Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_10.1738.263ON59259231310.0
YLR089C (ALT1)8.263ON59259229340.0
Smik_12.1488.263ON59259228680.0
Skud_12.1578.263ON59259228510.0
TDEL0F039008.263ON55951821320.0
NDAI0B019908.263ON58849921070.0
NCAS0B050208.263ON56849121000.0
ZYRO0C01628g8.263ON53450420510.0
KNAG0G020408.263ON59149120530.0
KLLA0F19162g8.263ON52848620200.0
SAKL0H17006g8.263ON53148920100.0
CAGL0L12254g8.263ON57450719660.0
KAFR0B027308.263ON53948919340.0
Kpol_392.58.263ON51249618760.0
TPHA0J007508.263ON52249818330.0
KNAG0M012108.263ON52148918250.0
NCAS0B038408.263ON49749518180.0
KLTH0G13662g8.263ON51948318070.0
Smik_4.3578.263ON50749317720.0
Skud_4.3728.263ON50748917710.0
YDR111C (ALT2)8.263ON50748917700.0
TBLA0E044408.263ON56249217730.0
Kwal_56.237918.263ON51850717670.0
Suva_2.2718.263ON50749317520.0
KAFR0B055308.263ON51448917510.0
Kpol_543.398.263ON49248917060.0
NDAI0J013608.263ON50149716880.0
KAFR0B05520singletonON51049116750.0
Ecym_43078.263ON53452116720.0
TPHA0A018008.263ON49849116470.0
AGR085W8.263ON52153516370.0
TBLA0F030608.263ON50049615890.0
TBLA0G01630singletonON50049415880.0
Kwal_34.160181.472ON3791601358e-08
TPHA0O014501.321ON4431761251e-06
Kwal_23.48882.252ON3891241232e-06
SAKL0F02156g3.511ON4981241224e-06
KLLA0F10021g3.511ON4971261181e-05
NDAI0B045502.102ON5651681181e-05
KLTH0G19646g1.472ON3791511142e-05
Kpol_1039.222.252ON3861841143e-05
KLTH0G09614g2.252ON3891251125e-05
KNAG0B006603.511ON4961251118e-05
Kpol_278.23.511ON4981251109e-05
NDAI0B037302.252ON3861261091e-04
KLLA0F03509g2.252ON3871701081e-04
NCAS0E006703.511ON4972591082e-04
TPHA0D033703.511ON4971251082e-04
Kwal_47.189823.511ON4961261072e-04
SAKL0E08492g2.252ON3841261062e-04
ZYRO0G20636g1.321ON4533531063e-04
ZYRO0A01672g2.252ON3861241063e-04
Suva_6.1361.321ON4441701063e-04
KNAG0B053201.321ON4331691054e-04
NDAI0G057601.321ON4481681054e-04
NCAS0A092001.321ON4453711037e-04
Kwal_14.25741.321ON443681028e-04
CAGL0G01254g3.511ON5041231028e-04
Ecym_32902.252ON3861241028e-04
TPHA0F012602.252ON3921701029e-04
NDAI0I028303.511ON5001261020.001
KLTH0G02002g3.511ON4961261010.001
TDEL0D019001.321ON4431681010.001
KLLA0F01617g1.321ON4441821010.001
Ecym_7228na 1ON4881981010.001
KAFR0D014203.511ON4921251000.002
Kpol_1032.398.204ON4531891000.002
NCAS0G040501.472ON384152990.002
Kpol_1035.231.321ON444168990.002
Smik_7.693.511ON500127990.002
Skud_10.1561.321ON460137980.003
SAKL0D11528g1.472ON383152970.003
KLLA0A04906gna 1ON480138970.004
Ecym_6319singletonON354191960.004
CAGL0J05126g1.321ON433184960.004
NCAS0B064402.252ON385126960.004
Kwal_47.17462na 1ON492128960.005
ADL249W2.252ON387176950.005
YGL202W (ARO8)3.511ON500127960.005
TDEL0A016008.204ON475208950.006
YJL060W (BNA3)1.321ON444185950.006
ZYRO0C06028g3.511ON496127950.006
Smik_9.532.252ON388125940.008
Suva_9.782.252ON386124930.010
KNAG0E018502.252ON384122930.010
AGR167Wna 1ON512125930.011
TBLA0B080808.204ON444202930.011
TBLA0B009902.102ON54650920.017
KLTH0H10648g1.321ON44372910.021
SAKL0E12188g2.102ON53053910.021
CAGL0I06578g8.204ON436177900.023
Smik_5.3198.204ON443202890.030
KLTH0E07678gna 1ON492128890.033
YIL116W (HIS5)2.252ON385125890.034
TDEL0D057903.511ON49760890.034
Ecym_62921.321ON430326890.035
Smik_10.1801.321ON444136890.037
Kpol_431.132.475ON443432880.039
SAKL0D06886g1.321ON447147880.040
KLTH0B00176g8.204ON448184880.040
Smik_8.2182.102ON513349880.042
Skud_9.552.252ON385124870.047
CAGL0C01243g2.252ON383124870.050
SAKL0H21824gna 1ON499125880.051
ZYRO0G05346g2.102ON50450880.052
TPHA0O015202.102ON50350870.056
Suva_7.613.511ON500127870.060
KNAG0G005501.472ON387152860.081
Kpol_480.11.472ON380153850.088
Kwal_33.145822.102ON525170850.098
Skud_7.693.511ON500122850.10
AFR548C3.511ON497129840.13
SAKL0D14630g7.14ON27065820.15
KLTH0G19624gsingletonON46833830.20
TDEL0C040902.252ON383124820.22
KAFR0J015802.252ON383124820.22
YHR137W (ARO9)2.102ON513436820.22
NCAS0B072202.102ON51050810.29
TBLA0A103205.287ON62160810.35
AEL170C1.321ON458144800.40
KLTH0B06270g2.102ON525147790.55
CAGL0G06028g2.102ON537136790.55
KAFR0B007905.329ON14148740.79
TDEL0F009002.102ON493148761.2
Skud_8.1982.102ON517190761.3
KNAG0H037302.102ON52344751.5
Kwal_26.77682.475ON422117741.9
Kwal_8.5858.204ON44653741.9
KAFR0A017101.321ON43548741.9
Suva_15.3342.102ON560170742.2
KNAG0G016808.204ON45234742.3
KLLA0E00969g8.204ON445149732.4
Suva_5.2818.204ON45033732.7
Suva_15.3835.56ON78552733.1
ZYRO0B11088g8.204ON45032723.3
YER152C8.204ON44357714.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_10.173
         (592 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...  1210   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...  1134   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...  1109   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...  1102   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   825   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   816   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   813   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   794   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   795   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   782   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   778   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   761   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   749   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   727   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   710   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   707   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   704   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   700   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   687   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   686   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   686   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   687   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   685   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   679   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            679   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   661   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   654   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   649   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   648   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   639   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   635   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   616   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              616   0.0  
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    57   8e-08
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    53   1e-06
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    52   2e-06
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    52   4e-06
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    50   1e-05
