEGKNTKLGLNRRRVCKACKGRG---SMKVRT- 178

Query: 174 HEMECESCGGKGSKERLKRFGPGLVASQWV-VCEKCHGKGKYTKRPKNRKNFCPDCESVG 232
               C++C G+G + R ++ GP  +   W   C  C+G G +TK      + C DCE  G
Sbjct: 179 ----CKACRGRGQQSRSRQMGP--MMQTWTQTCSDCNGMGTFTK----DSDVCRDCEGEG 228

Query: 233 LQYKKEVITVNVPPGHHFNDVVTVKGMADEEI------DKAVCGDLIFHLVEKPEDLQQK 286
              ++++  V V PG      + + G ADE I      +  + GD+I  ++         
Sbjct: 229 CIRERKIFDVEVKPGMCQGQQIILPGEADEVIKTRFGNETVIPGDVIITII--------- 279

Query: 287 QVLMKKFGGGNLQ--DLYV-SITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGD 343
           Q+   KF   N    DL V +  + L  +L G +              +I PG++I+P  
Sbjct: 280 QIKDPKFQRVNRNGCDLMVRNCKIPLVTSLCGGKLSIDGHPNGKLINVTILPGELIKPNH 339

Query: 344 IIKITNEGWPILDHPRGQ--CGDLYVFVDIEFP 374
              I N G P  +  R     G+LY+   +EFP
Sbjct: 340 FKSIENLGMPRYEEKRAPEGYGNLYIQFQVEFP 372

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 461

 Score =  135 bits (340), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 113/404 (27%), Positives = 179/404 (44%), Gaps = 54/404 (13%)

Query: 10  LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEK 69
           LYD L ++ +A+ QEIK AYR  ALK HPDK+   +  E ++ KF+EI  AYEIL D +K
Sbjct: 9   LYDTLNISVDATPQEIKKAYRLAALKSHPDKN---NHSEDSKRKFQEICKAYEILGDAKK 65

Query: 70  KSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHE---------ANDFPNEHEMYEG 120
           K  YD Y                              +         A+ F N+  M+  
Sbjct: 66  KLLYDRYGTVDESVIQEQQQEGVYYGSSGMSAGDLFSQFFGGGSTTSASSFFNDDTMFFT 125

Query: 121 NETTSSK------DIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTH 174
            +  S +      DI  +L  ++++LY GKK K  L R  +C  C+G+G         T 
Sbjct: 126 GKKNSQRRVSRGPDIKHNLRCSLEELYHGKKSKLRLDRTRLCKTCKGNGG--------TS 177

Query: 175 EMECESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQ 234
              C +C G+G   + +R GP +V +    C+ C G G + +    RK+ C +C+  G  
Sbjct: 178 SSACRACNGQGFYTQTRRHGP-MVQTWSTTCQDCGGSGTFVR----RKDVCSECKGQGCI 232

Query: 235 YKKEVITVNVPPGHHFNDVVTVKGMADEEI------DKAVCGDLIFHLVEKPEDLQQKQV 288
            ++++  + V PG H    + +   ADE +      ++   GD+I  +         +QV
Sbjct: 233 KERKIFEIEVQPGMHHGQEIVLPEEADEIVYTTYGKEQVNPGDVIIIV---------QQV 283

Query: 289 LMKKFGGGNLQDLYVS-ITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKI 347
               F   N  DL ++   V L  +L G E               + PG++++PG +  +
Sbjct: 284 KHPLFQIHNDTDLVMNDCHVDLKTSLCGGEVLIENHPCGSALKIEVLPGEILKPGCVKCV 343

Query: 348 TNEGWPILDHPRGQ-CGDLYVFVDIEFPPD---NWFNEKSELLA 387
            + G P   HP+ Q  G+LY+   ++FP        N+ SELL 
Sbjct: 344 ESMGMP---HPQSQGFGNLYIRFQVDFPDKLQLETINKVSELLG 384

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 462

 Score =  134 bits (336), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 121/442 (27%), Positives = 178/442 (40%), Gaps = 55/442 (12%)

Query: 4   SDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEI 63
           S S   LYD+LGV+  AS Q+IK AYR  ALKHHPDK+   +  +L   KF++I  AYEI
Sbjct: 3   SVSNSELYDILGVSASASRQDIKKAYRVNALKHHPDKNGHSEESKL---KFQQICKAYEI 59

Query: 64  LSDPEKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----AHEANDFPNEHEMY 118
           L D  K+  YD +                                       F N+   +
Sbjct: 60  LKDERKREMYDRFGTADESQWHTESTSYQEQSGMSAGDLFAQFFGGGSTTGSFFNDDMSF 119

Query: 119 ----EGNETTSSK-------DIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQG-SGWKA 166
               +G  T  S+       DI   L  T++++Y GK+ K  LKR  +C KC+G  G KA
Sbjct: 120 FGKRQGAHTAPSRRELPRGPDIKHYLKCTLEEVYHGKRAKLALKRTRLCKKCKGEGGLKA 179

Query: 167 KKKVHVTHEMECESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCP 226
                     +C +CGG+G +   KR GP +V +    C  C G+G + K    +K+ C 
Sbjct: 180 S---------QCYTCGGRGIRTETKRHGP-MVQTWSSTCSDCAGRGSFMK----QKDICR 225

Query: 227 DCESVGLQYKKEVITVNVPPGHHFNDVVTVKGMADEEI------DKAVCGDLIFHLVEKP 280
           DC   G   ++ +  + V  G      V + G ADE +      +  + GD+I  L + P
Sbjct: 226 DCNGQGCIRERRIFDIEVHKGMENGQEVVLPGEADEVVGSELGSEHVIPGDVIIILEQLP 285

Query: 281 EDLQQKQVLMKKFGGGNLQDLYVS-ITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVI 339
                     K F       L +    V L  +L G                 + PG+++
Sbjct: 286 H---------KAFWRHRDASLVLDHCKVDLKTSLCGGPVWVDSHPSGKLLKIDVLPGEIL 336

Query: 340 RPGDIIKITNEGWPILDHPRGQCGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRP 399
           +PG I  +   G P      G+ G+LY+  D+ FP          L A     P + S  
Sbjct: 337 KPGAIKCVEGMGMP---KSGGRFGNLYIRFDVAFPESLKPETVEALRAALGQEPGANSGA 393

Query: 400 SNTTVNTGSDNSPINSETVSNF 421
               V    +   +    +SNF
Sbjct: 394 GEPAVAV--EGREVEEHVLSNF 413

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {ON}
           YNL064C (YDJ1) - yeast dnaJ homolog (nuclear envelope
           protein); heat shock protein [contig 5] FULL
          Length = 411

 Score =  132 bits (333), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 113/396 (28%), Positives = 183/396 (46%), Gaps = 44/396 (11%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           + YD+LGV+ +A+  +IK AYRK ALK HPDK+  +++ +    KFKE+T AYEILSD +
Sbjct: 6   KFYDLLGVSPDANDAQIKKAYRKQALKFHPDKNPSEEAAD----KFKELTVAYEILSDSQ 61

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNET----T 124
           K+  YD                                   D  ++     G++      
Sbjct: 62  KRDIYD---------QLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGGSQRPRGPQ 112

Query: 125 SSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGK 184
             +DI  ++S ++++LY G+  K  L +QI+C  C+G G KA          +C SC G+
Sbjct: 113 KGRDIKHEMSASLEELYKGRTAKLALNKQILCKTCEGRGGKA------GAVKKCSSCNGQ 166

Query: 185 GSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNV 244
           G K   ++ GP ++      C+ C G G     PK+R   C  C    +  +++++ V++
Sbjct: 167 GIKFITRQMGP-MIQRFQAECDVCSGTGDIID-PKDR---CKSCNGKKIDNERKILEVHI 221

Query: 245 PPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVS 304
            PG      +  +G AD +    + GD++F + ++P    +++            DL   
Sbjct: 222 EPGMKDGQKIVFQGEAD-QAPGIIPGDVVFVISQRPHKHFERKG----------DDLLYQ 270

Query: 305 ITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGD 364
             V L  A+ G E              SI PG+VI PG    I  +G PI  +  G  G+
Sbjct: 271 AEVDLLSAIAGGE-FAIEHVSGEWLKVSIVPGEVISPGMTKVIEGKGMPIQKY--GGYGN 327

Query: 365 LYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPS 400
           L V   I FP +++ +E+S L  ++  LP   S+PS
Sbjct: 328 LIVTFKINFPTNHFADEES-LKKLEEILP-PRSKPS 361

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
           to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
           yeast dnaJ homolog (nuclear envelope protein) heat shock
           protein
          Length = 411

 Score =  132 bits (331), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 112/390 (28%), Positives = 180/390 (46%), Gaps = 45/390 (11%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           +LYD++GV+  A   +IK AYRK ALK+HPDK+  +++ E    KFKEI++AYEILSD +
Sbjct: 6   KLYDLIGVSPGADDAQIKKAYRKAALKYHPDKNPTEEAAE----KFKEISSAYEILSDSQ 61

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNET----- 123
           K+  YD                                  +D  ++     G  +     
Sbjct: 62  KREMYD----------QFGEEGLNGGGAGAGGFGGFGGFGDDIFSQFFGGAGGSSRPRGP 111

Query: 124 TSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGG 183
              +DI  ++S T+++LY G+  K  L +QI+C  C+G G KA          +C SC G
Sbjct: 112 QKGRDIRHEISATLEELYKGRTAKLALNKQILCKSCEGRGGKA------GAVKKCSSCNG 165

Query: 184 KGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVN 243
           +G K   ++ GP ++      C+ C+G G       + K+ C  C    +  +++++ V+
Sbjct: 166 QGFKFITRQMGP-MIQRFQAECDACNGTGDII----DAKDRCKACNGKKIANERKILEVH 220

Query: 244 VPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYV 303
           + PG      +  +G AD+  D    GD++F + E+P +   ++            DLY 
Sbjct: 221 IEPGMKDGQKIVFQGEADQAPDVVP-GDVVFVVSERPHERFNRKG----------DDLYY 269

Query: 304 SITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCG 363
              V L  A+ G E               I PG+VI PG    I  +G P+  +  G  G
Sbjct: 270 EAEVDLLTAIAGGE-FAVQHVSGDWLKVEIVPGEVIAPGATKIIEGKGMPVQKY--GGFG 326

Query: 364 DLYVFVDIEFPPDNWFNEKSELLAIKTHLP 393
           +L V   I+FPP N F +++ L  ++  LP
Sbjct: 327 NLIVKFKIKFPP-NHFADEASLKQLENILP 355

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 411

 Score =  129 bits (323), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 111/394 (28%), Positives = 179/394 (45%), Gaps = 41/394 (10%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           + YD+LGV  +A+  +IK  YRK ALK HPDK+   ++ +    KFKE+T AYE+LSD +
Sbjct: 6   KFYDLLGVPVDANDAQIKKGYRKQALKFHPDKNPSAEAAD----KFKELTVAYEVLSDSQ 61

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKD 128
           K+  YD                                            +G      +D
Sbjct: 62  KRDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGASRPRGPQKG------RD 115

Query: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWK--AKKKVHVTHEMECESCGGKGS 186
           I  ++S ++++LY G+  K  L +Q++C  C+G G K  A KK        C SC G+G 
Sbjct: 116 IKHEMSASLEELYKGRTAKLALNKQVLCKTCEGRGGKEGAVKK--------CASCNGQGV 167

Query: 187 KERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPP 246
           K   ++ GP ++      C+ C+G G     PK+R   C  C    +  +++++ V++ P
Sbjct: 168 KFITRQMGP-MIQRFQAECDACNGTGDIVD-PKDR---CKTCNGKKIDNERKILEVHIEP 222

Query: 247 GHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSIT 306
           G      +  +G AD +    + GD+IF + ++P    +++       G N   LY    
Sbjct: 223 GMKDGQKIVFQGEAD-QAPGVIPGDVIFVISQRPHKHFERK-------GDN---LYYQAE 271

Query: 307 VSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLY 366
           V L  A+ G E               I PG+VI PG    I  +G P+  +  G  GDL 
Sbjct: 272 VDLLSAIAGGE-FAIEHVSGEWLKVGIVPGEVISPGMTKVIEGKGMPVQKY--GGFGDLI 328

Query: 367 VFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPS 400
           V   + FP +++ +E+S L  ++  LP   ++PS
Sbjct: 329 VTFKVNFPTNHFADEES-LKKLEEILPPR-AKPS 360

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {ON}
           YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score =  125 bits (314), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 117/447 (26%), Positives = 174/447 (38%), Gaps = 62/447 (13%)

Query: 3   GSDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYE 62
           GS   + LYD LGV   AS QEIK AYR  ALKHHPDK+   +  +L   KF++I  AYE
Sbjct: 2   GSAMNNDLYDTLGVAANASRQEIKKAYRLKALKHHPDKNGHSEQSKL---KFQQICKAYE 58

Query: 63  ILSDPEKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXX------------XXXXXAHEAND 110
           IL D +K+  YD +                                          E  D
Sbjct: 59  ILGDDKKREMYDRFGTADETQWHTEATNYEEPSGMSAGDLFSQFFGGGSTTGGFFSEGMD 118

Query: 111 FPNEHEMYEGNETTSSK-----DIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWK 165
           F      +    +  S      DI   L  T++++Y GK+ K  LKR  +C  CQG G K
Sbjct: 119 FFGSSRGFRAQGSRRSAPQRGPDIKHYLKCTLEEMYNGKRAKLALKRTRLCQTCQGEGSK 178

Query: 166 AKKKVHVTHEMECESCGGKGSKERLKRFGPGLVASQW-VVCEKCHGKGKYTKRPKNRKNF 224
                       C +C GKG + + KR GP  +   W   C  C G G   K      + 
Sbjct: 179 --------KATSCYACRGKGMQTQTKRQGP--IMQTWSSTCGTCGGSGTIVK----PSDI 224

Query: 225 CPDCESVGLQYKKEVITVNVPPGHHFNDVVTVKGMADEEI------DKAVCGDLIFHLVE 278
           C  C   G   ++++  + V  G      V V   ADE +      ++ + GD+I  L +
Sbjct: 225 CNGCHGQGWVRERKIFEIEVQKGMENGQTVVVPAEADEVVISKYGSERVIPGDVIIILEQ 284

Query: 279 KPEDLQQKQVLMKKFGGGNLQDLYVSITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKV 338
            P    ++        G +   L     V L  +L G                 + PG++
Sbjct: 285 LPHRSLKR--------GHDSSLLLSECQVDLKTSLCGGTVWVDSHPSGKVLKIDVIPGEL 336

Query: 339 IRPGDIIKITNEGWPILDHPRGQCGDLYVFVDIEFP----PDNWFNEKSELLAIKTHLPS 394
           ++PG I  + + G P     +G  GDL++   + FP    PD     ++ L    +   S
Sbjct: 337 LKPGAIKCVQSMGMP---KSKGGYGDLFIKFKVIFPDNLKPDTIQTMQAALDKEPSMQTS 393

Query: 395 STSRPSNTTVNTGSDNSPINSETVSNF 421
           +T++P         +  P+     +NF
Sbjct: 394 ATTQPEI------DEGIPVEEHVFTNF 414

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {ON}
           Anc_2.218 YNL077W
          Length = 460

 Score =  114 bits (286), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 108/378 (28%), Positives = 159/378 (42%), Gaps = 67/378 (17%)

Query: 10  LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEK 69
           LYDVLGV  +AS  EIK AYRKLAL++HPDK+   +  E     F++I+ AY +L D  +
Sbjct: 4   LYDVLGVASDASQSEIKKAYRKLALRYHPDKN---NGDEKCHEAFQKISHAYGVLGDVAQ 60

Query: 70  KSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSK-- 127
           +  YD                              A   + F N   +Y    +      
Sbjct: 61  RQRYD--------------QSGDENESLQPTGSNAADLFSSFFNGGGVYPSGSSGGPGPS 106

Query: 128 -------DIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECES 180
                  +I  +L  T++DLY GK +K  L+R   C +C                  C S
Sbjct: 107 RGPSRGPNIIHELKCTLQDLYRGKVIKLALRRTAPCERCSLGAANV-----------CSS 155

Query: 181 CGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKE-- 238
           C G G+  R++R GP L  +    C  C G+G+ +         C  C   G QY  E  
Sbjct: 156 CNGSGNITRIERVGP-LTQTWSSTCNACQGQGRMSVD-------CSQCG--GAQYLNERV 205

Query: 239 VITVNVPPGHHFNDVVTVKGMADE-------EIDKAVCGDLIFHLVEKPEDLQQKQVLMK 291
           V  V+V PG H    + + G AD+        +  A  GD++  + E  +   ++  L K
Sbjct: 206 VFKVHVKPGMHDGQTIVLDGEADQCVRDRLGHLTVAESGDVVIVIRELADAKFKRSALNK 265

Query: 292 KFGGGNLQDLYV-SITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIK-ITN 349
           +      ++L+V  + V L+ ALTG                +I PG+ + P + IK +  
Sbjct: 266 R------ENLFVDQVKVDLTTALTGGNVLLEDHPSGNLMKINILPGEFL-PENCIKCVEG 318

Query: 350 EGWPILDHPRGQCGDLYV 367
            G PI D   GQ GDLY+
Sbjct: 319 LGMPIDD--TGQRGDLYI 334

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score =  111 bits (277), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 107/408 (26%), Positives = 160/408 (39%), Gaps = 45/408 (11%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
           RLYDVLGV    S  E+K +Y+  AL++HPDK+      E ++ +F++I  AY +L D  
Sbjct: 6   RLYDVLGVQPGVSAAELKKSYKLAALRYHPDKN---GHSEASKQRFQQIADAYRVLGDER 62

Query: 69  KKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSK- 127
            +  YD Y                            AH   D           E+ +S  
Sbjct: 63  LRKIYDRYGTVDEGEVAAMAAAERRHAGGITPGDLFAHFFGDGQGLGSFAIFGESGASSA 122

Query: 128 ---------DIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMEC 178
                    DI   L  T+++LY GK ++  L R  +C  C G G         +    C
Sbjct: 123 RCSRVSRGPDIKHKLRCTLEELYGGKVVRLALTRTRLCTLCAGRGG--------SRASTC 174

Query: 179 ESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKE 238
            +C G+G   + KR G  LV +    C  C G G   K      + C  C   G   +++
Sbjct: 175 TACSGQGICSQTKRQGS-LVQTWSSTCRVCSGSGTIVKDC----DTCTSCGGAGYLRERK 229

Query: 239 VITVNVPPGHHFNDVVTVKGMADEEI------DKAVCGDLIFHLVEK-PEDLQQKQVLMK 291
           V  V + PG      V   G ADE +      ++ + GDL   + E  P    Q +    
Sbjct: 230 VFEVEIRPGMRAGSEVVFPGEADEVVNTPYGKEQVLPGDLAITIEEATPATRYQCR---- 285

Query: 292 KFGGGNLQDLYVSITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEG 351
             G  NL  L   + V L  +L G                 I PG+++ PG I  I + G
Sbjct: 286 --GDANL--LLTELHVDLRTSLCGGTVYIEDHPSGKLIQLEIIPGELLEPGAIKCIEHLG 341

Query: 352 WPILDHPRGQCGDLYVFVDIEFP---PDNWFNEKSELLAIKTHLPSST 396
            P  D P  Q G L++   ++FP    D+     ++ L   T++ + T
Sbjct: 342 MPHPDDP-SQYGHLFIKFHVDFPKTLADSTITAIAQALDADTNVRTRT 388

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  108 bits (270), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 104/367 (28%), Positives = 150/367 (40%), Gaps = 31/367 (8%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           Y +LGV++ A  ++IK+AYR+L+ K+HPDK+ D DS      KF E+  AYE+LSDPEK+
Sbjct: 22  YSILGVSKGAGDKDIKSAYRQLSKKYHPDKNPDDDSA---HNKFIEVGEAYEVLSDPEKR 78

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKDID 130
             YD Y                              +   F                +++
Sbjct: 79  KIYDQYGAEALKNNGGQGGGQGPRGGGFHDPFDIFEQM--FGGGGGGQRQRRRARGHNLE 136

Query: 131 IDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKERL 190
                T+K+ Y G  + F L     C  C+GSG +  K   VT   +C  C G G   ++
Sbjct: 137 TREELTLKEYYRGTSIDFNLNLNDFCEHCEGSGSQDGK---VT---KCPDCKGHGVVVQI 190

Query: 191 KRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGHHF 250
            R GP     Q  +C KC G+G         KN C  C    +  K +   V+VPPG   
Sbjct: 191 VRMGPVTQQIQQ-MCGKCQGRGSTI------KNKCKHCHGEKVVRKPKSFHVDVPPGAPR 243

Query: 251 NDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVSLS 310
           N V   +G +D+  D    GDL     E   D     +  ++ G     DL+ +  +SL 
Sbjct: 244 NFVEVKQGESDKGPDFDA-GDLFIKFSETSRD----NLGYRRRG----DDLFRTEALSLR 294

Query: 311 EALT-GFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLYVFV 369
           EAL  G+E+                   V   G+I +I   G P       + GDLY+  
Sbjct: 295 EALKGGWEREIEFLDAKRKVKIKRASSMVTNNGEIERIPGFGMP---KEHNKFGDLYIDY 351

Query: 370 DIEFPPD 376
            +  P D
Sbjct: 352 VVIVPDD 358

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {ON}
           Anc_8.730 YMR214W
          Length = 393

 Score =  107 bits (266), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 97/374 (25%), Positives = 160/374 (42%), Gaps = 49/374 (13%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           Y +LG+ +EAS + IK+AYR+L+ K+HPDK  +Q+ +E +   F EI  AYE+LSDPEK+
Sbjct: 31  YKILGIPKEASEKAIKSAYRQLSKKYHPDK--NQNDEEAH-NHFIEIGEAYEVLSDPEKR 87

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNE---------------- 114
             YD +                             H+  D  N+                
Sbjct: 88  RTYDQFGSDAFQNGGQGQGGPGGPGGPGGF-----HDPFDLFNQMFGGNKGNFGGFGGFG 142

Query: 115 HEMYEGNETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTH 174
              +  +    ++ I +    ++++ + G  + F++  +  C  C+GSG +  K      
Sbjct: 143 GGGFADDRRRKAQSIQVTYPLSLREYFTGANVNFQMDFKDTCDHCKGSGSEDGK------ 196

Query: 175 EMECESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQ 234
             +C+ CGG G   ++ R GP +       C KCHG G   K      N C  C    L 
Sbjct: 197 VDKCKECGGNGFVVQVIRMGP-VTQQMHTQCPKCHGAGSTIK------NHCKKCHGQKLV 249

Query: 235 YKKEVITVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFG 294
            K + I V VP G   + +  V+   D+E++ A  GDL+       +++ Q  +  ++ G
Sbjct: 250 TKSKEINVKVPAGAPRDFLKIVENGGDKELN-AEAGDLLVQF----QEIAQNNLGYRRRG 304

Query: 295 GGNLQDLYVSITVSLSEALT-GFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWP 353
                DL+ +  +   +A+  G+ +             S KPG  +   +I K+   G P
Sbjct: 305 ----NDLFRTEALVFKDAMEGGWNRTIPFFDPKRDVKISRKPGIPVLNKEIEKLVGFGMP 360

Query: 354 ILDHPRGQCGDLYV 367
           I    R   GDLY+
Sbjct: 361 IQGSDR--FGDLYI 372

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  106 bits (264), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 102/381 (26%), Positives = 160/381 (41%), Gaps = 55/381 (14%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           Y +LGV ++A+ +EIK+AYR+L+ K+HPDK+      E    KF E+  AY++LSD EK+
Sbjct: 24  YKILGVNKDANDKEIKSAYRQLSKKYHPDKN---PGDEEAHNKFIEVGEAYDVLSDSEKR 80

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGN--------- 121
           + YD Y                                + F    +M+ GN         
Sbjct: 81  NIYDQYGADAIKNGGNGQRPGGGGSPFH----------DPFEMFEKMFNGNPFGGAARGG 130

Query: 122 ----ETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEME 177
                    +++ +    ++ D Y G++ K+ L+    C KC G+G K  K   VT    
Sbjct: 131 PGGRGRPRGQNLLLREEVSLMDFYNGREFKYNLQLNDFCEKCHGTGSKDGK---VTR--- 184

Query: 178 CESCGGKGSKERLKRFGPGLVASQWV--VCEKCHGKGKYTKRPKNRKNFCPDCESVGLQY 235
           C  C G+G   ++ + G   + +Q +  VC++C G G+  K P      CP C    +  
Sbjct: 185 CPDCQGRGVIVQVIQMG---IMTQQIQHVCDRCSGSGEIIKNP------CPHCHGHKVAK 235

Query: 236 KKEVITVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGG 295
             +  TV +P G   N V    G A++  D    GDL+F   E           M   G 
Sbjct: 236 MDKEFTVKLPNGAQRNYVDIKHGEAEKGADFDA-GDLMFEFRENS---------MNNMGY 285

Query: 296 GNLQD-LYVSITVSLSEALT-GFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWP 353
               D LY +  +S+ EAL  G+E+                  +V+  G+I  +   G P
Sbjct: 286 RRRGDHLYRTEVLSVQEALKGGWERELEFFDKDKNVKLKRDANQVVITGEIECVPGFGMP 345

Query: 354 ILDHPRGQCGDLYVFVDIEFP 374
           IL+    + GDL++   I  P
Sbjct: 346 ILNSQGRKFGDLFIDYVILMP 366

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  105 bits (261), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 97/347 (27%), Positives = 146/347 (42%), Gaps = 36/347 (10%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           Y +LGV ++AS +EIK+AYR+L+ K+HPDK+   D    +   F E+  AY++LSDPEK+
Sbjct: 22  YAILGVDKQASEKEIKSAYRQLSKKYHPDKNPGNDEAHHH---FIEVGEAYDVLSDPEKR 78

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKDID 130
             YD +                               +N +        G     + DI 
Sbjct: 79  QIYDRHGADALKNGHPGGPGGGNGFHDPFDLFEQMFGSNMYNRARGKPRGQNLQVNHDI- 137

Query: 131 IDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKERL 190
                ++K  Y+G + +F L    IC  C GSG +  K         C  CGG G   ++
Sbjct: 138 -----SLKTFYLGTEFEFTLNLNDICDACDGSGSEDGKT------ETCPDCGGSGQIMKV 186

Query: 191 KRFGPGLVASQWVV--CEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGH 248
            R GP     Q V   C +C G+G+        K+ C  C+ V +  K +V T  V PG 
Sbjct: 187 FRAGP---IEQRVRQPCSRCQGRGQLI------KHVCKKCKGVKVVQKSKVFTAKVEPGM 237

Query: 249 HFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVS 308
             N +  ++G +++  D    GDL  +  E  +D       M     GN   LY +  +S
Sbjct: 238 ERNHIHVMQGQSEKHPDIEP-GDLYQYFRESEKD------SMGYRRRGNT--LYRTEILS 288

Query: 309 LSEALT-GFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPI 354
             EAL  G+E+             S   G  ++ G+   I + G PI
Sbjct: 289 FKEALQGGWERNIEFFDKEKSLVLSRPVGHTVQNGETEVIKSFGMPI 335

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR214W
           (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score = 98.6 bits (244), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 102/363 (28%), Positives = 151/363 (41%), Gaps = 39/363 (10%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKS-VDQDSKELNETKFKEITAAYEILSDPEK 69
           Y +LGV+++AS +EIK+AYR+L+ K HPDK+  D+D+      KF E+  AYE+LSD +K
Sbjct: 27  YGILGVSKDASDKEIKSAYRQLSKKFHPDKNPGDEDAHH----KFIEVGEAYEVLSDDQK 82

Query: 70  KSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNE----HEMYEGNETTS 125
           +  YD +                             H+  D   +    H    G     
Sbjct: 83  RQIYDQHGAEALKNGGPGGPGGPGGGFGGG-----FHDPMDIFEQMFGGHRGGGGRGRPR 137

Query: 126 SKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKG 185
             +++     T+K  Y G  L F L     C  C GSG +  K  H      C  C G+G
Sbjct: 138 GHNLEAREELTLKQYYQGTSLDFTLNLNDFCENCHGSGSQDGKTTH------CSECRGQG 191

Query: 186 SKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVP 245
              ++ R GP L      +C  C GKG+        KN C  C    ++ K +   V+VP
Sbjct: 192 VVIQVVRMGP-LTQKIQQMCGACQGKGQVI------KNKCKRCHGAKVERKAKHFHVDVP 244

Query: 246 PGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSI 305
            G   + V    G AD+  D    GD+     E   D     +  ++ G      LY + 
Sbjct: 245 AGAPRDFVDVKAGEADKGPDFD-SGDVFIKFSESSRD----NMGYRRRG----PHLYRTE 295

Query: 306 TVSLSEALT-GFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGD 364
            +SL EAL  G+++                 G  +R G+I ++   G P   H  G+ GD
Sbjct: 296 VLSLKEALLGGWKREIEFFDPNKKLKLQRGQGVPVRNGEIERVPGFGMPTGGH--GKHGD 353

Query: 365 LYV 367
           L+V
Sbjct: 354 LFV 356

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
           Ashbya gossypii AER346W
          Length = 374

 Score = 98.2 bits (243), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 100/379 (26%), Positives = 162/379 (42%), Gaps = 54/379 (14%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKS-VDQDSKELNETKFKEITAAYEILSDPEK 69
           Y +LGV R AS ++IK+AYR+L+ K+HPDK+  D+D+      +F E+  AYE LSDPEK
Sbjct: 23  YAILGVGRGASDKDIKSAYRQLSKKYHPDKNPGDEDA----HNRFIEVGEAYEALSDPEK 78

Query: 70  KSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTS---- 125
           +  YD +                             H+  D  ++  M+ G   +     
Sbjct: 79  RKIYDQFGAEALKNGGDRAGGGGAGGGF--------HDPFDIFDQ--MFGGGAGSRFHGG 128

Query: 126 --------SKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEME 177
                    + + +     +K  Y G  ++F +     C  C GSG +  K        +
Sbjct: 129 GGQRRKQRGQSLQVQDELNLKKFYHGTSIEFTMSLNDFCDACDGSGSQDGKV------EK 182

Query: 178 CESCGGKGSKERLKRFGPGLVASQ-WVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYK 236
           C  CGG+G   ++ R   G +  Q   +C+KC G+G+        KN C  C    +  K
Sbjct: 183 CGQCGGRGMVVQVIR--QGFITQQIQQMCQKCEGRGEVI------KNKCKTCHGSKVVKK 234

Query: 237 KEVITVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGG 296
            +   V+VP G   + V  ++G A++  D    GD+   +VE P     + +  ++ G  
Sbjct: 235 NKSFHVDVPAGAPRDFVAVIRGEAEKSPDTEP-GDIYVKVVESP----VQNMGYRRRG-- 287

Query: 297 NLQDLYVSITVSLSEALT-GFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPIL 355
              DL+ +  +SL+EAL  G+ +             S   G  ++ G++  I   G P+ 
Sbjct: 288 --PDLFRTEVLSLTEALKGGWVRELEFLDSKKKVVLSRSKGTPVQHGEVECIKGFGMPLE 345

Query: 356 DHPRGQCGDLYVFVDIEFP 374
              +   GDLYV   I  P
Sbjct: 346 SGTK--YGDLYVDYVIVMP 362

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
           (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score = 97.8 bits (242), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 80/282 (28%), Positives = 119/282 (42%), Gaps = 42/282 (14%)

Query: 110 DFPNEHEMYEGNETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKK 169
           +F N  E     E     DI   L  ++KDLY GKK K  L R  +C  C G G   K K
Sbjct: 148 NFNNTFENTASVELERGPDIKHTLRCSLKDLYYGKKTKLRLDRTRLCVLCMGQGSMKKSK 207

Query: 170 VHVTHEMECESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCE 229
                   C +C G GS  + +R GP ++ +    C  C G G + KR       C  C 
Sbjct: 208 --------CFTCNGLGSLTQTRRMGP-MIQTFSQSCPDCQGSGMFVKRSDT----CQSCS 254

Query: 230 SVGLQYKKEVITVNVPPGHHFNDVVTVKGMADEEID------KAVCGDLIFHLVEKPEDL 283
             G   ++++  V + PG     V+ + G ADE ++      K + GD++  +       
Sbjct: 255 GNGYVEERKIFDVEIQPGMVNGQVIILPGEADEVVNTSFGKQKVIAGDIVLTI------- 307

Query: 284 QQKQVLMKKFGGGNLQDLYV-SITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPG 342
              Q+    F   N  DL + + +V+LS+AL G                 I PG+++ PG
Sbjct: 308 --NQLKDNNFEVINDCDLLLDNFSVNLSKALCGGTIFISNHPSGNLIKIDIIPGEILSPG 365

Query: 343 DIIKITNEGWP----------ILDHPRGQCGDLYVFVDIEFP 374
            I  + N G P          I++  +   G+LYV  DI+FP
Sbjct: 366 VIKTVANLGMPKEEKRDPDVSIINISK---GNLYVKFDIKFP 404

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 46/67 (68%), Gaps = 3/67 (4%)

Query: 10 LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEK 69
          LYD+L ++  A  ++IK AYR LALK+HPDK+   +  E ++  F++I+ AYE+L D EK
Sbjct: 7  LYDILNISSNADAKDIKKAYRVLALKYHPDKN---NHSEESKVMFQKISEAYEVLIDVEK 63

Query: 70 KSHYDLY 76
          +  YD Y
Sbjct: 64 RKLYDQY 70

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {ON}
           Anc_8.730
          Length = 376

 Score = 96.3 bits (238), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 95/367 (25%), Positives = 155/367 (42%), Gaps = 45/367 (12%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSV-DQDSKELNETKFKEITAAYEILSDPEK 69
           Y +L + ++A+ ++I++AYR+L+ K+HPDK+  D+D+      KF E+  AYEILSDPEK
Sbjct: 24  YKILELDKDATDKDIRSAYRQLSKKYHPDKNPNDEDAHH----KFIEVGQAYEILSDPEK 79

Query: 70  KSHYDLYXXXXXXXXXXXXXXXXX------XXXXXXXXXXXAHEANDFPNEHEMYEGNET 123
           +  YD +                                         P + +   G   
Sbjct: 80  RQRYDQFGPEGVNGQNGGGPGGAGFHDPFDIFEQMFGGGGGMGGHGGNPFQQQRQRGQNV 139

Query: 124 TSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGG 183
            + +      S ++K+ Y G  LKF +    IC  C GSG    K        +C  C G
Sbjct: 140 VARE------STSLKNYYNGYVLKFSINLNDICDHCHGSGSNDGKST------KCPDCQG 187

Query: 184 KGSKERLKRFGPGLVASQWV--VCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVIT 241
           +G   ++ R G   + +Q +  VC KC GKG+  K P      C  C    +  K +   
Sbjct: 188 RGVTVQVIRMG---MMTQQIQQVCGKCGGKGQIIKNP------CKTCHGSKVVQKPKDFE 238

Query: 242 VNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDL 301
           + +P G     V    G AD+  D    GD+     E  +D     +  ++ G      L
Sbjct: 239 IELPAGAPRKFVHAEHGAADKHPDYD-SGDVYIEFTENDKD----NMGYRRRG----PHL 289

Query: 302 YVSITVSLSEALT-GFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRG 360
           Y +  ++ +EAL  G+E+               +P K+I+ G+  +I   G P+ +  +G
Sbjct: 290 YRTEVLNATEALYGGWERQLAFLDSSKIVTIKREPNKIIQNGETERIAGFGMPLGNGRKG 349

Query: 361 QCGDLYV 367
             GDL++
Sbjct: 350 -FGDLFI 355

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214w SCJ1
          Length = 361

 Score = 95.9 bits (237), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 94/358 (26%), Positives = 153/358 (42%), Gaps = 37/358 (10%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           Y +LG++++AS +EIK+AYR+L+ K+HPDK+      E    KF E+  AY+IL DPEK+
Sbjct: 22  YAILGLSKDASDKEIKSAYRQLSKKYHPDKN---PGDEEAHHKFIEVGEAYDILGDPEKR 78

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKDID 130
             YD++                              +   F          +T  S++  
Sbjct: 79  KTYDVHGADAFKNGGQGQRGGGFHDPFDMFEQMFGRQGGGF---------RQTQRSQNYQ 129

Query: 131 IDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKERL 190
           +    ++K+ Y G +++FE+    IC  C GSG  A  KV V     C +C G+G   ++
Sbjct: 130 VRNQVSLKEFYSGGEVEFEIPLNDICDSCHGSG-SADGKVKV-----CPACQGRGVVVQV 183

Query: 191 KRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGHHF 250
            R GP       +  +     G+   + K  +N C  C+   +  K +      P G   
Sbjct: 184 IRMGP-------ITQQIQQQCGQCGGKGKTIENPCKTCKGHKVVRKNKPFHFEFPGGIPR 236

Query: 251 NDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVSLS 310
           N +    G +D+  D    GD+I    E      +K+ L  +  G N   LY +  ++ +
Sbjct: 237 NHIDKKSGESDKSPDME-SGDIIIEYNE-----SEKENLGYRRRGNN---LYRTEIITAN 287

Query: 311 EALT-GFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLYV 367
           EA+  G+ +             S   G ++  GDI +I   G PI+       GDLY+
Sbjct: 288 EAINGGWTREIEFLDEKKKVKLSRPKGSIVNNGDIERIKGFGMPIMGSK--NFGDLYI 343

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {ON}
           similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and weakly similar to YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 495

 Score = 97.1 bits (240), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 116/471 (24%), Positives = 187/471 (39%), Gaps = 86/471 (18%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSV-DQDSKELNETKFKEITAAYEILSDP 67
           +LYD+L V   A+ QEIK AYRK ALKHHPDK+    +S +L    F++I+ AYE LS+ 
Sbjct: 6   KLYDILEVNTTATEQEIKKAYRKKALKHHPDKNNHSAESIKL----FQDISHAYETLSNS 61

Query: 68  EKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXX--XAHEAND--------------- 110
            K+  YD Y                              AH A D               
Sbjct: 62  NKRELYDQYGTVDEGEISEIIAKQNMGNTGSNGNSHPFSAHTAGDLFAQFFGGRGSSGTG 121

Query: 111 ---FPNEHEMYEGNETTSSKDIDIDLSFTMKD-----LYMGKKLKFELK---RQIICGKC 159
              F     M  G   + S D +++     +D     +  G  ++  LK     +  GK 
Sbjct: 122 ASGFGFMRGMVNGPFQSFSHDFNMNSMADFEDDGSHEMASGPGIRHNLKCNLYDLFHGK- 180

Query: 160 QGSGWKAKKKVHVTHEMECESCGGKGSKE--------------RLKRFGPGLVASQWVVC 205
                  + K+ +     C+ C G G K+                KR GP +V +    C
Sbjct: 181 -------RAKLALNRTRLCQRCQGYGGKKATQCRGCQGTGLFTTTKRMGP-MVQTWQTTC 232

Query: 206 EKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGHHFNDVVTVKGMADEEID 265
           ++C G GKY +     K+ C +C   G   +++   V V PG    + + + G ADE I+
Sbjct: 233 KECSGTGKYIR----SKDACTECSGNGFIKERKFFDVEVLPGMRNGNEIILPGEADEVIN 288

Query: 266 ------KAVCGDLI--FHLVEKPEDLQQKQVLMKKFGGGNLQDLYV-SITVSLSEALTGF 316
                 + + GD+I    L    E   + + L+         DL + +  V L  +L G 
Sbjct: 289 TEYGKERVIPGDVIITIQLTRNEESNMRYKYLVHD------HDLILDNFEVDLKTSLCGG 342

Query: 317 EKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLYVFVDIEFPP- 375
                           +  G++++PG I  + N+G P+     G  G+LY+   ++FP  
Sbjct: 343 TIIIEDHPSGNPFKIEVLSGELLKPGCIKCVENKGMPV--DSNGNFGNLYIRFRVKFPEQ 400

Query: 376 --DNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSNFQII 424
              +  N+ SE+L    ++ S  S   N      + +  INS  ++  Q++
Sbjct: 401 LKSDTINKLSEILVQDENISSILSDSIN------NKSYKINSSDIAEEQVL 445

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
           (REAL)
          Length = 533

 Score = 97.4 bits (241), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 80/271 (29%), Positives = 117/271 (43%), Gaps = 35/271 (12%)

Query: 128 DIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSK 187
           DI  +L  T+K+LYMGK  K  L R  IC  C G G   K          C+ C G+G +
Sbjct: 185 DIKHNLKCTLKELYMGKTAKLGLNRTRICHVCDGHGGLRK--------YTCKPCKGQGIQ 236

Query: 188 ERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPG 247
            + KR GP LV S    C  C G G + K     K+ C  C+ +G   +++++ V V PG
Sbjct: 237 TQTKRMGP-LVQSWSQTCADCGGAGTFVK----NKDICEQCQGLGFIKQRKILQVTVQPG 291

Query: 248 HHFNDVVTVKGMADEEI-------DKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQD 300
              N ++ + G  DE I       +K + GD++  ++   +          KF   +  D
Sbjct: 292 SCHNQLIVLTGEGDEVISTKGGGREKVIPGDVVITILRLKD---------PKFQITDNCD 342

Query: 301 LYV-SITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWP-ILDHP 358
           L      V L  +L G                 I PG+V++PG    + N G P  ++  
Sbjct: 343 LICKKCEVDLMTSLCGGIVYIEGHPSGKLIKIDIIPGEVLKPGCFKTVENMGMPKFINGV 402

Query: 359 RGQCGDLYVFVDIEFP----PDNWFNEKSEL 385
           R   G LYV  D+ +P    P+N    KS L
Sbjct: 403 RSGFGHLYVKFDVTYPERLEPENAAKVKSIL 433

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 43/67 (64%), Gaps = 3/67 (4%)

Query: 10 LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEK 69
          LYD L VT  AS  EIK AYR  ALK+HPDK+   +  E ++ KF+EI  AYE+L D   
Sbjct: 7  LYDSLNVTATASTSEIKKAYRNAALKYHPDKN---NHTEESKRKFQEICQAYEVLKDNHL 63

Query: 70 KSHYDLY 76
          +S YD Y
Sbjct: 64 RSLYDQY 70

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 97/369 (26%), Positives = 150/369 (40%), Gaps = 37/369 (10%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           Y +L + ++AS +EIK+AYR+L+ K+HPDK+   D       KF EI  AYE+LSDPEKK
Sbjct: 25  YAILDIGKDASEKEIKSAYRQLSKKYHPDKNAGSDEA---HHKFIEIGEAYEVLSDPEKK 81

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKDID 130
             YD +                                         +   +      I 
Sbjct: 82  KIYDQFGADAVKNGGGGAGGPGGGGFHDPFDIFERMFQGGQGGPGGGFGQRQRQRGPTIK 141

Query: 131 IDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKERL 190
           +  + ++K  Y G  ++F L     C  C GSG    K        +C  C G+G   ++
Sbjct: 142 VHENLSLKQFYSGTSIEFTLSLNDECDGCHGSGSADGKLA------QCPDCQGRGIIVQV 195