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    50   1e-05
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    49   2e-05
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    49   3e-05
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    48   5e-05
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    47   8e-05
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    47   9e-05
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    47   1e-04
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    46   1e-04
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     46   2e-04
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    46   2e-04
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    46   2e-04
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    45   2e-04
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    45   3e-04
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    45   3e-04
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    45   3e-04
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    45   4e-04
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    45   4e-04
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    44   7e-04
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    44   8e-04
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    44   8e-04
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    44   8e-04
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    44   9e-04
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    44   0.001
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    44   0.001
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    44   0.001
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    44   0.001
Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar t...    44   0.001
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    43   0.002
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    43   0.002
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    43   0.002
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    43   0.002
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    43   0.002
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    42   0.003
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    42   0.003
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    42   0.004
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    42   0.004
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    42   0.004
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    42   0.004
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    42   0.005
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    41   0.005
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    42   0.005
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    41   0.006
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    41   0.006
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    41   0.006
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    41   0.008
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    40   0.010
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    40   0.010
AGR167W Chr7 (1059790..1061328) [1539 bp, 512 aa] {ON} Non-synte...    40   0.011
TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa] ...    40   0.011
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    40   0.017
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    40   0.021
SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} simi...    40   0.021
CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} simila...    39   0.023
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    39   0.030
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    39   0.033
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    39   0.034
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    39   0.034
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    39   0.035
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    39   0.037
Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,...    39   0.039
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    39   0.040
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    39   0.040
Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W ...    39   0.042
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    38   0.047
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    38   0.050
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    39   0.051
ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {...    39   0.052
TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2....    38   0.056
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    38   0.060
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       38   0.081
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    37   0.088
Kwal_33.14582 s33 complement(728649..730226) [1578 bp, 525 aa] {...    37   0.098
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    37   0.10 
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    37   0.13 
SAKL0D14630g Chr4 (1206755..1207567) [813 bp, 270 aa] {ON} highl...    36   0.15 
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    37   0.20 
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    36   0.22 
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    36   0.22 
YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromat...    36   0.22 
NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON} Anc_2...    36   0.29 
TBLA0A10320 Chr1 (2542498..2544363) [1866 bp, 621 aa] {ON} Anc_5...    36   0.35 
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    35   0.40 
KLTH0B06270g Chr2 (508642..510219) [1578 bp, 525 aa] {ON} simila...    35   0.55 
CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {...    35   0.55 
KAFR0B00790 Chr2 (152018..152443) [426 bp, 141 aa] {ON} Anc_5.32...    33   0.79 
TDEL0F00900 Chr6 complement(153488..154969) [1482 bp, 493 aa] {O...    34   1.2  
Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W ...    34   1.3  
KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.1...    33   1.5  
Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W...    33   1.9  
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    33   1.9  
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    33   1.9  
Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137...    33   2.2  
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    33   2.3  
KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} simila...    33   2.4  
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    33   2.7  
Suva_15.383 Chr15 (671786..674143) [2358 bp, 785 aa] {ON} YHR182...    33   3.1  
ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {...    32   3.3  
YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON} P...    32   4.5  