Query: 191 KRFGPGLVASQWV--VCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGH 248
            R G   + +Q +  +C +C G G+        KN C  C    +  K +   V+VPPG 
Sbjct: 196 VRMG---IMTQQIQQICGRCAGTGQVI------KNQCKTCHGKKVTKKNKFFHVDVPPGA 246

Query: 249 HFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVS 308
             N + T  G A++  D    GDL+    E    +  + +  ++ G     +LY +  +S
Sbjct: 247 PRNYMDTRAGEAEKGPDFDA-GDLVIEFRE----MDTENMGYRRRG----HNLYRTEVLS 297

Query: 309 LSEAL-TGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWP--ILDHPRGQCGDL 365
            +EAL  G+E+             S     V+  G+I  +   G P    DH     GDL
Sbjct: 298 AAEALYGGWERTIEFLDENKPVKLSRPAHAVVSTGEIEVVKGFGMPKGSRDH-----GDL 352

Query: 366 YVFVDIEFP 374
           Y+   +  P
Sbjct: 353 YIDYVVVMP 361

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
           (REAL)
          Length = 532

 Score = 96.3 bits (238), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 74/264 (28%), Positives = 114/264 (43%), Gaps = 29/264 (10%)

Query: 119 EGNETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMEC 178
           EG       DI  +L  T+K+LYMGK  K  L R  IC  C G G   K          C
Sbjct: 173 EGRHLNRGPDIKHNLKCTLKELYMGKTAKLGLNRTRICQVCDGHGGLKK--------YAC 224

Query: 179 ESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKE 238
           ++C G+G + +  R GP LV S    C  C G G + +     K+ C  C+ +G   +++
Sbjct: 225 KTCKGQGVQTQTNRMGP-LVQSWSQTCADCGGAGIFVE----SKDICQQCQGLGFVKQRK 279

Query: 239 VITVNVPPGHHFNDVVTVKGMADEEI-------DKAVCGDLIFHLVEKPEDLQQKQVLMK 291
           ++ V V PG   N ++ + G  DE I       +K + GD++  +      L+ K    +
Sbjct: 280 ILQVAVQPGSCHNQLIVLTGEGDEVISSKGGGHEKIIPGDVVITI------LRLKDPRFQ 333

Query: 292 KFGGGNLQDLYVSITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEG 351
                NL  +Y    V L  +L G                 I PG+V++PG    + N G
Sbjct: 334 IVDDYNL--IYKKCKVDLMTSLCGGVVYIEGHPSGKLIKLDIIPGEVLKPGCFKTVENMG 391

Query: 352 WP-ILDHPRGQCGDLYVFVDIEFP 374
            P  ++  R   G +YV  ++ +P
Sbjct: 392 MPKFINGVRSGFGHMYVKFEVTYP 415

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 42/67 (62%), Gaps = 3/67 (4%)

Query: 10 LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEK 69
          LYD L VT  AS  EIK AYR  ALK+HPDK+   +  E ++ KF+EI  AYE L D   
Sbjct: 7  LYDSLNVTATASTSEIKKAYRNAALKYHPDKN---NHTEESKRKFQEICQAYETLKDNHL 63

Query: 70 KSHYDLY 76
          +S YD Y
Sbjct: 64 RSLYDQY 70

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putative
           chaperone of the HSP40 (DNAJ) family; overexpression
           interferes with propagation of the [Psi+] prion; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 528

 Score = 94.0 bits (232), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 111/255 (43%), Gaps = 29/255 (11%)

Query: 128 DIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSK 187
           DI  +L  T+K+LYMGK  K  L R  IC  C G G   K          C++C G+G +
Sbjct: 178 DIKHNLKCTLKELYMGKTAKLGLNRTRICSVCDGHGGLKK--------CTCKTCKGQGIQ 229

Query: 188 ERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPG 247
            + +R GP LV S    C  C G G + K     K+ C  C+ +G   +++++ V V PG
Sbjct: 230 TQTRRMGP-LVQSWSQTCADCGGAGVFVK----NKDICQQCQGLGFIKERKILQVTVQPG 284

Query: 248 HHFNDVVTVKGMADEEI-------DKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQD 300
              N ++ + G  DE I       +K + GD++  ++     L+     +  +     + 
Sbjct: 285 SCHNQLIVLTGEGDEVISTKGGGHEKVIPGDVVITILR----LKDPNFQVINYSNLICKK 340

Query: 301 LYVSITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWP-ILDHPR 359
             +    SL   +   E               I PG++++PG    + + G P  ++  R
Sbjct: 341 CKIDFMTSLCGGVVYIE----GHPSGKLIKLDIIPGEILKPGCFKTVEDMGMPKFINGVR 396

Query: 360 GQCGDLYVFVDIEFP 374
              G LYV  D+ +P
Sbjct: 397 SGFGHLYVKFDVTYP 411

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 43/67 (64%), Gaps = 3/67 (4%)

Query: 10 LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEK 69
          LYD L VT  AS  EIK AYR  ALK+HPDK+   +  E ++ KF+EI  AYEIL D   
Sbjct: 7  LYDSLNVTAAASTSEIKKAYRNAALKYHPDKN---NHTEESKRKFQEICQAYEILKDNRL 63

Query: 70 KSHYDLY 76
          ++ YD Y
Sbjct: 64 RALYDQY 70

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {ON}
           Anc_8.730 YMR214W
          Length = 373

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 95/369 (25%), Positives = 152/369 (41%), Gaps = 35/369 (9%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           Y +LG+ ++AS +EIK++YR+L+ K HPDK+      E    KF EI  AYE+LSDPEK+
Sbjct: 23  YAILGLNKDASDKEIKSSYRQLSKKFHPDKN---PGDEEAHHKFIEIGEAYEVLSDPEKR 79

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKDID 130
             +D Y                                         +   +     ++ 
Sbjct: 80  KIFDQYGADALKNGGPGGPGGGGGGFNDPFDIFEQMFNRGGGGGGGGFGRMQRPRGHNLK 139

Query: 131 IDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKERL 190
           +    ++K+ Y G  L+F L    IC  C G+G  A  KV      +C  C G+G   ++
Sbjct: 140 VREQLSLKEYYTGATLEFTLALNDICDHCDGTG-SADGKV-----AKCSDCQGRGVVIQV 193

Query: 191 KRFGPGLVASQWV--VCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGH 248
            R G   + +Q +  +C +C GKG         KN C  C    +  K++   V VPPG 
Sbjct: 194 IRMG---MMTQQIQQMCGRCGGKGSVI------KNHCKTCHGSKVVKKQKPFHVEVPPGA 244

Query: 249 HFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVS 308
             +   T  G +D+  D    GD+     EK  +     +  ++ G      LY +  +S
Sbjct: 245 ARHYTETRSGESDKGADFDA-GDVFIEFNEKTTN----NLGYRRRG----PHLYRTEVLS 295

Query: 309 LSEALTG-FEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQ--CGDL 365
             EAL G +++             +     V+  G++ +I   G P    P G+   GDL
Sbjct: 296 AREALKGDWQREVEFLDEKKKVKIARAKNVVVHNGEVERIPGFGMP---QPNGKHAFGDL 352

Query: 366 YVFVDIEFP 374
           ++   +  P
Sbjct: 353 FIEYVVVMP 361

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 96/366 (26%), Positives = 149/366 (40%), Gaps = 33/366 (9%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           Y +LGV ++AS ++IK+AYR+++ K HPDK+   D       KF EI  AYE+LSD EK+
Sbjct: 21  YAILGVAKDASEKDIKSAYRQMSKKWHPDKNAGDDEA---HHKFIEIGEAYEVLSDSEKR 77

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKDID 130
           + YD +                                  F + H    G       ++ 
Sbjct: 78  ATYDRFGADALKNGGGGGGGHPGGFGGGGFHDPFDLFNQMFGDSHP--GGQNVRKGSNLI 135

Query: 131 IDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKERL 190
           +  S T+   Y G      L     C  C GSG  A+     T    CE+C G+G   ++
Sbjct: 136 VKDSVTLNGFYHGFYANLTLDLNDDCEHCHGSG--AEDNQFAT----CETCQGRGVIIQV 189

Query: 191 KRFGPGLVASQWV--VCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGH 248
            + G     +Q +  VC  C GKGK        K+ C  C    +    +   ++VP G 
Sbjct: 190 IQMG---FMTQQIQQVCGACQGKGKTI------KHVCKICRGARVVKTPKTFEISVPAGA 240

Query: 249 HFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVS 308
             N  V   G A E++     GDL+F      E+   + +  ++ G      LY +  + 
Sbjct: 241 QRNYNVVKSGQA-EKVPDMQSGDLVFVF----EENSHENLGYRRRG----DHLYRTEVLH 291

Query: 309 LSEALT-GFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLYV 367
             EAL  G+E+                   V  PG+I ++ N G P L+  +G+  + Y 
Sbjct: 292 WKEALLGGWERRIAFFDDQKQVVVKRDKNVVTAPGEIERVPNLGMPKLN-SKGKSTNAYG 350

Query: 368 FVDIEF 373
            + IE+
Sbjct: 351 DLFIEY 356

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
           (REAL)
          Length = 536

 Score = 91.3 bits (225), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 108/254 (42%), Gaps = 28/254 (11%)

Query: 128 DIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSK 187
           DI   L  T+++LYMGK  K  L R  IC  C+G G   K          C++C G+G +
Sbjct: 189 DIKHTLKCTLRELYMGKTAKLGLNRTRICHVCEGHGGLQK--------YTCKTCKGQGVQ 240

Query: 188 ERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPG 247
            + K  GP LV S    C  C G G + +     K+ C  C+ +G   +++++ V V PG
Sbjct: 241 TQTKCMGP-LVQSWSQTCADCGGAGIFVES----KDICQQCQGLGFIKQRKILQVTVQPG 295

Query: 248 HHFNDVVTVKGMADEEI------DKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDL 301
              N ++ + G  DE I      +K + GD++  ++   +   Q           N   +
Sbjct: 296 TSHNQLIVLTGEGDEVISKGGGHEKVIPGDVVITILRLKDPKFQVT--------DNCSLI 347

Query: 302 YVSITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWP-ILDHPRG 360
           Y    V L  +L G                 I PG+V++P     I   G P  ++  R 
Sbjct: 348 YKKCKVDLMTSLCGGIVYIEGHPSGKLIKLDIIPGEVLKPSCFKTIEGMGMPKFINGVRS 407

Query: 361 QCGDLYVFVDIEFP 374
             G LYV  D+ +P
Sbjct: 408 GFGHLYVKFDVSYP 421

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 43/67 (64%), Gaps = 3/67 (4%)

Query: 10 LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEK 69
          LYD L VT  AS  EIK AYR  AL++HPDK+   +  E ++ KF+EI  AYE+L D   
Sbjct: 7  LYDSLNVTTTASTSEIKKAYRNAALRYHPDKN---NHTEESKRKFQEICQAYEVLKDNHL 63

Query: 70 KSHYDLY 76
          +S YD Y
Sbjct: 64 RSLYDQY 70

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.218
           YNL077W
          Length = 554

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 108/244 (44%), Gaps = 27/244 (11%)

Query: 128 DIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSK 187
           DI   L  T+ +LY GK+ K  L+R   C KC+G G    K         C  C G+GS 
Sbjct: 232 DIKHTLKCTLSNLYSGKRSKLRLERTRCCLKCKGFGSLNIK--------SCSKCNGRGSL 283

Query: 188 ERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPG 247
            + K+FGP +  +    C+ C G G +     + ++ C +C+  G   +K++  V + PG
Sbjct: 284 TQTKKFGP-MTQTFTQTCDGCGGNGTFA----DAQDICNECQGEGFLNEKKIFEVEITPG 338

Query: 248 HHFNDVVTVKGMADEEI------DKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDL 301
                ++ + G ADE I      ++ + GD+I  +   P+         K   G +L  L
Sbjct: 339 MTDGQLIILTGEADEVISTNLGKERVIPGDIILTINLLPDP------TFKVVQGADL--L 390

Query: 302 YVSITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQ 361
           Y +  ++L  +L G                +I PG++I+ G I  + N G P +D   G 
Sbjct: 391 YANYKINLLTSLCGGSIYIKNHPSEHLIKINIIPGELIKNGAIKTVENLGMPKIDLSVGH 450

Query: 362 CGDL 365
             D+
Sbjct: 451 SNDI 454

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 48/69 (69%), Gaps = 5/69 (7%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDK-SVDQDSKELNETKFKEITAAYEILSDP 67
          +LYD+L V  ++    IK AYR LALK+HPDK ++ ++SK++    F++I+ AY +LS+ 
Sbjct: 6  QLYDILQVRYDSDESVIKKAYRTLALKYHPDKNNLSEESKQM----FQKISEAYVVLSNK 61

Query: 68 EKKSHYDLY 76
          +K+  YD Y
Sbjct: 62 DKRQMYDKY 70

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} similar
           to uniprot|P25303 Saccharomyces cerevisiae YMR214W SCJ1
           dnaJ homolog
          Length = 375

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 114/276 (41%), Gaps = 24/276 (8%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           Y +LGV+++AS +EIK+AYR+L+ K+HPDK+      E    KF E+  AYE+LSD +K+
Sbjct: 26  YAILGVSKDASEKEIKSAYRQLSKKYHPDKN---PGDETAHHKFIEVGEAYEVLSDDQKR 82

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNE----HEMYEGNETTSS 126
             Y+ Y                             H+  D   +         G      
Sbjct: 83  QIYNQY---GAEALKNGGPGGSGGPGGPGGFGGGFHDPMDIFEQMFGAQRGGGGRGRPRG 139

Query: 127 KDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGS 186
            +++     T+K+ Y G  L F L     C  C+G+G +  K         C  C G+G 
Sbjct: 140 HNLEAREEITLKEYYQGTSLDFTLNLNDFCDNCKGTGSQDGKTT------RCSDCQGQGV 193

Query: 187 KERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPP 246
             ++ R GP +      +C  C GKG+        KN C  C    ++ K +   V+VP 
Sbjct: 194 VIQIIRMGP-ITQQIQQMCGACQGKGQII------KNKCKQCHGAKVERKTKHFHVDVPA 246

Query: 247 GHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPED 282
           G   + V    G AD+  D    GD+     E   D
Sbjct: 247 GAPRDFVDVKNGEADKGPDFDA-GDVYIKFSESSRD 281

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
           several homologs of bacterial chaperone DnaJ, located in
           the ER lumen where it cooperates with Kar2p to mediate
           maturation of proteins
          Length = 377

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 94/372 (25%), Positives = 150/372 (40%), Gaps = 41/372 (11%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           Y +L + ++A+ +EIK+AYR+L+ K+HPDK+      E    KF E+  AY++LSDPEKK
Sbjct: 25  YAILEIDKDATEKEIKSAYRQLSKKYHPDKNA---GSEEAHQKFIEVGEAYDVLSDPEKK 81

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKD-- 128
             YD +                                    +        +    +   
Sbjct: 82  KIYDQFGADAVKNGGGGGGPGGPGAGGFHDPFDIFERMFQGGHGGPGGGFGQRQRQRGPM 141

Query: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKE 188
           I +    ++K  Y G  ++F L     C  C GSG    K        +C  C G+G   
Sbjct: 142 IKVQEKLSLKQFYSGSSIEFTLNLNDECDACHGSGSADGKLA------QCPDCQGRGVII 195

Query: 189 RLKRFGPGLVASQWV--VCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPP 246
           ++ R G   + +Q +  +C +C G G+        KN C  C    +  K +   V+VPP
Sbjct: 196 QVLRMG---IMTQQIQQMCGRCGGTGQII------KNECKTCHGKKVTKKNKFFHVDVPP 246

Query: 247 GHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSIT 306
           G   N + T  G A++  D    GDL+    EK  +     +  ++ G     +LY +  
Sbjct: 247 GAPRNYMDTRVGEAEKGPDFDA-GDLVIEFKEKDTE----NMGYRRRG----DNLYRTEV 297

Query: 307 VSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPI--LDHPRGQ--C 362
           +S +EAL G  +               KP K+ RP  ++    E   +     P+G    
Sbjct: 298 LSAAEALYGGWQRTIEFLDEN------KPVKLSRPAHVVVSNGEVEVVKGFGMPKGSKGY 351

Query: 363 GDLYVFVDIEFP 374
           GDLY+   +  P
Sbjct: 352 GDLYIDYVVVMP 363

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
           {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and some similarites with YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 491

 Score = 88.2 bits (217), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 76/273 (27%), Positives = 126/273 (46%), Gaps = 32/273 (11%)

Query: 128 DIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSK 187
           DI  +L  T+ +LY GK  K  L R+ +C  CQG G   ++         C++C G+G +
Sbjct: 164 DIKHNLKCTLAELYDGKITKLGLNRRRMCQSCQGQGSLRRRT--------CKTCRGQGQQ 215

Query: 188 ERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPG 247
              +R GP +V +    C  C+G G YTK+     + C +C       ++++  V V  G
Sbjct: 216 TETRRTGP-MVQTWTQTCPDCNGLGTYTKQA----DVCHECRGESYIKERKIFDVEVSKG 270

Query: 248 HHFNDVVTVKGMADEEI------DKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDL 301
                 + + G ADE I      +K + GD++   +++ +D +  +V   ++G     DL
Sbjct: 271 MCHGQTIVLPGEADELIKTSFGVEKVIPGDVVI-TIDQVKDSKFHRV--NRYGC----DL 323

Query: 302 YV-SITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRG 360
            + S ++ LS +L G +              SI PG++I P  +  I   G P   H  G
Sbjct: 324 VMGSCSIDLSTSLCGGDIYIDGHPSGKLLKVSIVPGELIGPNCLKSIEGMGMPKYGHDGG 383

Query: 361 QCGDLYVFVDIEFP----PDNWFNEKSELLAIK 389
           + G+LY+   +E+P    PD     +S LL  K
Sbjct: 384 K-GNLYIQFQLEYPVGLEPDTIGRLQSVLLQDK 415

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 47/68 (69%), Gaps = 3/68 (4%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          RLYD L V+ +A++ EIK AY+ +ALK+HPDK+      E  + KF+E+  AYEIL+D +
Sbjct: 6  RLYDTLKVSPDATISEIKRAYKVMALKYHPDKN---HHSEDAKNKFQEVCKAYEILADED 62

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 63 KRVMYDRY 70

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
           (REAL)
          Length = 378

 Score = 86.3 bits (212), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 101/375 (26%), Positives = 155/375 (41%), Gaps = 60/375 (16%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           Y +L V ++AS +EIK+AYR+L+ K+HPDK+      E    KF E+  AY++LSDPEKK
Sbjct: 25  YAILEVDKDASEKEIKSAYRQLSKKYHPDKN---SGSEEAHHKFIEVGEAYDVLSDPEKK 81

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEG---------- 120
             YD +                             H+  D   EH M++G          
Sbjct: 82  KIYDQFGADAVKNGGGGGGGAGGPGGGGF------HDPFDI-FEH-MFQGGHGGPGGGFG 133

Query: 121 -NETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECE 179
             +      I +    ++K  Y G  ++F L     C  C GSG    K        +C 
Sbjct: 134 QRQRQRGPMIKVQEKLSLKQFYSGTSIEFTLSLNDECDVCHGSGSADGKLA------QCP 187

Query: 180 SCGGKGSKERLKRFGPGLVASQWV--VCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKK 237
            C G+G   ++ R G   + +Q +  +C +C G G+        KN C  C    +  K 
Sbjct: 188 DCQGRGVIIQVLRMG---IMTQQIQQMCGRCGGTGQII------KNQCKTCHGKKVIKKN 238

Query: 238 EVITVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGN 297
           +   V+VPPG   N + T  G A++  D    GDL+    EK  +     +  ++ G   
Sbjct: 239 KFFHVDVPPGAPRNYLDTRAGEAEKGPDFDA-GDLVIEFKEKDTE----NMGYRRRG--- 290

Query: 298 LQDLYVSITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNE-----GW 352
             +LY +  +S  EAL G  +               KP K+ RP  ++    E     G+
Sbjct: 291 -DNLYRTEVLSAEEALYGGWQRTIEFFDEN------KPVKLSRPAHVVVSNGEIEVLKGF 343

Query: 353 PILDHPRGQCGDLYV 367
            +    +G  GDLY+
Sbjct: 344 GMPKSGKGH-GDLYI 357

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score = 86.3 bits (212), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 93/374 (24%), Positives = 154/374 (41%), Gaps = 38/374 (10%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           Y +LG+ ++A+ +EIK+AYR+L+ K HPDK+      E    KF E+  AYE+LSDP+K+
Sbjct: 23  YQILGIAKDATDKEIKSAYRQLSKKFHPDKN---PGNEDAHQKFIEVGEAYEVLSDPQKR 79

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKDID 130
             +D +                                          +  +     +I 
Sbjct: 80  QTFDQFGADAVKNGGQGQPGGGAQFHDPFDIFEQMFGGQGGGGNPFGGQ-RQKPRGPNIM 138

Query: 131 IDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKERL 190
                ++KD Y G +L F L    +C  C G+G    K         C  C G+G   +L
Sbjct: 139 AREEISLKDYYTGYELNFTLNVNDLCDHCHGTGSDDGKLT------PCPDCQGRGVIIQL 192

Query: 191 KRFGPGLVASQWV--VCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPG- 247
            R G   + +Q +  +C +C GKG+  K+       C  C    +  +K+   V +P G 
Sbjct: 193 IRMG---MMTQQIQQMCGRCGGKGQLFKKQ------CRKCHGNKVMPQKKEFQVKLPKGA 243

Query: 248 -HHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSIT 306
             H+ DV    G AD+  D    GDL+    E      +  +  ++ G    Q+LY +  
Sbjct: 244 KRHYMDV--KHGEADKNPDLEA-GDLLIEFNEN----DKSNMGYRRRG----QNLYRTEV 292

Query: 307 VSLSEAL-TGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDL 365
           ++++EAL  G+++               +   V+  G++ +I   G P     +   GDL
Sbjct: 293 LNVTEALYGGWQREIPFLDPKKKLQVGRESNIVVSHGEVERIPGFGMPTGKGKKETFGDL 352

Query: 366 YVFVD-IEFPPDNW 378
             F+D +   P  W
Sbjct: 353 --FIDYVVIMPKQW 364

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score = 86.3 bits (212), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 92/375 (24%), Positives = 149/375 (39%), Gaps = 43/375 (11%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           Y +LG+ ++AS +++K+AYR+L+ K+HPDK+   +S      +F E+  AYE+LSDPEK+
Sbjct: 21  YSILGLNKDASDKDVKSAYRQLSKKYHPDKNPGDESA---HQRFIEVGEAYEVLSDPEKR 77

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXX--------XXXXXXXAHEANDFPNEHEMYEGNE 122
             +D Y                                                M+ G  
Sbjct: 78  GIFDQYGADGLKNGAGGGGGPGGGFGGFHDPFDIFEQMFNRGGGGGGFGGGFGGMHRGKG 137

Query: 123 TTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCG 182
            +    + +    ++KD Y G  ++FEL    IC  C+GSG +  K         C  CG
Sbjct: 138 PS----LRVHEELSLKDYYSGTGVEFELMLNDICDHCEGSGSEDGKV------ETCPDCG 187

Query: 183 GKGSKERLKRFGPGLVASQWVV--CEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVI 240
           G+G   ++ R G   + +Q +   C +C G+G         KN C  C    +  K +  
Sbjct: 188 GQGILIQIIRMG---IMTQRIQQPCGRCSGRGHII------KNQCKACGGHKVVKKPKSF 238

Query: 241 TVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQD 300
            V VP G   + V      AD+  D    GD+     E  ++     +  ++ G      
Sbjct: 239 QVEVPAGAPRDHVEVRHQEADQSTDMEA-GDIFVEFTESDKN----NMGYRRRG----DH 289

Query: 301 LYVSITVSLSEALTGFEKXXXXXXXXXXXXXSIKP-GKVIRPGDIIKITNEGWPILDHPR 359
           L+ +  +S  EAL G                  +P G ++  G+I +I   G P     +
Sbjct: 290 LFRTEVLSAREALAGGWSREIEFLDDAKKVKLQRPKGNIVHHGEIEQIPGFGMPKGSSGK 349

Query: 360 GQCGDLYVFVDIEFP 374
              GDL+V   +  P
Sbjct: 350 -SFGDLFVEYAVVMP 363

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 81/307 (26%), Positives = 126/307 (41%), Gaps = 29/307 (9%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           Y +L + + AS +EIK+AYR+L+ K HPDK+      E    KF E+  AY++LSDPEKK
Sbjct: 25  YAILEIDKGASEKEIKSAYRQLSKKFHPDKNA---GSEEAHQKFIEVGEAYDVLSDPEKK 81

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKDID 130
             YD +                                         +   +      I 
Sbjct: 82  KIYDQFGAEAVKNGGDGAGGPGAGGFHDPFDIFERMFQGGHGGTGGGFGQRQRQRGPMIK 141

Query: 131 IDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKERL 190
           +    ++K  Y G  ++F L     C  C GSG    K        +C  C G+G   ++
Sbjct: 142 VQEKLSLKQFYSGSSIEFTLSLNDECDVCHGSGSADGKLA------QCPDCQGRGVIIQV 195

Query: 191 KRFGPGLVASQWV--VCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGH 248
            R G   + +Q +  +C +C G G+        KN C  C    +  + +   V+VPPG 
Sbjct: 196 LRMG---IMTQQIQQMCGRCGGTGQVI------KNECKTCHGNKVTKRNKFFHVDVPPGA 246

Query: 249 HFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVS 308
             N + T  G A++  D    GDL+    EK  +     +  ++ G     +LY +  +S
Sbjct: 247 PRNYMDTRAGEAEKGPDFDA-GDLVIEFKEKDSE----NMGYRRRG----DNLYRTEVLS 297

Query: 309 LSEALTG 315
           + EAL G
Sbjct: 298 IEEALYG 304

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
           Ashbya gossypii AER427W
          Length = 503

 Score = 84.3 bits (207), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 104/254 (40%), Gaps = 29/254 (11%)

Query: 128 DIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSK 187
           DI  +L   +K+LY GK  K  L R  +C +C G G              C  C G+G  
Sbjct: 154 DIKHNLKCELKELYSGKVAKLGLTRTRLCHRCSGHGSMTSSV--------CGECRGQGVY 205

Query: 188 ERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPG 247
            + +R GP LV +    C  C G G + K      + C  C   G   ++++  V + PG
Sbjct: 206 SQTRRHGP-LVQTWSSSCRNCSGAGTFVK----SNDVCQTCRGTGYIRERKIFEVEIKPG 260

Query: 248 HHFNDVVTVKGMADEEID------KAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDL 301
                 + + G AD+ I       + + GD+I         + Q+Q    ++      DL
Sbjct: 261 LSNKSEIILPGEADQVISTVYGKQQVIPGDVII--------IVQEQCSTGRYRRFRESDL 312

Query: 302 YVS-ITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRG 360
            ++   V L  +L G                 + PG+++ PG I  + N G P  D+P  
Sbjct: 313 VLTRCVVDLRTSLCGGSIYIDDHPSGRPIKLEVIPGELLNPGSIKCVENLGMPKRDNP-S 371

Query: 361 QCGDLYVFVDIEFP 374
           Q GDLY+   + FP
Sbjct: 372 QYGDLYIKFCVNFP 385

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score = 83.6 bits (205), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 92/359 (25%), Positives = 142/359 (39%), Gaps = 34/359 (9%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           Y +LGV REA+ ++IK+AYR+L+ K+HPDK+    +   N   F E+  AYE LSDPEK+
Sbjct: 23  YAILGVDREATEKDIKSAYRQLSKKYHPDKNPGDTTAHHN---FIEVGEAYEALSDPEKR 79

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKDID 130
             YD Y                              E                  S+ + 
Sbjct: 80  RIYDQY-----GAEALKNGGGAEGGHGGFHDPFDIFEQMFGGGARFGGGQRRRQRSQSLQ 134

Query: 131 IDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKERL 190
           +    T++  Y G  ++F L     C  C  +G +  K         C  C  +G   ++
Sbjct: 135 VQEELTLRQYYHGTAVEFTLSLNDHCDHCGATGSQDGKV------ERCTQCSVRGVIVQV 188

Query: 191 KRFGPGLVASQW-VVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGHH 249
            R   G +  Q+  VC +  G       PK     C  C+      K +   V VPPG  
Sbjct: 189 GR--QGFMTQQFQQVCPRLLGPW-----PKALPKKCKVCQGHKAIKKNKSFRVEVPPGAP 241

Query: 250 FNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVSL 309
             D V V+    E++     GD+   + E   D      +  +  G N   L+ +  +SL
Sbjct: 242 -RDFVAVQQGEAEKVPDMDPGDIYVKVFENTRD-----NMGYRRQGAN---LFRTEVLSL 292

Query: 310 SEALTG-FEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLYV 367
            EAL G +++             S K G+ ++ G++ ++   G P+ D      GDLYV
Sbjct: 293 KEALHGDWKRELEFLDPSKKVPFSRKKGQTVQHGEVERVPGFGMPLPDS--AGFGDLYV 349

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
           {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077w
          Length = 479

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 100/418 (23%), Positives = 153/418 (36%), Gaps = 84/418 (20%)

Query: 9   RLYDVLGVTREASVQEIKTAYRKLALKHHPDKS------------VDQDSKELNETKFKE 56
           RLYD+L V  +AS   IK A+   AL+ HPDK+            + +  + L++ K +E
Sbjct: 6   RLYDLLNVECDASQVTIKKAFHAAALRCHPDKNNHSEESKKQFQEISKAYEVLSDPKSRE 65

Query: 57  ITAAYEILSDP---------EKKSHY--------------DLYXXXXXXXXXXXXXXXXX 93
           +   Y    +          E  S Y              DL+                 
Sbjct: 66  MYDRYGTTDESAIASQEPFGEGMSFYSGGNPMHMFGTSAGDLFAQFFNSSGDAGPSFGFG 125

Query: 94  XXXXXXXXXXXAHEANDFPNEHEMYEGNETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQ 153
                      AH A D              +  DI   L   + DLY GKK K  L R 
Sbjct: 126 SRFDGFGNSAQAHGARD----------GHMRTGPDIKHYLKCNLSDLYQGKKTKLGLNRM 175

Query: 154 IICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGK 213
            +C  C G G              C +C G+G   + +R GP +V +    C  CHG G 
Sbjct: 176 RVCSSCDGKGG--------MRVASCRTCKGQGEVVKTRRVGP-MVQTMSSTCNSCHGTGT 226

Query: 214 YTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGHHFNDVVTVKGMADEEID------KA 267
           + K      + C  C+  G+  ++++  V V  G   N V+ + G ADE I+      K 
Sbjct: 227 FIK----DSDLCFVCKGSGVSKERKIFDVEVKAGMTHNQVIVLPGEADEVIETSHGLIKV 282

Query: 268 VCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYV-SITVSLSEALTGFEKXXXXXXXX 326
             GD++  +++  ++ Q + V        N  DL + +  V L   L G E         
Sbjct: 283 QPGDVVI-VIDLVKNTQFQVV--------NDHDLVLKNCEVPLKTCLCGGEIMIEGHPSG 333

Query: 327 XXXXXSIKPGKVIRPGDIIKITNEGWPIL----DHPR------GQCGDLYVFVDIEFP 374
                SI P ++++P     +   G P +    DH           G+LYV   ++FP
Sbjct: 334 KIIKLSIIPNELLKPSCFKTVEGLGMPKVIANSDHANIAGTDIDGYGNLYVQFQVKFP 391

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218
          Length = 494

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 111/258 (43%), Gaps = 31/258 (12%)

Query: 128 DIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSK 187
           DI   L  T+++LY GK  K  L R  +C  C G G   +          CESC G G +
Sbjct: 153 DIKHVLKCTLRELYNGKMAKLALNRTRLCLPCNGFGGLQRTT--------CESCQGDGFQ 204

Query: 188 ERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPG 247
            + +R GP +V +    C  C G G + K      + CP C   G   ++++  V V PG
Sbjct: 205 TQTRRMGP-MVQTWTQTCASCDGAGCFIK----PNDVCPHCHGEGFIRERKIFHVEVKPG 259

Query: 248 HHFNDVVTVKGMADEEI------DKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDL 301
                 V ++G ADE +      +K + GD++  + +  ++    Q++       N +DL
Sbjct: 260 FQDGKDVIMQGEADEIMLNNLVKEKVIPGDVVITIKQSRDENNCFQMI-------NNKDL 312

Query: 302 YVS-ITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPIL----D 356
            ++   V L  +L G E               I PG++++P     I   G P L    D
Sbjct: 313 LMNGCPVDLVTSLCGGEVYIDNHPSGKLIKLDIIPGEILKPNCFKIIEGLGMPYLEDGKD 372

Query: 357 HPRGQCGDLYVFVDIEFP 374
               + GDLY+   I++P
Sbjct: 373 DTMLRRGDLYIQFKIQYP 390

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LY+ L V   A+  +IK AY+KLALK+HPDK+   +  E ++TKF+ +  AYEIL+D +
Sbjct: 6  KLYETLNVPITATTLDIKKAYKKLALKYHPDKN---NHSEDSKTKFQAVCQAYEILNDKQ 62

Query: 69 KKSHYD 74
           ++ YD
Sbjct: 63 SRAIYD 68

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.218
           YNL077W
          Length = 448

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/250 (26%), Positives = 107/250 (42%), Gaps = 26/250 (10%)

Query: 128 DIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSK 187
           DI+ +L  T+KDLY GK+ K  L+R  +C  C+G G        V   M C  C G G+ 
Sbjct: 159 DINHNLKCTIKDLYRGKRSKLRLERSKLCSICKGDGG-------VKRSM-CNQCHGDGNI 210

Query: 188 ERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPG 247
               R GP ++ +    C  C+G G      +     C  C  VG   + ++  V + PG
Sbjct: 211 TETTRLGP-MLQTFTHTCNICNGNGWVIISQET----CQGCNGVGFYNEMKIFDVEIYPG 265

Query: 248 HHFNDVVTVKGMADEEIDK--AVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYV-S 304
                 +      DE ++K   + G++I H+ E  ED + K+V        + QDLY  +
Sbjct: 266 MKDGTQIVFNNEGDEIVNKRRVIPGNVIIHINE-IEDNKFKRV-------NDGQDLYYWN 317

Query: 305 ITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGD 364
             + L  +L G                 I PG++I  G +  + + G P   +   + G 
Sbjct: 318 YEIDLFTSLCGGVIYIKGHPNNKLIKVDILPGEIIESGSVKGVESLGMP--KNKGNEYGI 375

Query: 365 LYVFVDIEFP 374
           LY+   +++P
Sbjct: 376 LYIQFQVKYP 385

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 43/68 (63%), Gaps = 3/68 (4%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          RLY+ L +   AS  +IK AYR  AL++HPDK+   +  E ++ KF++I+ AY IL D  
Sbjct: 6  RLYNALNIPPTASQSDIKKAYRVQALRYHPDKN---NESEESKKKFQDISEAYSILRDEN 62

Query: 69 KKSHYDLY 76
          ++  YD Y
Sbjct: 63 QRKMYDKY 70

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa]
          {ON} highly similar to uniprot|P25294 Saccharomyces
          cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LYD+LG++  A+ QEIK  YRK ALK+HPDK         +  KFKEI+ A+EILSDP+
Sbjct: 6  KLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTG------DTEKFKEISEAFEILSDPQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREVYDQY 67

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score = 72.4 bits (176), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 80/304 (26%), Positives = 121/304 (39%), Gaps = 50/304 (16%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           Y  LGV+R+AS  +IK AY KLA K+HPD + +  +    +  F  +  AYEILSD +KK
Sbjct: 50  YKTLGVSRDASPSDIKRAYYKLAKKYHPDINKEPGA----DKTFHNLQNAYEILSDEKKK 105

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXX---------------XAHEANDFPNEH 115
             YD Y                                           A   + F N  
Sbjct: 106 LQYDQYGSSAFDQNGNANGAGGFNPFGGGASASGFADFGGLNFEDLFGAAFGRSGFRNGG 165

Query: 116 EM--YEGNETT----SSKDIDIDLSFTMKDLYMG-KKLKFELKRQIICGKCQGSGWKAKK 168
           +   + G            I+I    + KD   G   +  + K    CG C GSG K  +
Sbjct: 166 DAGGFNGRANIVREYQGDSIEIQHVVSFKDAVFGLNNVSLKYKSLDPCGTCHGSGLKNGE 225

Query: 169 KVHVTHEME-CESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPD 227
           +    H+ + C  C G G++  +K    G   +    C  CHG+G        R++ C  
Sbjct: 226 Q----HKRKTCSYCNGTGTQVHVK---SGFQMAS--TCMHCHGEGTTIA----REDTCSA 272

Query: 228 CESVGLQYK-KEVITVNVPPGHHFNDVVTVKG------MADEEIDKAV---CGDLIFHLV 277
           C+  G++   K+ + VN P G    DV+ + G      +A  E DK++    GDL+  + 
Sbjct: 273 CDGDGVKINSKKSLNVNFPSGLSDGDVIRIPGEGSYPNIAVGENDKSIKLSRGDLLVRIR 332

Query: 278 EKPE 281
            K +
Sbjct: 333 VKSD 336

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {ON}
           Anc_2.218
          Length = 530

 Score = 72.0 bits (175), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 71/270 (26%), Positives = 113/270 (41%), Gaps = 36/270 (13%)

Query: 128 DIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSK 187
           DI   L+ T+K+LY GKK K  L R   C  C G G          + + C  C GKG  
Sbjct: 172 DIKHVLNCTLKELYQGKKCKLGLNRTRSCHSCNGMGG--------MNTIICNECQGKGIN 223

Query: 188 ERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPG 247
              K  GP +V S    C  C G G +     + ++ C +C+  G   ++ + TV V PG
Sbjct: 224 TETKMLGP-MVQSWSSTCFNCSGMGYFI----DSQSGCKECQGEGYLRERTIFTVTVKPG 278

Query: 248 HHFNDVVTVKGMADEEI-------DKAVCGDLIFHLVE-------KPEDLQQKQVLMK-K 292
              N  + +KG AD+ +       +K + GD+I  + +          ++ Q +   K  
Sbjct: 279 MRNNQKIVLKGEADQVMLVGKLNKEKVIPGDVIIVINQIEGKSWKNDSNIDQGENKNKFH 338

Query: 293 FGGGNLQDLYV-SITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEG 351
           F   N +DL + +  + L  +L G E               I P ++++P  +  + N G
Sbjct: 339 FEIINEKDLLLRNCQIDLITSLCGGEIYIKNHPSGKLIKLDIIPSEILKPDCLKCVENLG 398

Query: 352 WP--ILDHPRGQ-----CGDLYVFVDIEFP 374
            P  I D           GDLY+   +++P
Sbjct: 399 MPRYIEDETNNGEEYLPNGDLYIQFKVKYP 428

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 50/73 (68%), Gaps = 3/73 (4%)

Query: 4  SDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEI 63
          +++  RLY +L V   A++ EIK AY+KLALK+HPDK+   +  E ++ KF+EI  AYE+
Sbjct: 8  NNNNTRLYSILQVPTAATLFEIKNAYKKLALKYHPDKN---NHSEESKLKFQEICKAYEV 64

Query: 64 LSDPEKKSHYDLY 76
          L D +KK  YD Y
Sbjct: 65 LHDKDKKLLYDTY 77

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
          Anc_1.398
          Length = 363

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LYD+LGVT  A+ QEIK  YRK ALK+HPDK         +  KFK+I+ AYEILSD  
Sbjct: 6  KLYDLLGVTPSANEQEIKKGYRKAALKYHPDKPTG------DTEKFKQISEAYEILSDSN 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDQY 67

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
          SIS1Type II HSP40 co-chaperone that interacts with the
          HSP70 protein Ssa1p; not functionally redundant with
          Ydj1p due to due to substrate specificity; shares
          similarity with bacterial DnaJ proteins
          Length = 352

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QE+K  YRK ALK+HPDK         +  KFKEI+ A+EIL+DP+
Sbjct: 6  KLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTG------DTEKFKEISEAFEILNDPQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDQY 67

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa]
          {ON} YNL007C (REAL)
          Length = 359

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QE+K  YRK ALK+HPDK         +  KFKEI+ A+EIL+DP+
Sbjct: 6  KLYDMLGVSPTANEQELKKGYRKAALKYHPDKPTG------DTEKFKEISEAFEILNDPQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDQY 67

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON}
          Anc_1.398 YNL007C
          Length = 355

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QEIK  YRK ALK+HPDK         N  KFKEI+ A+EILSD  
Sbjct: 6  KLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTG------NTEKFKEISEAFEILSDSN 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREVYDQY 67

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QEIK  YRK AL++HPDK         N  KFK+I+ AYEILSD  
Sbjct: 6  KLYDLLGVSPSANDQEIKKGYRKAALQYHPDKPTG------NTEKFKQISEAYEILSDSN 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREVYDQY 67

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LYD+LGV+  AS  E+K  YRK ALK+HPDK         +  KFKEI+ A+EILSDP 
Sbjct: 6  KLYDLLGVSPSASDAELKKGYRKAALKYHPDKPTG------DTEKFKEISEAFEILSDPN 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREVYDTY 67

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa]
          {ON} Anc_1.398 YNL007C
          Length = 353

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LYD+LGV+  AS  EIK  YRK ALK+HPDK         +  KFKEI+ A+EILSD  
Sbjct: 6  KLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTG------DTEKFKEISEAFEILSDSN 59

Query: 69 KKSHYDLY 76
          K+S YD Y
Sbjct: 60 KRSVYDQY 67

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON}
          Anc_1.398 YNL007C
          Length = 359

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QEIK  YRK ALK+HPDK         +  KFKEI+ A+EILSD  
Sbjct: 6  KLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTG------DTEKFKEISEAFEILSDKN 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREVYDQY 67

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 357

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QE+K  Y+K ALK+HPDK         +  KFKEI+ AYEILSD  
Sbjct: 6  KLYDMLGVSPSANEQELKKGYKKAALKYHPDKPAG------DTEKFKEISEAYEILSDSS 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDQY 67

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 63/154 (40%), Gaps = 14/154 (9%)

Query: 221 RKNFCPDCESVGLQYKKEVITVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKP 280
           +K+F    ++ G  ++K  I + + PG      +T K   D          L F L EK 
Sbjct: 203 KKSFKIGRKNRGGSFEKTQIDIQLKPGWKAGTKITYKNEGDYNPQTGGRKTLQFVLQEKS 262

Query: 281 EDLQQKQVLMKKFGGGNLQDLYVSITVSLSEALTGFEKXXXXXXXXXXXXXSIKPGKVIR 340
             L ++          +  +L  S+ +S  E+L GF K              I+P   ++
Sbjct: 263 HPLYKR----------DGDNLIYSLPLSFKESLLGFSKTIQTIDGRTLPISKIQP---VQ 309