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score = 1210 bits (3131), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/592 (98%), Positives = 581/592 (98%)

Query: 1   MLSLSAKNHFTVNNSITHIVKSYHIKTLTTSAKKMPHIXXXXXXXXXXXKLKAFRQVRPV 60
           MLSLSAKNHFTVNNSITHIVKSYHIKTLTTSAKKMPHI           KLKAFRQVRPV
Sbjct: 1   MLSLSAKNHFTVNNSITHIVKSYHIKTLTTSAKKMPHITTSFTTTASSTKLKAFRQVRPV 60

Query: 61  LQRHSSSWMAAQGQKRSISGQSSLKDLRHLNRFPHHTLKTANNEFYPAEQLTLDDVNENV 120
           LQRHSSSWMAAQGQKRSISGQSSLKDLRHLNRFPHHTLKTANNEFYPAEQLTLDDVNENV
Sbjct: 61  LQRHSSSWMAAQGQKRSISGQSSLKDLRHLNRFPHHTLKTANNEFYPAEQLTLDDVNENV 120

Query: 121 LKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLL 180
           LKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLL
Sbjct: 121 LKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLL 180

Query: 181 QYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQGVEGIRKSVADFITK 240
           QYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQGVEGIRKSVADFITK
Sbjct: 181 QYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQGVEGIRKSVADFITK 240

Query: 241 RDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLP 300
           RDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLP
Sbjct: 241 RDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLP 300

Query: 301 YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360
           YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK
Sbjct: 301 YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360

Query: 361 YGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQ 420
           YGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQ
Sbjct: 361 YGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQ 420

Query: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQSERNSI 480
           RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQSERNSI
Sbjct: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQSERNSI 480

Query: 481 HEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAIQEAHHLELTPDEFYCKK 540
           HEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAIQEAHHLELTPDEFYCKK
Sbjct: 481 HEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAIQEAHHLELTPDEFYCKK 540

Query: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFHKEFFDQYRD 592
           LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFHKEFFDQYRD
Sbjct: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFHKEFFDQYRD 592

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score = 1134 bits (2934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/592 (90%), Positives = 568/592 (95%)

Query: 1   MLSLSAKNHFTVNNSITHIVKSYHIKTLTTSAKKMPHIXXXXXXXXXXXKLKAFRQVRPV 60
           MLSLSAKNHFTV+NSITH++KSYHI+TLT+SA+KMPHI           KLKAFR+VRPV
Sbjct: 1   MLSLSAKNHFTVSNSITHVIKSYHIRTLTSSAEKMPHITTPFSTSASSTKLKAFRKVRPV 60

Query: 61  LQRHSSSWMAAQGQKRSISGQSSLKDLRHLNRFPHHTLKTANNEFYPAEQLTLDDVNENV 120
           LQRHSSSW+ AQ  +RS+SGQSSL DLRHLNRFPHHTLKT+NNEFYPAEQLTL+DVNENV
Sbjct: 61  LQRHSSSWIVAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENV 120