Query: 341 PGDIIKITNEGWPILDHPRGQCGDLYVFVDIEFP 374
           P ++     +G P+   P GQ GDL V   I++P
Sbjct: 310 PTEVSSYPGQGMPVSKRP-GQRGDLVVKYKIDYP 342

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
          YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
          82] FULL
          Length = 353

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LYD+LGV+  A   E+K  YRK ALK+HPDK         +  KFKEI+ A+EIL+DP+
Sbjct: 6  KLYDLLGVSPSAQETELKKGYRKAALKYHPDKPSG------DAEKFKEISEAFEILNDPQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREVYDTY 67

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
          (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 44/67 (65%), Gaps = 6/67 (8%)

Query: 10 LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEK 69
          LYD+L V+  A+ QEIK  YRK ALK+HPDK         +  KFKEI+ A+EILSD EK
Sbjct: 7  LYDLLNVSPTANEQEIKKGYRKAALKYHPDKPTG------DTEKFKEISEAFEILSDAEK 60

Query: 70 KSHYDLY 76
          +  YD Y
Sbjct: 61 REVYDQY 67

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 35/65 (53%), Gaps = 9/65 (13%)

Query: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQ--------GSGWKAKKKVHVTHEMECE- 179
           + +DL  +++DL+ GKK  F++ R+   G+ +         +GWKA  K+   ++ +   
Sbjct: 187 VQVDLPVSLEDLFEGKKKTFKIGRKGPNGEAEKAQIEIALKAGWKAGTKITYKNQGDYNP 246

Query: 180 SCGGK 184
           S GG+
Sbjct: 247 STGGR 251

>NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398
          Length = 327

 Score = 67.8 bits (164), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QE+K  YRK ALK+HPDK         +  KFKEI+ A+EIL+DP 
Sbjct: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTG------DTEKFKEISEAFEILNDPN 59

Query: 69 KKSHYDLY 76
           +  YD Y
Sbjct: 60 TREVYDQY 67

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON}
          Anc_1.398
          Length = 367

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LYD+L V   A+ QE+K  YRK ALK+HPDK         +  KFKEI+ A+EIL+DP+
Sbjct: 6  KLYDLLNVQPTANEQELKKGYRKAALKYHPDKPTG------DTEKFKEISEAFEILNDPQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDQY 67

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 350

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LYD+LGV+  A   E+K  YRK ALK+HPDK         +  KFKEI+ A+EIL+DP+
Sbjct: 6  KLYDLLGVSPSAQETELKKGYRKAALKYHPDKPTG------DAEKFKEISEAFEILNDPQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDNY 67

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
           (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 107/244 (43%), Gaps = 28/244 (11%)

Query: 127 KDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGS 186
           + I +  + T+KD Y G  + F L     C  C GSG +  K        +C  CGG+G 
Sbjct: 150 QSIKVRHALTLKDYYNGGSISFSLLLNDNCDHCHGSGSEDGKV------KKCPDCGGRGV 203

Query: 187 KERLKRFGPGLVASQWV--VCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNV 244
             ++ R G   + +Q V   C +C G G+        +N C  C    +Q K++ I+V+ 
Sbjct: 204 VIQVIRMG---IVTQQVQQRCNRCAGSGEII------QNKCKVCSGAKVQKKEKDISVSF 254

Query: 245 PPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVS 304
             G   N +   +G A E+      GDLI    E PE      +  ++ G    +DL+ +
Sbjct: 255 DSGIERNHISVQQGEA-EKGPGIEPGDLIVEFFEVPE----ANMGYRRRG----KDLFRT 305

Query: 305 ITVSLSEALTG-FEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCG 363
             ++L EA+ G + +                P  ++  G++ KI   G PIL   +G+ G
Sbjct: 306 EVLTLQEAINGDWSRDIQFLDPTKKLQLKRSPMDIVMNGEVEKIPGFGMPILG-SKGKFG 364

Query: 364 DLYV 367
           DLY+
Sbjct: 365 DLYI 368

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 47/67 (70%), Gaps = 5/67 (7%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSV-DQDSKELNETKFKEITAAYEILSDPEK 69
          Y +LG+++  + +EIK+AYR+L+ K HPDK+  D+D+      KF EI  AYE+LSDPEK
Sbjct: 25 YKILGLSKNCNEKEIKSAYRQLSKKFHPDKNPNDEDA----HNKFIEIGEAYEVLSDPEK 80

Query: 70 KSHYDLY 76
          +  YD +
Sbjct: 81 RRMYDQF 87

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
          to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LYD+LGV+  A   E+K  YRK ALK+HPDK         +  KFKEI+ A+EIL+DP+
Sbjct: 6  KLYDLLGVSPSADEGELKKGYRKAALKYHPDKPTG------DTEKFKEISEAFEILNDPQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDSY 67

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa]
          {ON} similar to gnl|GLV|CAGL0H03707g Candida glabrata
          CAGL0H03707g and some similarites with YNL007C
          uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 44/68 (64%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LYD+LG++  A   EIK  YRK ALK+HPDK         +  KFKEI+ A+EILSD +
Sbjct: 6  KLYDLLGISPSAGEAEIKKGYRKAALKYHPDKPTG------DTEKFKEISEAFEILSDAQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREVYDTY 67

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
          {ON} Anc_1.398 YNL007C
          Length = 369

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QE+K  YRK ALK+HPDK         +  KFKEI+ A+EIL+D +
Sbjct: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTG------DTEKFKEISEAFEILNDSQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDQY 67

>KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {ON}
           Anc_8.61 YFL016C
          Length = 498

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 73/268 (27%), Positives = 117/268 (43%), Gaps = 41/268 (15%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           Y  LG+   AS  +IK AY KLA K+HPD + ++++    E KF ++  AYEILSD +K+
Sbjct: 49  YKTLGINSNASQSDIKKAYYKLAKKYHPDINKEENA----EAKFHDLQNAYEILSDEQKR 104

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEANDFP--NEHEMYEGN------- 121
             YD +                             +  +DF   N  +++ GN       
Sbjct: 105 KQYDQFGPSAFDPNINTSGNSNPFTSDPFGFGTTNNPFSDFGGINFEDLF-GNAFKQQHS 163

Query: 122 -----------ETTSSKDIDIDLSFTMKDLYMGKK-LKFELKRQIICGKCQGSGWKAKKK 169
                             I ++ +   KD   GKK +K        C  C GSG K    
Sbjct: 164 NNTSNSNRNFFREFKGDTIHLNYNLNFKDSVFGKKNVKLNFNSFDPCNTCNGSGLK---- 219

Query: 170 VHVTHEMECESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCE 229
            H  H+  C++C G G++  + R G  ++++    C  C+G+G  TK   N  ++C  C 
Sbjct: 220 -HNAHKSTCQTCNGTGTRVHI-RGGFQMMST----CNDCNGEG--TKIDPN--DYCNHCH 269

Query: 230 SVGLQYKK-EVITVNVPPGHHFNDVVTV 256
             G+++K+ + ITV++P      DV+ V
Sbjct: 270 GDGVEFKRNKEITVDLPNALQDGDVIRV 297

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa]
          {ON} YNL007C (REAL)
          Length = 366

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QE+K  YRK ALK+HPDK         +  KFKEI+ A+EIL+D +
Sbjct: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTG------DTEKFKEISEAFEILNDSQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDQY 67

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa]
          {ON} YNL007C (REAL)
          Length = 368

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QE+K  YRK ALK+HPDK         +  KFKEI+ A+EIL+D +
Sbjct: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTG------DTEKFKEISEAFEILNDAQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDQY 67

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa]
          {ON} Anc_1.398 YNL007C
          Length = 363

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QE+K  YRK ALK+HPDK         +  KFKEI+ A+EIL+D +
Sbjct: 6  KLYDLLGVSPTANEQELKKGYRKSALKYHPDKPTG------DTEKFKEISEAFEILNDKQ 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREIYDQY 67

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
          similar to Ashbya gossypii AAL008W
          Length = 347

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 44/68 (64%), Gaps = 6/68 (8%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          +LYD+LGV+   +  E+K  YRK ALK+HPDK         +  KFKEI+ A+EIL+DP 
Sbjct: 6  KLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTG------DTEKFKEISEAFEILNDPN 59

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 60 KREVYDKY 67

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 43/91 (47%), Gaps = 20/91 (21%)

Query: 127 KDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGS--------GWKAKKKVHVTHEMEC 178
           K + ++L  +++DLY GK+  F++ R+   G  +          GWKA  K  +T++ E 
Sbjct: 175 KVVQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTK--ITYKNEG 232

Query: 179 ESCGGKGSKERLKRFGPGLVASQWVVCEKCH 209
           +     G ++ L          Q+++ EK H
Sbjct: 233 DYNPSTGGRQTL----------QFIIQEKMH 253

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON}
          Anc_7.217 YER048C
          Length = 387

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (66%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YDVLGV+  A+  EIK AYRK A++ HPDK+ D       ETKF+ +  AY++LSD E +
Sbjct: 8  YDVLGVSPTATAMEIKKAYRKKAMQTHPDKNPDDPEA---ETKFQAVGEAYQVLSDTELR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SRYDQF 70

>TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON}
          Anc_2.350 YMR161W
          Length = 225

 Score = 61.2 bits (147), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 45/71 (63%), Gaps = 6/71 (8%)

Query: 6  SKDR--LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEI 63
          SKDR   Y+VL + R AS  EIK +YRKLA+K HPDK+    + E     FK I  A+E+
Sbjct: 19 SKDRQAFYEVLQIERSASDNEIKKSYRKLAIKLHPDKNPHPRASE----AFKVINRAFEV 74

Query: 64 LSDPEKKSHYD 74
          LSD EK+  YD
Sbjct: 75 LSDEEKRRLYD 85

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
          HLJ1Co-chaperone for Hsp40p, anchored in the ER
          membrane; with its homolog Ydj1p promotes ER-associated
          protein degradation (ERAD) of integral membrane
          substrates; similar to E. coli DnaJ
          Length = 224

 Score = 61.2 bits (147), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 45/71 (63%), Gaps = 4/71 (5%)

Query: 4  SDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEI 63
          S  K   Y++L V R+A+  EIK AYRKLA+K HPDK+    + E     FK I  A+E+
Sbjct: 16 SKDKHEFYEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGE----AFKVINRAFEV 71

Query: 64 LSDPEKKSHYD 74
          LS+ EK+S YD
Sbjct: 72 LSNEEKRSIYD 82

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {ON}
           Anc_8.730 YMR214W
          Length = 384

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 103/250 (41%), Gaps = 30/250 (12%)

Query: 129 IDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWK-AKKKVHVTHEMECESCGGKGSK 187
           + ++   ++K  Y G   +F L     C  C G+G +  K KV       C  C G G  
Sbjct: 151 LKVEQQLSLKQYYQGFDFQFALNLHDDCDHCHGTGSEDGKTKV-------CPDCKGSGII 203

Query: 188 ERLKRFGPGLVASQWVV--CEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVP 245
            ++ R G   + +Q +   C +C G+G   K      NFC  C    +Q K +   V VP
Sbjct: 204 IQIIRMG---MMTQQIQQPCGRCRGQGHLIK------NFCKVCNGAKVQQKLKDFKVYVP 254

Query: 246 PGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSI 305
           PG   N V    G A++  +    GD+I    E P D      L  +  G N   L+ + 
Sbjct: 255 PGSPRNHVEVKAGQAEKNPNYEP-GDVIIEFNELPLD-----NLGYRRRGNN---LFRTE 305

Query: 306 TVSLSEALTG-FEKXXXXXXXXXXXXXSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGD 364
            +SL+EAL G +E+                P   I  G+I  +   G PI  + + + GD
Sbjct: 306 YISLNEALYGNWERTLDFLDPKKRINLKRSPNVTIYDGEIEILKGFGMPI-PNKKNKFGD 364

Query: 365 LYVFVDIEFP 374
           LY+   +  P
Sbjct: 365 LYIDYKVIIP 374

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 43/68 (63%), Gaps = 4/68 (5%)

Query: 8  DRLYDVLGVTREASVQ-EIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSD 66
          D  Y +LG+ +    + EIK+AYRKL+ K+HPDK+ +    + N   F ++  AY++L D
Sbjct: 23 DDYYKILGINKNYKYEKEIKSAYRKLSKKYHPDKNKNDKDAQQN---FIKVGEAYDVLGD 79

Query: 67 PEKKSHYD 74
          P+KK  YD
Sbjct: 80 PDKKRQYD 87

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa]
          {ON} some similarities with uniprot|P48353
          Saccharomyces cerevisiae YMR161W
          Length = 233

 Score = 61.2 bits (147), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 43/68 (63%), Gaps = 4/68 (5%)

Query: 7  KDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSD 66
          K   Y+VL + REAS  EIK AYRKLA+K HPDK+    + E     FK I  A+E+LSD
Sbjct: 20 KHAFYEVLQIEREASDNEIKKAYRKLAIKLHPDKNKHPRASE----AFKRINRAFEVLSD 75

Query: 67 PEKKSHYD 74
           +K+  +D
Sbjct: 76 EQKRRIFD 83

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 428

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 45/66 (68%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+L V+ +AS QEIK +YRKLA+K HPDK+ D       +TKF+E+  AY++L D + +
Sbjct: 8  YDILQVSVDASPQEIKKSYRKLAIKTHPDKNPDDPQA---QTKFQELAKAYQVLIDDDLR 64

Query: 71 SHYDLY 76
            YD +
Sbjct: 65 KKYDQF 70

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 395

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LG+  +AS  EIK AYRK A+  HPDK  D       + KF+ I  AY++LSDPE +
Sbjct: 8  YDLLGIQPDASATEIKKAYRKKAMLTHPDKHPDDPE---AQAKFQAIGQAYQVLSDPELR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SRYDEF 70

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 4/71 (5%)

Query: 4  SDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEI 63
          S  K   Y++L V R+A+  +IK AYRKLA+K HPDK+    + E     FK I  A+E+
Sbjct: 16 SKDKHEFYEILKVDRKATDSDIKKAYRKLAIKLHPDKNSHPKAGE----AFKVINRAFEV 71

Query: 64 LSDPEKKSHYD 74
          LS+ EK+S YD
Sbjct: 72 LSNEEKRSIYD 82

>TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON}
          Anc_7.217 YER048C
          Length = 380

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 44/66 (66%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YDVLGVT EA+  +IK AYRK A++ HPDK  D       ++KF+ +  AY++LSDP  +
Sbjct: 8  YDVLGVTPEATPTDIKKAYRKKAMQTHPDKHPDDPEA---QSKFQAVGEAYQVLSDPGLR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SKYDQF 70

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
          similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68
          + YDVLGV  +A+ ++IK AYRK A++ HPDK+ +       + KF+E++ AY++LSD E
Sbjct: 6  KYYDVLGVQPDATAEQIKKAYRKKAIQTHPDKNPNDPEA---QAKFQEVSKAYKVLSDGE 62

Query: 69 KKSHYD 74
           +S YD
Sbjct: 63 LRSRYD 68

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
          YMR161W
          Length = 233

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 43/71 (60%), Gaps = 4/71 (5%)

Query: 4  SDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEI 63
          S  K   YD+L V + A   EIK +YRKLA+K HPDK+    + E     FK I  A+E+
Sbjct: 19 SKEKHAFYDILNVQKSADSVEIKKSYRKLAIKLHPDKNPHPKAGE----AFKVINRAFEV 74

Query: 64 LSDPEKKSHYD 74
          LSD EK+S +D
Sbjct: 75 LSDDEKRSVFD 85

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa]
          {ON} YNL227C (REAL)
          Length = 593

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 47/66 (71%), Gaps = 6/66 (9%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVD--QDSKELNETKFKEITAAYEILSDPE 68
          Y++LGV   AS  E+K AYRK AL++HPDK+ D  Q++ E    KF  I AAYE+LSDP+
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNVQEATE----KFAIIRAAYEVLSDPQ 61

Query: 69 KKSHYD 74
          +++ YD
Sbjct: 62 ERAWYD 67

>TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON}
          Anc_7.217 YER048C
          Length = 389

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (66%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YDVLG+  +A+  EIK AYR+ A++ HPDK  D       ++KF+ +  AY++LSDP+ K
Sbjct: 8  YDVLGIQPDATPAEIKKAYRRKAMQTHPDKHPDDPDA---QSKFQAVGEAYQVLSDPQLK 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SRYDQF 70

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
          JJJ1Co-chaperone that stimulates the ATPase activity of
          Ssa1p, required for a late step of ribosome biogenesis;
          associated with the cytosolic large ribosomal subunit;
          contains a J-domain; mutation causes defects in
          fluid-phase endocytosis
          Length = 590

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 45/64 (70%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y++LGV   AS  E+K AYRK AL++HPDK  + D+ E    KF  I AAYE+LSDP+++
Sbjct: 6  YELLGVETHASDLELKKAYRKKALQYHPDK--NPDNVEEATQKFAVIRAAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 4/71 (5%)

Query: 4  SDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEI 63
          S  K   Y++L V ++A+  EIK AYRKLA+K HPDK+    + E     FK I  A+E+
Sbjct: 16 SKDKHEFYEILRVDKKATDGEIKKAYRKLAIKLHPDKNSHPRASE----AFKVINRAFEV 71

Query: 64 LSDPEKKSHYD 74
          LS+ EK+S YD
Sbjct: 72 LSNEEKRSIYD 82

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227c
          Length = 623

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+L V  +AS  ++K AYR+ AL++HPDK+   D+ E   T F EI AAYE+LSDP+++
Sbjct: 6  YDLLEVRSDASDLDLKKAYRRKALQYHPDKNP--DNVEEATTIFAEIRAAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
          YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
          PARTIAL
          Length = 85

 Score = 55.5 bits (132), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 32/67 (47%), Positives = 42/67 (62%), Gaps = 4/67 (5%)

Query: 4  SDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEI 63
          S  K   Y+VL V ++AS  EIK AYRKLA+K HPDK+    + E     FK I  A+E+
Sbjct: 17 SKDKHAFYEVLRVEKQASDLEIKKAYRKLAIKLHPDKNKHPRASE----AFKRINRAFEV 72

Query: 64 LSDPEKK 70
          LSD +K+
Sbjct: 73 LSDEQKR 79

>Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON}
          (52022..53164) [1143 nt, 381 aa]
          Length = 380

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LGV  EA+  EIK AYR+ A++ HPDK  D       ++KF+ +  AY++LSDP  +
Sbjct: 8  YDILGVKPEATPAEIKKAYRRRAMETHPDKHPDDPEA---QSKFQAVGEAYQVLSDPGLR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SRYDEF 70

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON}
          Anc_7.217
          Length = 387

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YDVLGV   A+  EIK AYR+ A++ HPDK  D       + KF+E+  AY++LSDP  +
Sbjct: 8  YDVLGVQPTATPAEIKKAYRRRAMQTHPDKHPDDPE---AQAKFQEVGEAYQVLSDPGLR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SRYDEF 70

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 525

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 48/64 (75%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y++LGV+  A   E+K A+R+ AL++HPDK+ D + +E  ET F +I AAYE+L+DP+++
Sbjct: 6  YELLGVSSTADDLELKKAFRRKALQYHPDKNRD-NVEEATET-FAQIRAAYEVLNDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
          {ON} highly similar to uniprot|P39101 Saccharomyces
          cerevisiae YER048c CAJ1
          Length = 382

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (62%), Gaps = 3/67 (4%)

Query: 10 LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEK 69
           YDVLG++ EA+  EIK AYRK+A+  HPDK  D       + KF+ +  AY++L+DP  
Sbjct: 7  FYDVLGISPEATPSEIKKAYRKMAMLTHPDKHPDDPE---AQAKFQAVGEAYQVLNDPAL 63

Query: 70 KSHYDLY 76
          +  YD +
Sbjct: 64 RKQYDEF 70

>KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON}
          Anc_2.350 YMR161W
          Length = 219

 Score = 57.8 bits (138), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 42/71 (59%), Gaps = 4/71 (5%)

Query: 4  SDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEI 63
          S  K   Y+VL V R AS  EIK AYR+LA+K HPDK+    S E     FK I  A+E+
Sbjct: 18 SRDKSEFYEVLQVERTASDNEIKKAYRRLAIKLHPDKNGHPRSAE----AFKVINRAFEV 73

Query: 64 LSDPEKKSHYD 74
          L D +K+  +D
Sbjct: 74 LGDEDKRRLFD 84

>ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161W
          Length = 238

 Score = 57.8 bits (138), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 44/71 (61%), Gaps = 4/71 (5%)

Query: 4  SDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEI 63
          S  K + Y++L V R A+  EIK +YRKLA++ HPDK+    + E     FK I  A+E+
Sbjct: 17 SKDKHQFYEILKVERTANDNEIKKSYRKLAIRLHPDKNPHPRASE----AFKLINRAFEV 72

Query: 64 LSDPEKKSHYD 74
          L D EK+S YD
Sbjct: 73 LGDSEKRSLYD 83

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
          Anc_2.350
          Length = 224

 Score = 57.4 bits (137), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 43/71 (60%), Gaps = 4/71 (5%)

Query: 4  SDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEI 63
          S  K   Y++L V + A+  EIK AYRKLA+K HPDK+    + E     FK I  A+E+
Sbjct: 17 SKDKHAFYEILKVEKTANDNEIKKAYRKLAVKLHPDKNPHPKASE----AFKIINRAFEV 72

Query: 64 LSDPEKKSHYD 74
          LSD EK+  YD
Sbjct: 73 LSDVEKRQLYD 83

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa]
          {ON} Anc_7.217 YER048C
          Length = 366