Query: 121 LKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLL 180
           LKA+YAVRGAIPMRAEELKAQLEKDPQSLPF++IINANIGNPQQLQQKPLTYYRQVLSLL
Sbjct: 121 LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLL 180

Query: 181 QYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQGVEGIRKSVADFITK 240
           QYPELLN NEQ+LV SKLFK+DAIKRAKSL++DIGGSVGAYSSSQGVEGIRKSVA+FITK
Sbjct: 181 QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK 240

Query: 241 RDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLP 300
           RD GE +YPEDIFLTAGASAAV YLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ LP
Sbjct: 241 RDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 300

Query: 301 YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360
           YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK
Sbjct: 301 YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360

Query: 361 YGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQ 420
           YGTVVIADEVYQENIFPGT+F+SMKK+LRHLQR+HPGKFDNVQLASLHSTSKGVSGECGQ
Sbjct: 361 YGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQ 420

Query: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQSERNSI 480
           RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQ+ERNSI
Sbjct: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSI 480

Query: 481 HEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAIQEAHHLELTPDEFYCKK 540
           HEKL TRAMTLYETFNSLEGIECQKPQGAMYLFPKID+PFKA+QEA HLELTPDEFYCKK
Sbjct: 481 HEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKK 540

Query: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFHKEFFDQYRD 592
           LLESTGICTVPGSGFGQEPGTYHLRTTFLAPG+EW+KKWE FHKEFFDQYRD
Sbjct: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYRD 592

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score = 1109 bits (2868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/592 (88%), Positives = 560/592 (94%)

Query: 1   MLSLSAKNHFTVNNSITHIVKSYHIKTLTTSAKKMPHIXXXXXXXXXXXKLKAFRQVRPV 60
           M  LSAK HFTV+NSI+  +KSYHI+TLT+ A+KMPHI            LKAFR++RPV
Sbjct: 1   MSYLSAKTHFTVSNSISQAIKSYHIRTLTSRAEKMPHISTPFTTSASNTNLKAFRKIRPV 60

Query: 61  LQRHSSSWMAAQGQKRSISGQSSLKDLRHLNRFPHHTLKTANNEFYPAEQLTLDDVNENV 120
           LQRHSSSW+AAQ  +RS+SGQSSL DLRHLNRFPHHTLKT+NNEFYPAEQLTLDDVNENV
Sbjct: 61  LQRHSSSWIAAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLDDVNENV 120

Query: 121 LKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLL 180
           LKA+YAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLL
Sbjct: 121 LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLL 180

Query: 181 QYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQGVEGIRKSVADFITK 240
           QYPELLN NEQ+LV SKLFK+DAIKRAKSL+++IGGSVGAYSSSQGVEGIR+SVA+FITK
Sbjct: 181 QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEEIGGSVGAYSSSQGVEGIRRSVAEFITK 240

Query: 241 RDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLP 300
           RD GE +YPEDIFLTAGASAAV YLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ LP
Sbjct: 241 RDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 300

Query: 301 YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360
           YYLDE+SGWSTNPEEIETVVKEAI+NEIK TVLVVINPGNPTGAVLSPESIAQIFEVAAK
Sbjct: 301 YYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360

Query: 361 YGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQ 420
           YGTVVIADEVYQENIFPGT+F+SMKK+LRHLQR+HPGKFDNVQLASLHSTSKGVSGECGQ
Sbjct: 361 YGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQ 420

Query: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQSERNSI 480
           RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP+EGEESFESDQ+ERNSI
Sbjct: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPLEGEESFESDQAERNSI 480

Query: 481 HEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAIQEAHHLELTPDEFYCKK 540
           HEKL TRAMTLY+TFNSLEGIECQKPQGAMYLFPKID+PF+A+QEA HLELTPDEFYCKK
Sbjct: 481 HEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKIDLPFRAVQEARHLELTPDEFYCKK 540

Query: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFHKEFFDQYRD 592
           LLESTGICTVPGSGFGQEPGTYHLRTTFLAPG+EW+KKWE FHKEFFD YRD
Sbjct: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDHYRD 592

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score = 1102 bits (2851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/592 (88%), Positives = 555/592 (93%)