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YDVLGV+ +AS  EIK AYRK A++ HPDK  D       + KF+ +  AY++LSD E +
Sbjct: 8  YDVLGVSPKASAIEIKKAYRKRAMETHPDKHPDDPD---AQAKFQRVGEAYQVLSDEELR 64

Query: 71 SHYDLY 76
            YD +
Sbjct: 65 KRYDEF 70

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
          Anc_2.15 YNL227C
          Length = 659

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y++L V+  AS  E+K AYRK AL++HPDK  ++++ E     F EI AAYE+LSDP+++
Sbjct: 6  YELLEVSEYASDLELKKAYRKKALQYHPDK--NRENPEEATAIFSEIRAAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161w HLJ1
          Length = 232

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 43/71 (60%), Gaps = 4/71 (5%)

Query: 4  SDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEI 63
          S  K   YD+L V R +S  +IK AYRKLA+K HPDK+    + E     FK I  A+E+
Sbjct: 16 SHDKHAFYDILNVERSSSDVDIKKAYRKLAIKLHPDKNPYPKAHE----AFKLINRAFEV 71

Query: 64 LSDPEKKSHYD 74
          LSD +K+  YD
Sbjct: 72 LSDSQKRQIYD 82

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPD---KSVDQDSKELNETKFKEITAAYEILSDP 67
           YD+LGV+  AS +EIK+AYRKL+LK HPD   K + ++ K   E  + +I+ AYE L+D 
Sbjct: 122 YDLLGVSVTASDKEIKSAYRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAYEALTDE 181

Query: 68  EKKSHYDLY 76
             K +Y +Y
Sbjct: 182 LVKQNYLMY 190

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (63%), Gaps = 4/66 (6%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           Y+ LGV ++AS  +IK AY KLA + HPD + D+ +    E KF ++  AYEILSD  K+
Sbjct: 43  YETLGVAKDASASQIKKAYYKLAKQFHPDINKDEGA----EKKFHDLQNAYEILSDENKR 98

Query: 71  SHYDLY 76
             YD +
Sbjct: 99  RQYDQF 104

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 62/134 (46%), Gaps = 20/134 (14%)

Query: 129 IDIDLSFTMKDLYMGKK---LKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKG 185
           I +    + +D   G K   L++ +  Q  CG C GSG KA  +  V     C  C G G
Sbjct: 175 IQVPFKLSFRDAVFGLKDVPLRYAVYDQ--CGTCSGSGLKAGAQRSV-----CGGCHGTG 227

Query: 186 SKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQY-KKEVITVNV 244
           ++  + R G  + ++    C +C G+G Y+ R  +R   C  C   G+ + + + + ++ 
Sbjct: 228 TQVHV-RAGFQMAST----CSQCSGEG-YSIRRGDR---CGTCSGEGVVFNRNKEVKMDF 278

Query: 245 PPGHHFNDVVTVKG 258
           P G    DVV V G
Sbjct: 279 PHGLQDGDVVKVPG 292

>Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W
          (REAL)
          Length = 225

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 43/71 (60%), Gaps = 4/71 (5%)

Query: 4  SDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEI 63
          S  K   Y +L V ++A+  EIK AYRKLA+K HPDK+    + E     FK I  A+E+
Sbjct: 16 SKDKHEFYQILKVDKKATDGEIKKAYRKLAIKLHPDKNPHPKASE----AFKIINRAFEV 71

Query: 64 LSDPEKKSHYD 74
          LS+ EK+  YD
Sbjct: 72 LSNEEKRGLYD 82

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 43/71 (60%), Gaps = 4/71 (5%)

Query: 4  SDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEI 63
          S  K   Y++L V R ++  EIK AYRKLA++ HPDK+    + E     FK I  A+E+
Sbjct: 16 SKDKHAFYEILKVERTSTENEIKKAYRKLAIRLHPDKNPHPKASE----AFKIINRAFEV 71

Query: 64 LSDPEKKSHYD 74
          LSD EK+  +D
Sbjct: 72 LSDNEKRRIFD 82

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 44/64 (68%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y++LGV   AS  E+K AYRK AL+ HPDK+ D +  E  E  F  I AAYE+LSDP+++
Sbjct: 6  YELLGVEVTASDAELKKAYRKKALQFHPDKNPD-NVDEATEN-FATIRAAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa]
          {ON} YER048C (CAJ1) - homologous to E. coli DnaJ
          [contig 197] FULL
          Length = 393

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LG+  +AS  +IK AYRK A+  HPDK  D       + KF+ I  AY++LSDP+ +
Sbjct: 8  YDLLGLQPDASATDIKKAYRKKAMLTHPDKHPDDPEA---QAKFQAIGEAYQVLSDPDLR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SRYDEF 70

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa]
          {ON} YNL227C (REAL)
          Length = 600

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y++LGV   AS  E+K AYRK AL++HPDK+ D + +E  E KF  I AAYE+LSD +++
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPD-NVEEATE-KFAIIRAAYEVLSDSQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON}
          Anc_7.157 YIR004W
          Length = 446

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 45/66 (68%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LG++  A+  EIK AYRK ++K HPDK+ +  S      +F+ I+ AY++LSD + +
Sbjct: 8  YDLLGISTTATDIEIKKAYRKKSIKEHPDKNPNDPSA---TERFQAISEAYQVLSDKQLR 64

Query: 71 SHYDLY 76
          S+YD Y
Sbjct: 65 SNYDKY 70

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa]
          {ON} YNL227C (REAL)
          Length = 596

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (68%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y++LGV   AS  E+K AYRK AL++HPDK+   D+ E    KF  I AAYE+LSD +++
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKN--PDNVEEATQKFAIIRAAYEVLSDSQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON}
          Anc_1.185 YJL162C
          Length = 586

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 41/64 (64%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y VLG+T +ASV EI+ +Y KLA   HPDKS    S+EL    FK ++ A+ IL DPE K
Sbjct: 16 YSVLGLTSKASVSEIRKSYMKLAKSLHPDKSKSNASEEL----FKIVSNAHSILIDPELK 71

Query: 71 SHYD 74
            YD
Sbjct: 72 LDYD 75

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
          to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 590

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 45/64 (70%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y++LGV   AS  ++K AYR+ AL++HPDK+   D+ E   T F  I +AYE+L+DP+++
Sbjct: 6  YELLGVETTASDSDLKKAYRRKALQYHPDKN--PDNVEEATTVFATIRSAYEVLADPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LG+  EA+  EIK AYR+ A++ HPDK  D       + KF+ +  AY++LSDP  +
Sbjct: 8  YDILGIKPEATSTEIKKAYRRKAMETHPDKHPDDPDA---QAKFQAVGEAYQVLSDPGLR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SKYDEF 70

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
          similarities with uniprot|P48353 Saccharomyces
          cerevisiae YMR161W
          Length = 232

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 4/68 (5%)

Query: 7  KDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSD 66
          K   Y++L V + AS  EIK AYRKLA++ HPDK+    + E     FK I  A+E+LSD
Sbjct: 22 KHEFYELLQVEKGASDNEIKKAYRKLAIRLHPDKNTHPRASE----AFKRINRAFEVLSD 77

Query: 67 PEKKSHYD 74
            K+  +D
Sbjct: 78 VGKRRMFD 85

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa]
          {ON} YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 44/64 (68%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y++LGV   AS  ++K AYRK AL +HPDK  ++D+ E     F  I AAYE+L+DP+++
Sbjct: 6  YELLGVETTASDADLKKAYRKKALVYHPDK--NRDNVEEATAIFATIRAAYEVLADPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LGV  +A+  EIK AYR+ A++ HPDK  D       + KF+ +  AY++LSDP  +
Sbjct: 8  YDILGVEPDATPTEIKKAYRRKAMQTHPDKHPDDPDA---QAKFQAVGEAYQVLSDPGLR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SRYDEF 70

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDK---SVDQDSKELNETKFKEITAAYEILSDP 67
           Y++LGVT  ++ +EIK AYR L+LK HPDK   ++ +  +   E  F +I+ AYE L++P
Sbjct: 123 YEILGVTVSSTEKEIKKAYRNLSLKFHPDKLDRNLSEKERLSMEEIFVQISKAYEALTNP 182

Query: 68  EKKSHYDLY 76
             K +Y LY
Sbjct: 183 ATKENYLLY 191

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
          CAJ1Nuclear type II J heat shock protein of the E. coli
          dnaJ family, contains a leucine zipper-like motif,
          binds to non-native substrates for presentation to
          Ssa3p, may function during protein translocation,
          assembly and disassembly
          Length = 391

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LG+  EA+  EIK AYR+ A++ HPDK  D       + KF+ +  AY++LSDP  +
Sbjct: 8  YDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPD---AQAKFQAVGEAYQVLSDPGLR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SKYDQF 70

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar
          to Ashbya gossypii AFL190C
          Length = 243

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 4/68 (5%)

Query: 7  KDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSD 66
          K   Y++L + +EAS  ++K AYRKLA+K HPDK+    + E     FK+I  A+E+LSD
Sbjct: 22 KHSFYELLQIDKEASDSDVKKAYRKLAIKLHPDKNRHPRAAE----AFKKINRAFEVLSD 77

Query: 67 PEKKSHYD 74
            K+  YD
Sbjct: 78 ENKRKVYD 85

>Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260)
          [687 nt, 229 aa]
          Length = 228

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (61%), Gaps = 6/71 (8%)

Query: 6  SKDR--LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEI 63
          SK+R   Y+VL V R +   EIK +YRKLA+K HPDK+    + E     FK I  A+E+
Sbjct: 17 SKERHDFYNVLKVERSSDETEIKKSYRKLAIKLHPDKNPHPKASE----AFKVINRAFEV 72

Query: 64 LSDPEKKSHYD 74
          LSD EK+  +D
Sbjct: 73 LSDNEKREIFD 83

>KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.297
           YJL073W
          Length = 665

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%), Gaps = 2/66 (3%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKS--VDQDSKELNETKFKEITAAYEILSDPE 68
           Y +LG+++EA+ ++I+ AY +L  ++HPDK   + +  ++ N  K  EI  AYE LSD  
Sbjct: 561 YKILGISKEATSKDIRKAYLQLTKRYHPDKQGHLSESEQKKNHEKMSEINEAYETLSDEA 620

Query: 69  KKSHYD 74
           KKS YD
Sbjct: 621 KKSEYD 626

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa]
          {ON} Anc_7.157 YIR004W
          Length = 470

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 45/66 (68%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LG+T  A+  EIK AYRK ++K HPDK+ +  +      +F++I+ AY++LSD   +
Sbjct: 8  YDILGITPTATQAEIKKAYRKKSIKEHPDKNPNDPTA---TERFQQISEAYQVLSDEHLR 64

Query: 71 SHYDLY 76
          ++YD +
Sbjct: 65 NNYDQF 70

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPD---KSVDQDSKELNETKFKEITAAYEILSDP 67
           Y++LG++  AS ++IK+AYRKL++K HPD   K +  D K++ E  + +IT AYE L+D 
Sbjct: 127 YEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTTDEKDVMEETYVQITKAYESLTDE 186

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 187 LVRQNYLKY 195

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LG+  +A+  EIK AYR+ A++ HPDK  D       + KF+ +  AY++LSDP  +
Sbjct: 8  YDILGIKPDATSTEIKKAYRRKAMETHPDKHPDDPD---AQAKFQAVGEAYQVLSDPGLR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SKYDEF 70

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa]
          {ON} Anc_2.15 YNL227C
          Length = 626

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 43/64 (67%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y++LGV   A+  E+K AYR+ AL+ HPDK  + D+ E     F  + AAYE+L+DP+++
Sbjct: 6  YELLGVETNATDVELKKAYRRKALQFHPDK--NPDNVEETTAIFASVRAAYEVLADPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar
          to uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 43/71 (60%), Gaps = 4/71 (5%)

Query: 4  SDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEI 63
          S  K   Y++L V + AS  +IK AYRKLA+K HPDK+    + E     FK+I  A+E+
Sbjct: 17 SKDKHEFYEMLKVGKSASESDIKKAYRKLAIKLHPDKNRHPRASEA----FKKINRAFEV 72

Query: 64 LSDPEKKSHYD 74
          LSD  K+  +D
Sbjct: 73 LSDDSKRRIFD 83

>TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa]
          {ON} Anc_1.185 YJL162C
          Length = 492

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 4/65 (6%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y VLG+T  AS+ +IK +Y+KLA + HPDKS   +S EL    FK +  AY ILSD +++
Sbjct: 9  YSVLGLTPTASLNDIKKSYKKLARELHPDKSKSNESSEL----FKIVVDAYSILSDVKER 64

Query: 71 SHYDL 75
            Y++
Sbjct: 65 EEYNI 69

>TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa]
          {ON} Anc_2.350 YMR161W
          Length = 227

 Score = 54.7 bits (130), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 41/71 (57%), Gaps = 4/71 (5%)

Query: 4  SDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEI 63
          S  K   YD+L V + A   EIK +YRKLA+K HPDK+    + E     FK I  A+E+
Sbjct: 19 SKDKHAFYDILKVDKTAQDNEIKKSYRKLAIKLHPDKNPHPKASE----AFKRINRAFEV 74

Query: 64 LSDPEKKSHYD 74
          L D +K+  +D
Sbjct: 75 LGDEKKRVLFD 85

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa]
          {ON} Anc_7.217 YER048C
          Length = 396

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YDVLG+   A+  EIK AYR+ A++ HPDK  D  +      +F+++  AY++LSDP+ +
Sbjct: 8  YDVLGIPPTATATEIKKAYRRKAMETHPDKHPDDPT---ASERFQQVGEAYQVLSDPDLR 64

Query: 71 SHYDLY 76
            YD +
Sbjct: 65 KQYDEF 70

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 678

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y++LGV   AS  E+K AYRK ALK+HPDK+   ++ E     F  I  AYE+LSDP+++
Sbjct: 6  YELLGVESIASDLELKKAYRKKALKYHPDKN--PNNVEEATQAFATIRLAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 631

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDK--SVDQDSKELNETKFKEITAAYEILSDPE 68
           Y +LGV + A+ ++++ +Y +L  K HPDK  +++ + ++ NE K  EI  AYEILSD +
Sbjct: 530 YKILGVDKSATPKDVRRSYLQLTKKFHPDKQKNLNDEQRQKNEEKMAEINEAYEILSDDD 589

Query: 69  KKSHYD 74
           K++ YD
Sbjct: 590 KRTKYD 595

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON}
          Anc_7.157 YIR004W
          Length = 425

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y++LGVT  A+  EIK AYRK +++ HPDK+ D     +   +F+ I+ AY++LSD + +
Sbjct: 8  YEILGVTPTATAVEIKKAYRKKSVQEHPDKNRDDP---MATERFQAISEAYQVLSDEDLR 64

Query: 71 SHYDLY 76
            YD +
Sbjct: 65 GKYDRF 70

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPD---KSVDQDSKELNETKFKEITAAYEILSDP 67
           Y++LG++  AS ++IK+AYRKL++K HPD   K +  D K + E  + +IT AYE L+D 
Sbjct: 127 YEILGISTSASDRDIKSAYRKLSVKFHPDKVAKGLTSDEKSVMEETYVQITKAYESLTDE 186

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 187 LVRQNYLKY 195

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
          (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 46/66 (69%), Gaps = 2/66 (3%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y++LGV   A+  E+K AYRK AL+ HPDK+ D + +E  E  F  I +AYE+LSDP+++
Sbjct: 6  YELLGVDITATDIELKKAYRKKALQFHPDKNPD-NVEEATEI-FATIRSAYEVLSDPQER 63

Query: 71 SHYDLY 76
          + YD +
Sbjct: 64 AWYDAH 69

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON}
          similar to uniprot|P39101 Saccharomyces cerevisiae
          YER048c CAJ1
          Length = 373

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 41/64 (64%), Gaps = 3/64 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LGV  EA+  EIK AYR+ A++ HPDK  +  +    + KF+ +  AY++LSD E +
Sbjct: 8  YDILGVKPEATSAEIKKAYRRRAMETHPDKHPNDPNA---QAKFQAVGEAYQVLSDDELR 64

Query: 71 SHYD 74
            YD
Sbjct: 65 KRYD 68

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa]
          {ON} Anc_2.15
          Length = 616

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y++LGV   A+  E+K AYRK AL+ HPDK+ D +  E  E  F  I +AYE+LSDP+++
Sbjct: 6  YELLGVDVTATDLELKKAYRKKALQFHPDKNPD-NVDEATEI-FATIRSAYEVLSDPQER 63

Query: 71 SHYDLY 76
          + YD +
Sbjct: 64 AWYDAH 69

>NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON}
          Anc_1.113
          Length = 190

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 6/80 (7%)

Query: 1  MSGSDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQ------DSKELNETKF 54
          M+ S S+   Y+VL +  +A++QEIK AY++  L  HPDKS  Q       + +L     
Sbjct: 1  MTKSSSRITHYEVLNINSDATLQEIKKAYKQKLLNIHPDKSSTQILPISITTNDLTSVSI 60

Query: 55 KEITAAYEILSDPEKKSHYD 74
           +I  AY+ILS+   +  YD
Sbjct: 61 NQIQQAYKILSNESTREQYD 80

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPD---KSVDQDSKELNETKFKEITAAYEILSDP 67
           Y++LGV+  AS ++IK+AYRKL++K HPD   K +  D K + E  + +IT AYE L+D 
Sbjct: 127 YEILGVSTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAYESLTDE 186

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 187 LVRQNYLKY 195

>Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W
          (REAL)
          Length = 421

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 44/67 (65%), Gaps = 5/67 (7%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNET-KFKEITAAYEILSDPEK 69
          YD+LGV+  AS  EIK AYRK +++ HPDK    +  +L  T +F+ I+ AY++L D E 
Sbjct: 8  YDLLGVSTTASAIEIKKAYRKKSIQEHPDK----NPNDLKATERFQAISEAYQVLGDDEL 63

Query: 70 KSHYDLY 76
          ++ YD +
Sbjct: 64 RAKYDKF 70

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON}
          Anc_2.15 YNL227C
          Length = 551

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (68%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y++LGV   AS  E+K AYRK AL++HPDK+  +  +E  E  F  I  AYE+LSDP+++
Sbjct: 6  YELLGVDSHASDLELKKAYRKKALQYHPDKNPTK-VEEATEI-FATIRTAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVD--QDSKELNETKFKEITAAYEILSDPE 68
          Y++LGV   AS  ++K AYR+ AL++HPDK++   Q + E+    F  I AAYE+LSD +
Sbjct: 6  YELLGVDSGASDTDLKKAYRRKALQYHPDKNIGNVQQATEI----FASIRAAYEVLSDAQ 61

Query: 69 KKSHYDLY 76
          +++ YD +
Sbjct: 62 ERAWYDAH 69

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPD---KSVDQDSKELNETKFKEITAAYEILSDP 67
           Y++LG++  AS ++IK+AYRKL++K HPD   K +  D K + E  + +IT AYE L+D 
Sbjct: 127 YEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAYESLTDE 186

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 187 LVRQNYLKY 195

>Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W
          (REAL)
          Length = 432

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 44/66 (66%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LGV+  A+  EIK AYRK +++ HPDK+ + D K     +F+ I+ AY++L D E +
Sbjct: 8  YDLLGVSTTATAIEIKKAYRKKSIQEHPDKNPN-DPKATE--RFQAISEAYQVLGDDELR 64

Query: 71 SHYDLY 76
          + YD Y
Sbjct: 65 AKYDKY 70

>KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa]
          {ON} Anc_2.350 YMR161W
          Length = 220

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 4/71 (5%)

Query: 4  SDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEI 63
          S  K   Y++L V R A+  EIK AYRKLA+K HPDK+    + E     FK I  A+E+
Sbjct: 17 SKDKHAFYEILKVNRTANDSEIKKAYRKLAIKLHPDKNPHPKAAE----AFKLINRAFEV 72

Query: 64 LSDPEKKSHYD 74
          L + EK+  ++
Sbjct: 73 LGNSEKREIFN 83

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPD---KSVDQDSKELNETKFKEITAAYEILSDP 67
           YD+LG++  AS +EIK+AYRKL++K HPD   K + +  +   E  + +IT AYE L+D 
Sbjct: 121 YDILGISSSASEREIKSAYRKLSVKFHPDKLAKELTEQERTTMEEAYVQITKAYEALTDE 180

Query: 68  EKKSHYDLY 76
             + ++  Y
Sbjct: 181 LTRQNFLKY 189

>Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W
           (JEM1) - ER chaperone [contig 224] FULL
          Length = 607

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 6   SKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDK--SVDQDSKELNETKFKEITAAYEI 63
           SK   Y VLGV ++A+ ++I+ +Y  +  K+HPDK   + +  K  N+ K  EI  AYEI
Sbjct: 502 SKKNYYKVLGVPQQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEI 561

Query: 64  LSDPEKKSHYD 74
           LSD  K+  YD
Sbjct: 562 LSDEGKRKEYD 572

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LG+  EA+  EIK AYR+ A++ HPDK  D       + KF+ +  AY++LSD   +
Sbjct: 8  YDILGIKPEATATEIKKAYRRKAMETHPDKHPDDPDA---QAKFQAVGEAYQVLSDQGLR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SKYDEF 70

>SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa]
          {ON} highly similar to uniprot|P39101 YER048C
          Saccharomyces cerevisiae CAJ1 Nuclear type II J heat
          shock protein of the E. coli dnaJ family
          Length = 393

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 43/67 (64%), Gaps = 5/67 (7%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKS-VDQDSKELNETKFKEITAAYEILSDPEK 69
          YD LG++ +A+  EIK AYRK A+  HPDK   D D+    + KF+ +  AY++LSDP  
Sbjct: 8  YDALGISPDATPTEIKKAYRKKAMLTHPDKHPNDPDA----QAKFQAVGQAYQVLSDPGL 63