Query: 1   MLSLSAKNHFTVNNSITHIVKSYHIKTLTTSAKKMPHIXXXXXXXXXXXKLKAFRQVRPV 60
           MLSLS KN  T +N IT I+KSYHI+TLTTS KKMP+I           KLKAFR+VRPV
Sbjct: 1   MLSLSVKNRCTASNCITDIIKSYHIRTLTTSVKKMPYINPPFITTASNTKLKAFRKVRPV 60

Query: 61  LQRHSSSWMAAQGQKRSISGQSSLKDLRHLNRFPHHTLKTANNEFYPAEQLTLDDVNENV 120
           LQRHSSSW+A Q   RS+SGQSSL DLRHLNRFPHHTLKT N++FYPAEQLTL+DVNENV
Sbjct: 61  LQRHSSSWVAGQSHSRSLSGQSSLNDLRHLNRFPHHTLKTGNDDFYPAEQLTLEDVNENV 120

Query: 121 LKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLL 180
           LKA+YAVRGAIPMRAEELKAQLEKDPQSLPF+KIINANIGNPQQLQQKPLTYYRQVLSLL
Sbjct: 121 LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLL 180

Query: 181 QYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQGVEGIRKSVADFITK 240
           QYPELLN NEQ+LV SKLFK+DAIKRAKSL++DIGGSVGAYSSSQGVEGIRKSVA+FITK
Sbjct: 181 QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK 240

Query: 241 RDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLP 300
           RD GE +YPEDIFLTAGASAAV YLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ LP
Sbjct: 241 RDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 300

Query: 301 YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360
           YYLDE SGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPES++QIFEVAAK
Sbjct: 301 YYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAK 360

Query: 361 YGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQ 420
           YGTVVIADEVYQENIFPGT+F+SMKK+LR LQR+HPGKFDNVQLASLHSTSKGVSGECGQ
Sbjct: 361 YGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQ 420

Query: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQSERNSI 480
           RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFE DQ+ERNSI
Sbjct: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSI 480

Query: 481 HEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAIQEAHHLELTPDEFYCKK 540
           HEKL TRAMTLY+TFNSLEGIECQKPQGAMYLFPKID+PFKA+QEA HLELTPDEFYCK 
Sbjct: 481 HEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKS 540

Query: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFHKEFFDQYRD 592
           LLESTGICTVPGSGFGQEPGTYHLRTTFLAPG+EW+KKWE FHKEFFDQYRD
Sbjct: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDQYRD 592

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/518 (75%), Positives = 453/518 (87%), Gaps = 6/518 (1%)

Query: 75  KRSISGQSSLKDLRHLNRFPHHTLKTANNEFYPAEQLTLDDVNENVLKARYAVRGAIPMR 134
           KR+ S  S+   L H+    +H  K  + +FYPAE LT+ D+NENVLKA+YAVRG+IPMR
Sbjct: 48  KRARSTSSTAAGLHHI----YH--KKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMR 101

Query: 135 AEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNHNEQELV 194
           AEEL+ QL++DP SLPF+KI+NANIGNPQQL QKPL++YRQVLS+LQYPE+L   E+EL+
Sbjct: 102 AEELQEQLKRDPSSLPFDKIVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELI 161

Query: 195 GSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFL 254
              +FK DAI+RAK +++D+GGSVGAYSSSQGV GIRK+VADFIT+RD GE AYPEDIFL
Sbjct: 162 SKGVFKRDAIERAKRILRDVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFL 221

Query: 255 TAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPE 314
           TAGASAAV+YLLSI CRG ETGVLIPIPQYPLYTATLALNNS  LPYYLDE SGWSTN  
Sbjct: 222 TAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTA 281

Query: 315 EIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQEN 374
           EIE VV E+I++ I+P+VLVVINPGNPTG+VLS E+I +IF+VAAKYG VVIADEVYQEN
Sbjct: 282 EIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQEN 341

Query: 375 IFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEM 434
           IF G+EF+SMKKVLR LQ++HPG +DNVQL SLHSTSKGVSGECGQRGGYMELTGF+HE+
Sbjct: 342 IFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEI 401

Query: 435 RQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYET 494
           RQV+LKLASISLCPVVTGQALVDLMV PP  G+ES+E D+ ER  IHE+L+ RA  L++T
Sbjct: 402 RQVVLKLASISLCPVVTGQALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDT 461