Query: 70 KSHYDLY 76
          +S YD +
Sbjct: 64 RSRYDEF 70

>Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W
          (REAL)
          Length = 431

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LGV+  AS  EIK AYRK +++ HPDK+ + D K     +F+ I+ AY++L D E +
Sbjct: 8  YDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPN-DPKATE--RFQAISEAYQVLGDNELR 64

Query: 71 SHYDLY 76
            YD Y
Sbjct: 65 VKYDKY 70

>TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {ON}
           Anc_1.297 YJL073W
          Length = 715

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 42/67 (62%), Gaps = 2/67 (2%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDK--SVDQDSKELNETKFKEITAAYEILSDPE 68
           Y +LGV + + ++EI+ +Y  L  K+HPDK   + ++ +E N  K ++I  AYE LSD  
Sbjct: 606 YKILGVKKNSQLKEIRKSYLSLTKKYHPDKQGQLSEEEQERNHKKMEQINEAYECLSDES 665

Query: 69  KKSHYDL 75
           K+  YDL
Sbjct: 666 KRKEYDL 672

>Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON}
           YFL016C (REAL)
          Length = 507

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 70/146 (47%), Gaps = 17/146 (11%)

Query: 129 IDIDLSFTMKDLYMG-KKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSK 187
           I+I    + KD   G K ++ +      CG C G+G K       TH++ C +C G GS 
Sbjct: 206 IEIVHKVSFKDAVFGAKNVQLKFSALDPCGTCSGTGMKPN-----THKVSCTTCHGSGST 260

Query: 188 ERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKK-EVITVNVPP 246
             + R G  ++++    C  C+G+G   KRP++    C  C   G+Q  + + ITV++P 
Sbjct: 261 VHV-RGGFQMMST----CPTCNGEGTM-KRPQDN---CTSCHGEGVQANRGKSITVDLPH 311

Query: 247 GHHFNDVVTVKGMADEEIDKAVCGDL 272
           G    DVV + G      D AV  DL
Sbjct: 312 GLQDGDVVRIPGQGSYP-DIAVEADL 336

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 4/64 (6%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           YD LG+ + A+  EIK AY KLA K+HPD + + D+    E KF ++  AYEILSD  K+
Sbjct: 63  YDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDA----EKKFHDLQNAYEILSDDTKR 118

Query: 71  SHYD 74
             +D
Sbjct: 119 QQFD 122

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPD---KSVDQDSKELNETKFKEITAAYEILSDP 67
           Y++LG++  AS ++IK+AYRKL++K HPD   K + Q+ +   E K+ +IT AYE L+D 
Sbjct: 123 YELLGISVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEALTDE 182

Query: 68  EKKSHYDLY 76
             K ++  Y
Sbjct: 183 VIKENFLKY 191

>KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON}
           Anc_1.297 YJL073W
          Length = 668

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 37/66 (56%), Gaps = 2/66 (3%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDK--SVDQDSKELNETKFKEITAAYEILSDPE 68
           Y +LGV + +  + I+ AY  L  K+HPDK   + Q  +E N  K  EI  AYEIL D  
Sbjct: 556 YKILGVAKNSDSKNIRKAYLNLTKKYHPDKQGQLSQKEQEQNHEKMSEINEAYEILGDES 615

Query: 69  KKSHYD 74
           KK  YD
Sbjct: 616 KKKEYD 621

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPD---KSVDQDSKELNETKFKEITAAYEILSDP 67
           Y++LG++  AS ++IK+AYRKL+LK HPD   K + +  +E  E ++ +IT AYE L+D 
Sbjct: 123 YELLGISSSASDKDIKSAYRKLSLKFHPDKLPKGLSEADREGLEAQYVQITKAYESLTDE 182

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 183 LIRFNYLTY 191

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 620

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 46/66 (69%), Gaps = 2/66 (3%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+L V  +A+  ++K AYRK AL +HPDK+ + + +E  E  F +I AAYE+LSD +++
Sbjct: 6  YDLLDVKSDATDTDLKRAYRKKALLYHPDKNRN-NIEEATEV-FAQIRAAYEVLSDAQER 63

Query: 71 SHYDLY 76
          + YD +
Sbjct: 64 AWYDAH 69

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR161W
          (HLJ1)
          Length = 235

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 43/68 (63%), Gaps = 4/68 (5%)

Query: 7  KDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSD 66
          K   Y++L V  +AS  +IK AYRK+A+K HPDK+    + E     FK++  A+E+LSD
Sbjct: 22 KHSFYELLQVDEKASDGDIKKAYRKMAIKLHPDKNRHPRAAEA----FKKVNRAFEVLSD 77

Query: 67 PEKKSHYD 74
           +K+  YD
Sbjct: 78 EKKRRVYD 85

>TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON}
          Anc_2.15 YNL227C
          Length = 598

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (68%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y++L V   AS  ++K AYR+ AL++HPDK+++ + KE  +  F  I  AYEILSDP+++
Sbjct: 6  YELLDVEMTASDADLKKAYRRKALQYHPDKNIN-NIKEATDI-FANIRTAYEILSDPQER 63

Query: 71 SHYD 74
            YD
Sbjct: 64 VWYD 67

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 398

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (60%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD LG++  A+  EIK AYR+ A++ HPDK  D       E KF+ +  AY++LSD   +
Sbjct: 8  YDRLGISPTATPTEIKKAYRRKAMETHPDKHPDDPEA---ENKFQAVGEAYQVLSDESLR 64

Query: 71 SHYDLY 76
          + YD Y
Sbjct: 65 ARYDEY 70

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
          YFL016C
          Length = 500

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 39/64 (60%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y VLGV   AS  EIK AY KLA ++HPD + +  +    E KF ++  AYEILSD  K+
Sbjct: 37 YGVLGVKSSASQGEIKKAYYKLAKQYHPDINKEAGA----EKKFHDLQNAYEILSDESKR 92

Query: 71 SHYD 74
            +D
Sbjct: 93 KQFD 96

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 58/165 (35%), Gaps = 51/165 (30%)

Query: 129 IDIDLSFTMKDLYMGK---KLKFEL---------------KRQIICGKCQGSGWKAKKKV 170
           + +  + + KD   GK   KLKF +                 +  C  CQGSG K   + 
Sbjct: 186 VHVSYNMSFKDAVFGKSGVKLKFNVFDPCDTCSGSGIKKGASRHQCPGCQGSGTKIHVRG 245

Query: 171 HVTHEMECESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCES 230
                  C  C G+G+             +   +C  CHG+G +  R K           
Sbjct: 246 GFQMMSTCNECQGEGT-----------TVNSSDLCGACHGEGVHFHRGKE---------- 284

Query: 231 VGLQYKKEVITVNVPPGHHFNDVVTVKGMA---DEEIDKAVCGDL 272
                    ITV++P G    DV+ + G     +  +D ++ G +
Sbjct: 285 ---------ITVDLPHGLQDGDVIRIPGQGSYPEVALDPSLAGSV 320

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 50/81 (61%), Gaps = 6/81 (7%)

Query: 2   SGSDSKDRLYD---VLGVTREASVQEIKTAYRKLALKHHPDK---SVDQDSKELNETKFK 55
           S  DS+  L+D   +LGV+  A+ +EIK+AYRKL++K HPDK    +  +++   E  + 
Sbjct: 112 SIQDSRTVLFDPYEILGVSASAADREIKSAYRKLSVKFHPDKLGHDLAPEARTKMEEMYV 171

Query: 56  EITAAYEILSDPEKKSHYDLY 76
           +IT AYE L+D   K +Y  Y
Sbjct: 172 QITKAYESLTDENVKENYLRY 192

>YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}
          DJP1Cytosolic J-domain-containing protein, required for
          peroxisomal protein import and involved in peroxisome
          assembly, homologous to E. coli DnaJ
          Length = 432

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LGV+  AS  EIK AYRK +++ HPDK+ +  +      +F+ I+ AY++L D + +
Sbjct: 8  YDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTA---TERFQAISEAYQVLGDDDLR 64

Query: 71 SHYDLY 76
          + YD Y
Sbjct: 65 AKYDKY 70

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa]
          {ON} Anc_7.217 YER048C
          Length = 364

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LG+   A+  EIK AYRK A++ HPDK  D       ++KF+ +  AY++LSD + +
Sbjct: 8  YDILGIQPSATSTEIKKAYRKKAMETHPDKHPDDPDA---QSKFQSVGEAYQVLSDDDLR 64

Query: 71 SHYDLY 76
            YD +
Sbjct: 65 KRYDEF 70

>SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 165

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETK--FKEITAAYEILSDPE 68
          Y+VL V   AS+ +IK AYR+  L  HPDK   Q ++    T+   ++I  AY +L+DP 
Sbjct: 6  YEVLAVEAGASLSQIKRAYRERLLDTHPDKKNGQQARSQAHTQASIEQIQQAYRVLADPT 65

Query: 69 KKSHYD 74
          ++  YD
Sbjct: 66 RREQYD 71

>SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 615

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 41/67 (61%), Gaps = 2/67 (2%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKS--VDQDSKELNETKFKEITAAYEILSDPE 68
           Y +L V + A+ ++I+ AY +L  K+HPDK   + ++ +  NE K   I  AYEILSD  
Sbjct: 509 YKILEVPKNANTKDIRKAYLQLTKKYHPDKQQQLSENEQVANEEKMSAINEAYEILSDES 568

Query: 69  KKSHYDL 75
           K+  YDL
Sbjct: 569 KRKEYDL 575

>Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 37/64 (57%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y++L +  +A+ +EIK AYR   L  HPDK     +  +N     +I  AY+ILS+ +K+
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLTKNTNNRVNSVTINKIQDAYKILSNNQKR 69

Query: 71 SHYD 74
            YD
Sbjct: 70 GEYD 73

>KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 607

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 6   SKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDK--SVDQDSKELNETKFKEITAAYEI 63
           SK   Y VL VT +A+ ++I+ +Y  +  K+HPDK   + +  K  N+ +  EI  AYEI
Sbjct: 500 SKKNYYKVLEVTPQATSKDIRKSYLSMTRKYHPDKQGQLSESQKLQNQERMSEINEAYEI 559

Query: 64  LSDPEKKSHYD 74
           LSD  K+  YD
Sbjct: 560 LSDEGKRKEYD 570

>CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254c SEC63
          Length = 668

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKE---LNETKFKEITAAYEILSDP 67
           YD+LG++  AS ++IK+AYR+L+LK HPDK   + S E     E  + +I+ A+E L+DP
Sbjct: 127 YDLLGISPSASDKDIKSAYRRLSLKFHPDKMSKELSAEERTAMEEMYVQISKAHEALTDP 186

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 187 IVRENYLKY 195

>CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097w
          Length = 175

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 6/75 (8%)

Query: 6  SKDRL--YDVLGVTREASVQEIKTAYRKLALKHHPDKS----VDQDSKELNETKFKEITA 59
          SK R+  Y+VLGV  +AS  EIK  YRK+ L  HPDKS    +D   K  +     +I  
Sbjct: 5  SKSRISHYEVLGVPVDASTDEIKLTYRKMLLTLHPDKSKTVPIDSTIKIRSGVSINQIQE 64

Query: 60 AYEILSDPEKKSHYD 74
          AY +LS+ + ++ Y+
Sbjct: 65 AYRVLSNDQLRAAYN 79

>Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073W
           (REAL)
          Length = 649

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 42/76 (55%), Gaps = 2/76 (2%)

Query: 2   SGSDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPD--KSVDQDSKELNETKFKEITA 59
           S  D K   Y +LGV+  A+ +EI+ AY  L  K+HPD  K+   D KE       +I  
Sbjct: 535 SSYDPKKDYYKILGVSPNANSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINE 594

Query: 60  AYEILSDPEKKSHYDL 75
           AYE LSD +K+  YDL
Sbjct: 595 AYETLSDEDKRKEYDL 610

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa]
          {ON} Anc_2.15 YNL227C
          Length = 581

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (68%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y++L V   A   E+K AYR+ AL++HPDK+  ++ +E  E  F  I AAYE+LSDP+++
Sbjct: 6  YELLDVQPFADDNELKKAYRRKALQYHPDKNP-ENVEEATEI-FASIRAAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {ON}
           complement(27738..29663) [1926 nt, 642 aa]
          Length = 641

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNET--KFKEITAAYEILSDPE 68
           Y VLG+++ AS +EI+ AY  L  K+HPDK      KE  +   K  ++  AYEILSD  
Sbjct: 524 YKVLGISKAASSKEIRKAYLDLTKKYHPDKQGQLSEKEQEKIHEKMSQVNEAYEILSDEG 583

Query: 69  KKSHYD 74
           KK  YD
Sbjct: 584 KKRDYD 589

>Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {ON}
           YJL073W (REAL)
          Length = 644

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 2   SGSDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPD--KSVDQDSKELNETKFKEITA 59
           S  D K   Y  LGVT  A+ +EI+ AY  L  K+HPD  K+   D KE       +I  
Sbjct: 531 SSYDPKKDYYKTLGVTPSATSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINE 590

Query: 60  AYEILSDPEKKSHYDL 75
           AYE LSD  K+  YDL
Sbjct: 591 AYEALSDDNKRKEYDL 606

>YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}
           JEM1DnaJ-like chaperone required for nuclear membrane
           fusion during mating, localizes to the ER membrane;
           exhibits genetic interactions with KAR2
          Length = 645

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 2/73 (2%)

Query: 5   DSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPD--KSVDQDSKELNETKFKEITAAYE 62
           D K   Y +LGV+  AS +EI+ AY  L  K+HPD  K+   D +E       +I  AYE
Sbjct: 534 DPKKDYYKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYE 593

Query: 63  ILSDPEKKSHYDL 75
            LSD +K+  YDL
Sbjct: 594 TLSDDDKRKEYDL 606

>AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YJR097W (JJJ3)
          Length = 156

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 5/64 (7%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LG+  +A   E++ AYR+  L+ HPDK        +++     I  AY +LSDP ++
Sbjct: 6  YDILGIAVDAEPLEVRQAYRQRLLEAHPDK-----QGGVDKGAVTRIQQAYRVLSDPTQR 60

Query: 71 SHYD 74
          S YD
Sbjct: 61 SAYD 64

>CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} similar
           to uniprot|P40358 Saccharomyces cerevisiae YJL073w JEM
          Length = 656

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 46/77 (59%), Gaps = 3/77 (3%)

Query: 1   MSGSDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDS---KELNETKFKEI 57
           ++ S +    Y +LG+  EAS +EI+ AY  L  K+HPDK   Q S   ++ N+ K  EI
Sbjct: 533 LTDSQTAKNYYQILGIKPEASDKEIRKAYLSLTKKYHPDKQGKQLSEEEEKKNDEKMSEI 592

Query: 58  TAAYEILSDPEKKSHYD 74
             AYE+L+D EK+  YD
Sbjct: 593 NEAYEVLNDEEKRKEYD 609

>ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa]
          {ON} similar to uniprot|P47138 Saccharomyces cerevisiae
          YJR097W JJJ3 Protein required along with Dph1p Dph2p
          Kti11p and Dph5p for synthesis of diphthamide which is
          a modified histidine residue of translation elongation
          factor 2 (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 162

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y+VL V  +AS+ EIK AYR   L  HPDK+ D++   LN      I  AY +LSD + +
Sbjct: 5  YEVLRVKFDASLIEIKQAYRDRLLNAHPDKNNDENKPALN-VSVNAIQEAYRVLSDEKLR 63

Query: 71 SHYD 74
            YD
Sbjct: 64 REYD 67

>KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.92
           YGL128C
          Length = 370

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 5/70 (7%)

Query: 10  LYDVLGVTR----EASVQEIKTAYRKLALKHHPDKSVD-QDSKELNETKFKEITAAYEIL 64
           LYDVLG+      E +V+E+K  Y+KL L++HPDK+V   +      ++F  + +A++IL
Sbjct: 83  LYDVLGLDSAKLDEITVEEVKRCYKKLVLQYHPDKNVSGAEDASFVASRFHSLRSAFQIL 142

Query: 65  SDPEKKSHYD 74
            D   ++ YD
Sbjct: 143 CDSSLRTQYD 152

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 44/66 (66%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LGV+ +A   EIK AYRK +++ HPDK+ + D K     +F+ I+ AY++LS  E +
Sbjct: 8  YDLLGVSPDAKAIEIKKAYRKKSVQEHPDKNPN-DPKATE--RFQAISEAYQVLSSDELR 64

Query: 71 SHYDLY 76
          + YD +
Sbjct: 65 AKYDKF 70

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDK-SVDQDSKELN--ETKFKEITAAYEILSDP 67
           Y++LG++  AS ++IK+AYRKL++K HPDK S D   KE    E  + +IT AYE L+D 
Sbjct: 131 YELLGISTSASERDIKSAYRKLSVKFHPDKLSKDLSEKERTTMEEMYVQITKAYEALTDE 190

Query: 68  EKKSHYDLY 76
             + ++  Y
Sbjct: 191 AMRENFLKY 199

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 429

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LGV+  A   EIK AYRK +++ HPDK+ +  S      +F+ I+ AY++LS+ E +
Sbjct: 8  YDLLGVSPNARPIEIKKAYRKKSVQEHPDKNPNDPSA---TERFQSISQAYQVLSNEELR 64

Query: 71 SHYDLY 76
          + YD +
Sbjct: 65 TKYDKF 70

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 45/73 (61%), Gaps = 11/73 (15%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNET-------KFKEITAAYEI 63
           Y++LGVT  ++ +EIK+AYRKL++K HPDK     SK+LNE        +F  I  AY+ 
Sbjct: 113 YELLGVTLSSTDKEIKSAYRKLSVKFHPDKL----SKDLNEIERTAMEEQFVMINKAYKA 168

Query: 64  LSDPEKKSHYDLY 76
           L+D   K +Y  Y
Sbjct: 169 LTDEITKENYRKY 181

>KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (67%), Gaps = 5/65 (7%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKS-VDQDSKELNETKFKEITAAYEILSDPEK 69
          YD+LG+T  A+  EIK AYRK +++ HPDK+  D  + E    +F+ I+ AY++LS+ E 
Sbjct: 8  YDLLGITPNATSIEIKKAYRKKSVQEHPDKNPNDPGATE----RFQAISEAYQVLSNDEL 63

Query: 70 KSHYD 74
          ++ YD
Sbjct: 64 RAKYD 68

>ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL073W
           (JEM1)
          Length = 611

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 6   SKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELN--ETKFKEITAAYEI 63
           +K   Y +LG+  +A+ ++I+ AY  L  K+HPDK  +    E    E K   I  AYE+
Sbjct: 506 TKKNYYKILGIGNDANAKDIRRAYLHLTKKYHPDKQGNMSDAERAKVEEKMSSINEAYEV 565

Query: 64  LSDPEKKSHYDL 75
           LSD  K+  YD+
Sbjct: 566 LSDESKRKEYDM 577

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa]
          {ON} Anc_7.157
          Length = 482

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (62%), Gaps = 5/67 (7%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKS-VDQDSKELNETKFKEITAAYEILSDPEK 69
          YD+LG+   A+  EIK AYRK ++K HPDK+  D  + E    +F+ I+ AY++LSD   
Sbjct: 8  YDLLGIEPSATQGEIKKAYRKKSIKEHPDKNPNDPQATE----RFQAISEAYQVLSDESL 63

Query: 70 KSHYDLY 76
          +  YD Y
Sbjct: 64 RLKYDKY 70

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON}
          Anc_7.157 YIR004W
          Length = 434

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 45/67 (67%), Gaps = 5/67 (7%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQ-DSKELNETKFKEITAAYEILSDPEK 69
          YD+LGV   ++  EIK AYRK ++K HPDK+ +  D+ +    KF+ I+ AY++LSD   
Sbjct: 8  YDLLGVEPNSTDIEIKKAYRKKSIKLHPDKNPNNPDATK----KFQAISEAYQVLSDKNL 63

Query: 70 KSHYDLY 76
          +S+YD +
Sbjct: 64 RSNYDKF 70

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 433

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LGV  +A   +IK AYRK ++K HPDK+ D  +      +F+ I+ AY++LS  E +
Sbjct: 8  YDLLGVATDAKQIDIKKAYRKKSVKEHPDKNPDDPTA---TERFQAISEAYQVLSSEELR 64

Query: 71 SHYDLY 76
            YD +
Sbjct: 65 MKYDKF 70

>TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON}
          Anc_7.157 YIR004W
          Length = 411

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 45/67 (67%), Gaps = 5/67 (7%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKS-VDQDSKELNETKFKEITAAYEILSDPEK 69
          Y++LG+   A+  EIK AYRK +++ HPDK+  D  + E    +F+ I+ AY++LSD + 
Sbjct: 8  YELLGIETTATAVEIKKAYRKKSIEEHPDKNPNDPGATE----RFQAISEAYQVLSDSDL 63

Query: 70 KSHYDLY 76
          +++YD +
Sbjct: 64 RANYDKF 70

>CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa]
          {ON} highly similar to uniprot|P40564 Saccharomyces
          cerevisiae YIR004w DJP1
          Length = 425

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LG+   A+  EIK AYRK +++ HPDK+ +  +      +F+ I+ AY++LS  E +
Sbjct: 8  YDLLGIGPTATAVEIKKAYRKKSIQEHPDKNPNDPTA---TERFQAISEAYQVLSSEELR 64

Query: 71 SHYDLY 76
          + YD +
Sbjct: 65 AKYDKF 70

>Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AFR507W
          Length = 492