Query: 495 FNSLEGIECQKPQGAMYLFPKIDVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSG 554
           FNSLEGIECQKP+GAMYLFP+I +P+KAIQ A HLE TPDEFYC+KLLE+TGICTVPGSG
Sbjct: 462 FNSLEGIECQKPRGAMYLFPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSG 521

Query: 555 FGQEPGTYHLRTTFLAPGVEWMKKWEIFHKEFFDQYRD 592
           FGQEPGTYHLRTTFLAPG EW+KKWE FHK+F+DQYRD
Sbjct: 522 FGQEPGTYHLRTTFLAPGTEWIKKWEDFHKKFYDQYRD 559

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  816 bits (2107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/499 (76%), Positives = 435/499 (87%), Gaps = 1/499 (0%)

Query: 95  HHTLKTANN-EFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNK 153
           HH+LK A   +F PAEQLTL D+NENVLKA+YAVRG+IPMRAEELK QLE +P +LPF++
Sbjct: 90  HHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQ 149

Query: 154 IINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKD 213
           I+NANIGNPQQL+QKPL++YRQVLS+LQYP++L  NEQ L+ +K++K DAI RAK L+ +
Sbjct: 150 IVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSE 209

Query: 214 IGGSVGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGP 273
           IGGSVGAYS+SQGV GIRK+VA+FIT+RDGGE AYPEDIFLT        YLLSI C+GP
Sbjct: 210 IGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGP 269

Query: 274 ETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVL 333
           +TGVLIPIPQYPLYTATLALNNS  LPYYLDE SGWSTNP+EIE VV++A++  I P+VL
Sbjct: 270 KTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVL 329

Query: 334 VVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQR 393
           VVINPGNPTGAVL+ ESI  IFE+AAKYG VVIADEVYQENI  G +F SMKKVLR LQ+
Sbjct: 330 VVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQK 389

Query: 394 DHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ 453
            HPGKFDNVQLASLHSTSKGVSGECGQRGGYMEL GF+HE+R+VILKLASISLCPVVTGQ
Sbjct: 390 SHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQ 449

Query: 454 ALVDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLF 513
           ALVDLMV PP +G+ S+E DQ+ER  I  +L+ RA  LYETF  LEGIECQKPQGAMYLF
Sbjct: 450 ALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLF 509

Query: 514 PKIDVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGV 573
           PK+D+PFKA+QEA HLE+TPDEFYCK LL++TGICTVPGSGFGQEPGTYHLRTTFLAPG 
Sbjct: 510 PKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGT 569

Query: 574 EWMKKWEIFHKEFFDQYRD 592
           EW+KKWE FHKEF+D YRD
Sbjct: 570 EWIKKWEAFHKEFYDNYRD 588

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  813 bits (2100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/491 (76%), Positives = 439/491 (89%)

Query: 102 NNEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGN 161
           +N F PA+QLTL ++N+NVLKA+YAVRGAIPMRAEELK QL++DP SLPF+ I+NANIGN
Sbjct: 78  HNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGN 137

Query: 162 PQQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAY 221
           PQQL QKPL++YRQVLSLLQYPE+L  +E +LV S LFK DA++RAK+L+ +IGG+VGAY
Sbjct: 138 PQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAY 197

Query: 222 SSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPI 281
           S+SQGV GIRK+VA+FITKRD GE AYPEDIFLTAGASAAV YLLSI C+GPETGVLIPI
Sbjct: 198 SASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPI 257

Query: 282 PQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341
           PQYPLYTA+LALNNS  LPYYLDE SGWSTNP+EIE VV  A   +I+P+VLVVINPGNP
Sbjct: 258 PQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNP 317

Query: 342 TGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDN 401
           TGAVLS +SI  IFE+AAKYG VVIADEVYQEN+F   +F+SMKKVLR+LQ+ HPG +D 
Sbjct: 318 TGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDM 377

Query: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461
           VQLASLHSTSKGVSGECGQRGGYMELTGF+HE+R VILKLASISLCPVVTGQALVDLMV 
Sbjct: 378 VQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVS 437

Query: 462 PPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFK 521
           PP +G+ESFE DQ+ER  I  +L+TRAM LY+ FN+LEGIECQKPQGAMYLFP++D+PFK
Sbjct: 438 PPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFK 497

Query: 522 AIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEI 581
           A+Q+A HLE++PDEFYCK LLE+TGICTVPGSGFGQEPGTYHLRTTFLAPG EW++KW+I
Sbjct: 498 AVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKI 557

Query: 582 FHKEFFDQYRD 592
           FH++F++ YRD
Sbjct: 558 FHQDFYNTYRD 568

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/504 (74%), Positives = 431/504 (85%), Gaps = 1/504 (0%)

Query: 89  HLNRFPHHTLKTANNEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQS 148
           HL+   H  +       YPAE+L L +VNENVLKA+YAVRGAIPM A EL A+L+KDP S
Sbjct: 32  HLHHI-HSKVSNVLGAVYPAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHS 90

Query: 149 LPFNKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAK 208
           LPF+ I++ANIGNPQ L+QKPLT+YRQVLSLLQYP LL  NEQ L+ SKL++ DAI RA+
Sbjct: 91  LPFDNIVSANIGNPQHLKQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARAR 150

Query: 209 SLIKDIGGSVGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSI 268
            L+ DIG SVGAYS+SQG++GIR++VA FIT+RDGGE AY EDIFLTAGAS+AV+YLLSI
Sbjct: 151 RLLNDIGSSVGAYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSI 210

Query: 269 FCRGPETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEI 328
            C+G ETGVLIPIPQYPLYTA+LALNNS PLPYYLDE SGWSTNP EIE VV  AI+  I
Sbjct: 211 LCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNI 270

Query: 329 KPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVL 388
           KP+VLVVINPGNPTGAVLS E I+QIF +AAKYG VVIADEVYQEN+F G EF+SMKK+L
Sbjct: 271 KPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKIL 330

Query: 389 RHLQRDHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCP 448
           R LQ+ +PG FDNVQLASLHSTSKGVSGECGQRGGYME+TGF++++RQVILKLASISLCP
Sbjct: 331 RKLQKSNPGVFDNVQLASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCP 390

Query: 449 VVTGQALVDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQG 508
           VVTGQALVDLMV PP  G+ES+E DQ ER SIHE L  RA  L+ TFNSLEGIECQKP+G
Sbjct: 391 VVTGQALVDLMVSPPKPGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEG 450

Query: 509 AMYLFPKIDVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTF 568
           AMYLFP++ +PFKAIQ A H  +TPD FYCKKLLE+TGICTVPGSGFGQEPGTYHLRTTF
Sbjct: 451 AMYLFPRLLLPFKAIQSAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTF 510

Query: 569 LAPGVEWMKKWEIFHKEFFDQYRD 592
           LAPG EW+++WE FHK F+++YRD
Sbjct: 511 LAPGTEWIERWENFHKAFYEEYRD 534

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/491 (75%), Positives = 437/491 (89%), Gaps = 2/491 (0%)

Query: 104 EFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQ 163
           +F PA Q+ + D+NENVLKA+YAVRG+IPMRAE+L+ QL++DP+SLPF+KIINANIGNPQ
Sbjct: 101 KFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQ 160

Query: 164 QLQQKPLTYYRQVLSLLQYPELLNH-NEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYS 222
           QL QKPL++YRQVLSLLQ+PELLN   E     + L+K DA++RA+ L++DIGGSVGAYS
Sbjct: 161 QLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYS 220

Query: 223 SSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIP 282
           +SQGV GIRK+VADFIT+RD  E AYPEDIFLTAGASAAV+YLLSIFC+G +TGVLIPIP
Sbjct: 221 TSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIP 280

Query: 283 QYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPT 342
           QYPLYTATLALNNS  LPYYLDE SGWSTN +EI++VV +AI   IKP+VLVVINPGNPT
Sbjct: 281 QYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPT 340

Query: 343 GAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP-GTEFNSMKKVLRHLQRDHPGKFDN 401
           GAVLS ++IA+IFE+AAKYG VVIADEVYQENIF    +F+SMKKVLR LQ++HPGKFD 
Sbjct: 341 GAVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDE 400

Query: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461
           VQLASLHSTSKGVSGECGQRGG+MELTGFSHE+RQVILKLASISLCPVVTGQALVDLMV 
Sbjct: 401 VQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVH 460

Query: 462 PPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFK 521
           PP EGEES+E DQ+ER+ IH +L+ RA  L+ETFN LEGI+CQKPQGAMYLFP++++PFK
Sbjct: 461 PPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFK 520