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 4/66 (6%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           Y+ LGV+R+AS  +IK AY KLA K+HPD + D+ +    E KF ++  AYEILSD  K+
Sbjct: 53  YETLGVSRDASTSQIKKAYYKLAKKYHPDINKDEGA----EKKFHDLQNAYEILSDESKR 108

Query: 71  SHYDLY 76
           S YD +
Sbjct: 109 SQYDQF 114

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 49/146 (33%), Gaps = 48/146 (32%)

Query: 129 IDIDLSFTMKDLYMG-KKLKFELKRQIICGKCQGSGWKAKKK-------------VHVTH 174
           I +  + + KD   G K +K +      CG C GSG K+  K             +HV  
Sbjct: 191 IHVPFNVSFKDAVFGLKGIKLKYSAYDQCGTCAGSGLKSGAKRSSCSICHGTGTQMHVRA 250

Query: 175 EME----CESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCES 230
             +    C  C G+GS  R           +   C  C G+G    R K           
Sbjct: 251 GFQMASTCTQCNGEGSSIR-----------RSDQCSSCRGEGVVFNRQKE---------- 289

Query: 231 VGLQYKKEVITVNVPPGHHFNDVVTV 256
                    I V++P G    DVV V
Sbjct: 290 ---------IDVDLPHGLQDGDVVKV 306

>NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa]
           {ON} Anc_1.297
          Length = 635

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 2/67 (2%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELN--ETKFKEITAAYEILSDPE 68
           Y +L V+++A  ++I+ +Y  L  K HPDK      KE    + K  EI  AYE+LSD  
Sbjct: 529 YKILDVSKDAGAKDIRKSYLNLTKKFHPDKQGQLSEKEQKKIQEKMSEINEAYEVLSDET 588

Query: 69  KKSHYDL 75
           K++ YDL
Sbjct: 589 KRNEYDL 595

>ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YER048C (CAJ1)
          Length = 578

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 39/63 (61%), Gaps = 3/63 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LGVT  A  ++   AYR  A++ HPD +    +      KF+E++ AY++LSDP+ K
Sbjct: 8  YDILGVTPSAFAEQNNKAYRMKAIQTHPDMN---PTHPYAHAKFQEVSKAYKVLSDPDLK 64

Query: 71 SHY 73
          + Y
Sbjct: 65 NRY 67

>KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa]
          {ON} Anc_1.185 YJL162C
          Length = 555

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (60%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y +LG+T  A+  EI+ +Y  LA K HPDKS  + + EL    FK +  A+ IL+D EKK
Sbjct: 15 YSILGLTPNATDIEIRKSYMNLARKLHPDKSKSEATGEL----FKLVVHAHSILTDVEKK 70

Query: 71 SHYD 74
            YD
Sbjct: 71 RAYD 74

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa]
          {ON} similar to gnl|GLV|CAGL0J01936g Candida glabrata
          CAGL0J01936g and some similarites with uniprot|P40564
          YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
          J-domain- containing protein, required for peroxisomal
          protein import
          Length = 418

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 42/64 (65%), Gaps = 3/64 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LGV   A+  EIK AYRK ++  HPDK+ D  +      +F+ I+ AY++LS+ + +
Sbjct: 8  YDLLGVEVTATDVEIKKAYRKKSILEHPDKNRDDPAA---TERFQSISEAYQVLSNKDLR 64

Query: 71 SHYD 74
          ++YD
Sbjct: 65 ANYD 68

>Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 37/64 (57%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y++L +  +A+ +EIK AYR   L  HPDK   + S ++N      I  AY++LS+ + +
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLAKKTSNKVNSVTIDTIQDAYKVLSNIKTR 69

Query: 71 SHYD 74
            YD
Sbjct: 70 GEYD 73

>KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 162

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (60%), Gaps = 3/64 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y++LGV  +++V EIK AY++  L  HPDK+    + E      +EI  AY++L +P  K
Sbjct: 8  YEILGVDTKSTVAEIKKAYKEKLLCTHPDKN---RTVEAQNVSIEEIKEAYQVLVNPSGK 64

Query: 71 SHYD 74
           +YD
Sbjct: 65 ENYD 68

>Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON}
           YJL073W (REAL)
          Length = 642

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (54%), Gaps = 2/73 (2%)

Query: 5   DSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPD--KSVDQDSKELNETKFKEITAAYE 62
           D +   Y VLGV   A+ +EI+ AY  L  K+HPD  K+   D +E       +I  AYE
Sbjct: 531 DPQKDYYKVLGVAPGATSKEIRKAYLNLTKKYHPDKIKANHNDKEETIHETMSQINEAYE 590

Query: 63  ILSDPEKKSHYDL 75
            LSD +K+  YDL
Sbjct: 591 TLSDDDKRKEYDL 603

>NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON}
          Anc_7.157
          Length = 414

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y++LG++  A+  EIK AYRK +++ HPDK+ +  +      +F+ I+ AY++LSD   +
Sbjct: 8  YELLGISPSATAIEIKKAYRKKSIQEHPDKNPNDPT---ATERFQAISEAYQVLSDDTLR 64

Query: 71 SHYDLY 76
            YD Y
Sbjct: 65 LKYDKY 70

>NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92
          Length = 276

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 41/71 (57%), Gaps = 3/71 (4%)

Query: 3  GSDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYE 62
          G D  + L     +TR  S+QEIK  YR LALK+HPDK  + DS  ++  KF EI+ A  
Sbjct: 12 GKDLYEDLEITDALTRRISIQEIKRQYRTLALKYHPDKHPN-DSNLIH--KFHEISIATN 68

Query: 63 ILSDPEKKSHY 73
          IL+D +    Y
Sbjct: 69 ILTDEKLSEEY 79

>Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON}
          (76723..77949) [1227 nt, 409 aa]
          Length = 408

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+L +   A+  EIK AYRK ++K HPDK+ +  +      +F+ I+ AY++LSD   +
Sbjct: 8  YDLLDIDITATAIEIKKAYRKKSIKEHPDKNPNDPTA---TERFQAISEAYQVLSDKNLR 64

Query: 71 SHYDLY 76
          ++YD +
Sbjct: 65 ANYDKF 70

>ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]
           {ON} weakly similar to uniprot|P40358 Saccharomyces
           cerevisiae YJL073W JEM1 DnaJ-like chaperone required for
           nuclear membrane fusion during mating localizes to the
           ER membrane exhibits genetic interactions with KAR2
          Length = 584

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 39/67 (58%), Gaps = 2/67 (2%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKS--VDQDSKELNETKFKEITAAYEILSDPE 68
           Y +L + + A+ +EI+ AY      +HPDK   + ++ ++ N+ K  EI  AYE LSD  
Sbjct: 477 YKILNIPKNANAKEIRKAYLNFTKMYHPDKQGQLSEEQQKKNDEKMSEINEAYETLSDEG 536

Query: 69  KKSHYDL 75
           K+  YD+
Sbjct: 537 KRREYDM 543

>NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON}
          Anc_1.185 YJL162C
          Length = 491

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y +LG+T +A+  EI+ +Y KLA + HPDKS      EL    FK +  A+ IL+D E K
Sbjct: 9  YSILGLTPKATDNEIRKSYMKLARQLHPDKSKSDSCAEL----FKLVVHAHSILTDEETK 64

Query: 71 SHYD 74
            YD
Sbjct: 65 RKYD 68

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPD---KSVDQDSKELNETKFKEITAAYEILSDP 67
           Y +LGV   A+ +E+++AYRKL++K HPD   K + Q+ +   E ++  IT AY+ L+D 
Sbjct: 118 YTLLGVATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKALTDE 177

Query: 68  EKKSHY 73
             K +Y
Sbjct: 178 ITKENY 183

>KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa]
          {ON} Anc_1.185 YJL162C
          Length = 544

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 42/64 (65%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y +LGV  +A+ +EI  +YRKLA+K HPDKS     +EL    FK +  A+ +L++ E++
Sbjct: 11 YSLLGVHFDATNEEISKSYRKLAMKLHPDKSKSDKCEEL----FKLVVHAHSVLTNGEER 66

Query: 71 SHYD 74
          + Y+
Sbjct: 67 AKYN 70

>TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {ON}
           Anc_8.61 YFL016C
          Length = 510

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 44/66 (66%), Gaps = 4/66 (6%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
           Y VLG+ ++A   EIK AY KLA K+HPD + D+ S    + KF +IT AYEILSD +KK
Sbjct: 49  YKVLGLNKDAKASEIKKAYYKLAKKYHPDINKDKGS----DKKFHDITNAYEILSDEKKK 104

Query: 71  SHYDLY 76
             YD +
Sbjct: 105 MQYDQF 110

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 71/162 (43%), Gaps = 27/162 (16%)

Query: 128 DIDIDLSFTMKDLYMG-KKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGS 186
           ++++  + + KD   G + +   +     C  C GSG K       +H  EC SC G G+
Sbjct: 196 NVEVIHTLSFKDAVFGSRNVTLNVSSIEQCKTCTGSGMKPG-----SHRSECSSCHGTGT 250

Query: 187 KERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYK--KEVITVNV 244
              + R G  + ++    C  C G G+       R++ C +C+  G + +  +  + V +
Sbjct: 251 TVHV-RAGFQMAST----CMSCGGTGENIA----REDVCRNCDGEGTEPRPVQRTVQVEL 301

Query: 245 PPGHHFNDVVTVKG--------MADEEID--KAVCGDLIFHL 276
           PPG    DV+ V G        +A E+ D  K   GDL+  +
Sbjct: 302 PPGLVDGDVIRVAGQGGYPNIAIAPEQRDQVKVTRGDLLVRI 343

>TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON}
          Anc_1.113 YJR097W
          Length = 168

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 1  MSGSDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAA 60
          M+G   +   Y+VLGVT ++++ +IK AY++  L  HPDK+  Q  K  N     +I  A
Sbjct: 1  MTGYTLRVSHYEVLGVTTDSTLMDIKRAYKEKLLNVHPDKNKGQAPKS-NTYSVNQIQEA 59

Query: 61 YEILSDPEKKSHYD 74
          Y +L++   ++ YD
Sbjct: 60 YGVLAEQTLRTQYD 73

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPD---KSVDQDSKELNETKFKEITAAYEILSDP 67
           Y +LGV+  A+ ++IK+AYRKL++K HPD   K +  + +   E  + +I+ AYE L+D 
Sbjct: 125 YALLGVSPSATDRDIKSAYRKLSVKFHPDKLSKDLGGEERARIEEMYVQISKAYEALTDE 184

Query: 68  EKKSHYDLY 76
             K++Y  Y
Sbjct: 185 ITKANYLTY 193

>KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON}
          Anc_2.350 YMR161W
          Length = 175

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 4/66 (6%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YDV+GV    S +++K +Y++L  K HPDK+    +KE     F  +  AY+ LS+ +K+
Sbjct: 25 YDVIGVDIGVSQRQLKMSYKELITKLHPDKNSSPGAKE----AFALVHKAYKTLSNKQKR 80

Query: 71 SHYDLY 76
          + YD Y
Sbjct: 81 AMYDKY 86

>KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa]
          {ON} some similarities with uniprot|P46997
          Saccharomyces cerevisiae YJL162C JJJ2 Protein that may
          function as a cochaperone as suggested by the presence
          of a DnaJ-like domain
          Length = 653

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 47/79 (59%), Gaps = 9/79 (11%)

Query: 1  MSGSD-----SKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFK 55
          MSGSD      +  LY VL +   A+  +I+ AY KLA + HPDKS  +++ EL    FK
Sbjct: 1  MSGSDKTYQLDETTLYSVLNLKYGATEVQIRKAYMKLARELHPDKSKSEEAGEL----FK 56

Query: 56 EITAAYEILSDPEKKSHYD 74
          ++  A+ IL+D ++K  YD
Sbjct: 57 KVAHAHFILTDKKEKMKYD 75

>TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa]
          {ON} Anc_1.92 YGL128C
          Length = 312

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 44/73 (60%), Gaps = 6/73 (8%)

Query: 5  DSKDRLYDVLGVTREASV---QEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAY 61
          ++K  LYD+LG     S     EIK  YR LALK+HPDK+ +  +  L E KF +IT A 
Sbjct: 10 ENKVNLYDILGFHNNNSTITSNEIKKRYRSLALKYHPDKTPNDLT--LVE-KFHKITIAL 66

Query: 62 EILSDPEKKSHYD 74
           IL++ + K+ YD
Sbjct: 67 NILTNNQLKTEYD 79

>CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some
          similarities with uniprot|P46997 Saccharomyces
          cerevisiae YJL162c
          Length = 455

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 39/64 (60%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y +LGV   AS  EI+ +Y KLA K HPDK+  + + EL    FK +  A+ IL++ + +
Sbjct: 14 YSILGVPTNASTNEIRKSYMKLAKKLHPDKTKSEHTAEL----FKLVVDAHSILNNDQLR 69

Query: 71 SHYD 74
          + YD
Sbjct: 70 AEYD 73

>Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004W
          (DJP1) - involved in peroxisome biogenesis [contig 135]
          FULL
          Length = 421

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LGV   A   +IK AYRK +++ HPDK+ +  +      +F+ I+ AY++LS  + +
Sbjct: 9  YDLLGVDPSAKAIDIKKAYRKKSVQEHPDKNPNDPTA---TERFQAISQAYQVLSKEDLR 65

Query: 71 SHYDLY 76
          + YD Y
Sbjct: 66 AKYDKY 71

>ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa]
          {ON} similar to uniprot|Q752R6 Ashbya gossypii AFR507W
          AFR507Wp and some similarites with YFL016C
          uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
          Protein involved in folding of mitochondrially
          synthesized proteins in the mitochondrial matrix
          localizes to the mitochondrial inner membrane member of
          the DnaJ family of molecular chaperones
          Length = 462

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 43/64 (67%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD LGV + AS  EIK AY KLA K+HPD + +Q + +    KF ++  AYEILSD +KK
Sbjct: 35 YDTLGVGKSASPSEIKKAYYKLAKKYHPDINKEQGAGD----KFHDLQNAYEILSDADKK 90

Query: 71 SHYD 74
          S YD
Sbjct: 91 SQYD 94

 Score = 33.9 bits (76), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 52/151 (34%), Gaps = 50/151 (33%)

Query: 129 IDIDLSFTMKDLYMGKK-LKFELKRQIICGKCQGSGWKAKKK-------------VHVTH 174
           I++      KD   G K +  + +    C  C GSG K   K             VHV  
Sbjct: 168 IEVSYRMPFKDAVFGAKDVNLKFRALDPCHTCDGSGMKTGAKPQSCPSCHGTGTTVHVRA 227

Query: 175 EME----CESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCES 230
             +    C+ CGG+G+  +                               R++ C  C  
Sbjct: 228 GFQMATTCQQCGGEGTTTK-------------------------------REDLCGSCHG 256

Query: 231 VGLQYKKE-VITVNVPPGHHFNDVVTVKGMA 260
            G+++ K+  + V++P G    DVV V G  
Sbjct: 257 DGVEWTKDKSVRVDLPQGLQDGDVVRVPGQG 287

>ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON}
          similar to uniprot|Q757X4 Ashbya gossypii AEL112C
          AEL112Cp and weakly similar to YJL162C uniprot|P46997
          Saccharomyces cerevisiae YJL162C JJJ2 Protein that may
          function as a cochaperone as suggested by the presence
          of a DnaJ-like domain
          Length = 503

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y  LG++  AS +EI  +Y KLA + HPDKS    + EL    FK I+ A+ +L D EKK
Sbjct: 15 YSTLGLSTNASDKEIHKSYVKLARELHPDKSKSDGAAEL----FKLISHAHSVLMDKEKK 70

Query: 71 SHYD 74
            YD
Sbjct: 71 DAYD 74

>Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON}
          similar to Ashbya gossypii AFR659W
          Length = 270

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 44/77 (57%), Gaps = 11/77 (14%)

Query: 5  DSKDRLYDVLGVT-------REASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEI 57
          DS   LYD L +           S+ +++  YR++ALK+HPDKS   +++E    KF +I
Sbjct: 9  DSDINLYDELQIAILSKEDLNNVSISQLRKQYRQMALKYHPDKSTAPNAQE----KFLKI 64

Query: 58 TAAYEILSDPEKKSHYD 74
            A+++LSD + +  Y+
Sbjct: 65 KLAFDVLSDSDSRKRYN 81

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
          similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LGV+ +A   +IK AYRK +++ HPDK+ + D K     +F+ I+ AY++L   E +
Sbjct: 8  YDLLGVSPDAKQIDIKKAYRKKSVQEHPDKNPN-DPKATE--RFQAISEAYQVLGSDELR 64

Query: 71 SHYDLY 76
          + YD +
Sbjct: 65 AKYDKF 70

>YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON}
          JJJ2Protein of unknown function, contains a J-domain,
          which is a region with homology to the E. coli DnaJ
          protein
          Length = 583

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y +LG+T  A+  E+  +Y KLA   HPDK+    S+EL    FK +  A+ IL+D ++K
Sbjct: 15 YSILGLTSNATSSEVHKSYLKLARLLHPDKTKSDKSEEL----FKAVVHAHSILTDEDQK 70

Query: 71 SHYD 74
            YD
Sbjct: 71 LRYD 74

>NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8.698
           YOR254C
          Length = 680

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 11  YDVLGVTREASVQEIKTAYRKLALKHHPD---KSVDQDSKELNETKFKEITAAYEILSDP 67
           YD+LG++  +S ++IK+AYRKL++K HPD   K +  D + + E K+ +IT AYE L+D 
Sbjct: 124 YDILGISSSSSDKDIKSAYRKLSIKFHPDKLSKDLSADERIVMEEKYVQITKAYEALTDE 183

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 184 TVRENYLKY 192

>Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}
           similar to Ashbya gossypii ADR124C
          Length = 624

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 41/72 (56%), Gaps = 2/72 (2%)

Query: 6   SKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDK--SVDQDSKELNETKFKEITAAYEI 63
           SK   Y  LGV++ A+ ++I+ AY +L  K+HPDK   + Q+ +   + K   I  AYE 
Sbjct: 501 SKKDYYKELGVSKNANNKDIRRAYLQLTKKYHPDKQGQLSQEERLKVDEKMSAINEAYET 560

Query: 64  LSDPEKKSHYDL 75
           L D  K+  YD+
Sbjct: 561 LRDDSKRKEYDM 572

>Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa]
          {ON} YJL162C - Hypothetical ORF [contig 108] FULL
          Length = 578

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 40/64 (62%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y +LG+T +A+  +IK AYRK+A+  HPDK+    + EL    FK ++ A  +L D E++
Sbjct: 14 YSMLGLTSDATEAQIKKAYRKIAMAIHPDKNKSVSAAEL----FKLVSHAQSVLIDKEQR 69

Query: 71 SHYD 74
            Y+
Sbjct: 70 QSYN 73

>Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W
          (REAL)
          Length = 172

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 33/64 (51%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y++L +  +A+ +EIK AYR   L  HPDK        ++     +I  AY ILSD   +
Sbjct: 10 YEILRIPSDATQEEIKRAYRDQLLHTHPDKLTKNTHGTISSVTINKIQDAYRILSDIRSR 69

Query: 71 SHYD 74
            YD
Sbjct: 70 CEYD 73

>KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa]
          {ON} weakly similar to uniprot|P52868 Saccharomyces
          cerevisiae YGL128C
          Length = 282

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 44/73 (60%), Gaps = 12/73 (16%)

Query: 10 LYDVLGVTREA-------SVQEIKTAYRKLALKHHPDKSVD-QDSKELNETKFKEITAAY 61
          LY++LG+  E        S  +I+  +R+ ALKHHPDK+    DS++    KF ++  A 
Sbjct: 13 LYELLGIVVEGPEDLAKLSPLQIRRNFRQQALKHHPDKNRQVSDSRQ----KFHQLDIAA 68

Query: 62 EILSDPEKKSHYD 74
          +ILSDP+ +S YD
Sbjct: 69 KILSDPKLRSAYD 81

>KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON}
          similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 419

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          YD+LGV+ +A   +IK AYRK +++ HPDK+ +  +      +F+ I+ AY++LS  + +
Sbjct: 8  YDLLGVSPDAKSIDIKKAYRKKSVQEHPDKNPNDPTA---TERFQAISQAYQVLSKDDLR 64

Query: 71 SHYDLY 76
          + YD +
Sbjct: 65 AKYDKF 70

>KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON}
          Anc_1.113 YJR097W
          Length = 163

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70
          Y+VL V  + +  E+K +YR L L  HPDKS    SK        +I  AY ILSDP  +
Sbjct: 7  YEVLNVPAQVTPDELKKSYRVLLLSTHPDKSNVTTSK----YSIDQIKEAYRILSDPVSR 62

Query: 71 SHYD 74
            YD
Sbjct: 63 KTYD 66

>SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa]
          {ON} weakly similar to uniprot|P52868 Saccharomyces
          cerevisiae YGL128C
          Length = 281

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 10/72 (13%)

Query: 10 LYDVLGVT-------REASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYE 62
          LY VLG +       R  S  +++  YRKLAL++HPDK+   D+  ++  KF +++ A +
Sbjct: 15 LYSVLGFSPGSLDAVRAVSTLQVRKQYRKLALQYHPDKN-PHDTSLIH--KFHQVSVATK 71

Query: 63 ILSDPEKKSHYD 74
          ILSD   +S YD
Sbjct: 72 ILSDSRLRSLYD 83

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.133    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,450,215
Number of extensions: 2146986
Number of successful extensions: 7512
Number of sequences better than 10.0: 408
Number of HSP's gapped: 7107
Number of HSP's successfully gapped: 500
Length of query: 456
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 343
Effective length of database: 40,524,141
Effective search space: 13899780363
Effective search space used: 13899780363
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)