Query: 522 AIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEI 581
           A+Q+A H+E+T DEFYCK+LLE+TGICTVPGSGFGQ PGTYHLRTTFLAPG EW+  WE 
Sbjct: 521 AVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEK 580

Query: 582 FHKEFFDQYRD 592
           FHKEF+++YRD
Sbjct: 581 FHKEFYNKYRD 591

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  782 bits (2020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/486 (75%), Positives = 425/486 (87%), Gaps = 2/486 (0%)

Query: 107 PAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQ 166
           PA +L+LDDVNENVLKA+YAVRG IPMRAEEL+ QL+KDP SLPF+KII+ANIGNPQQL 
Sbjct: 45  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 104

Query: 167 QKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQG 226
           QKPLT+YR+VLSLLQ+PELL   ++ L    L+K D+IKRAK L+ ++GGSVGAYS SQG
Sbjct: 105 QKPLTFYREVLSLLQHPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 162

Query: 227 VEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPL 286
           V+GIR++VADFITKRD GE +YPEDI+LTAGASAAV+Y+LSI C+GP TGVLIPIPQYPL
Sbjct: 163 VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 222

Query: 287 YTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVL 346
           YTA+LALNNS+PLPYYL E   WST+PEEIE VV +AIQ  IKPT LVVINPGNPTGA+L
Sbjct: 223 YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 282

Query: 347 SPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLAS 406
           S +SI +IFEVAAKYG VVIADEVYQEN+F G++F SMKKVLR+LQ+ + G++DN+QLAS
Sbjct: 283 SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 342

Query: 407 LHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEG 466
           LHSTSKGVSGECGQRGGYMEL GF+H++RQV LKLASISLCPVVTGQALVDLMV PP  G
Sbjct: 343 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 402

Query: 467 EESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAIQEA 526
           +ES+E DQ ER  IH+ L+ RA  L+ETF+ LEGIEC+KPQGAMYL+PK+D+P+K IQEA
Sbjct: 403 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 462

Query: 527 HHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFHKEF 586
            HLE+ PDEFYCK LLE+TGICTVPGSGFGQ PGTYHLRTTFL PG EW++ WE FHK F
Sbjct: 463 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 522

Query: 587 FDQYRD 592
           FD+YRD
Sbjct: 523 FDKYRD 528

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/489 (74%), Positives = 425/489 (86%), Gaps = 1/489 (0%)

Query: 104 EFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQ 163
           +F PA++L+L+D+NENVL+A+YAVRG IP +AEELK QL +DP+SLPF++IINANIGNPQ
Sbjct: 44  KFQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQ 103

Query: 164 QLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSS 223
           QL QKPLT+YRQVLSLLQ P++L    +E + S+++K DAI RA  L+ +IGGSVGAYS 
Sbjct: 104 QLDQKPLTFYRQVLSLLQNPDMLEEIPREQL-SQIYKPDAIDRAARLLSNIGGSVGAYSH 162

Query: 224 SQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQ 283
           SQGV G RK+VADFITKRDGGE AY EDIFLTAGASAAV+Y+LSI CRGP+TGVLIPIPQ
Sbjct: 163 SQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQ 222

Query: 284 YPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 343
           YPLYTA+LALNNS  LPYYLDE S WSTNPEEIE VV  +I   ++P  LVVINPGNPTG
Sbjct: 223 YPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTG 282

Query: 344 AVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQ 403
           A+LSPESI +IFEVAAKYG VVIADEVYQEN+F G EF+SM+KVL+ LQR H GKFDN+Q
Sbjct: 283 AILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQ 342

Query: 404 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 463
           LASLHSTSKGVSGECGQRGGYMEL GFSH++RQV LKLASISLCPVVTGQALVDLMV PP
Sbjct: 343 LASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPP 402

Query: 464 VEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAI 523
             G+ S+E DQ ER+ IH+ L+ RA  LYETFN LEGIECQKPQGAMYLFP++D+ +KA+
Sbjct: 403 KPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAV 462

Query: 524 QEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFH 583
           Q+A HL L+PDEFYC++LLE+TGICTVPGSGFGQ PGTYHLRTTFLAPG +W+K WE FH
Sbjct: 463 QKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFH 522

Query: 584 KEFFDQYRD 592
           K+F+++YRD
Sbjct: 523 KKFYNEYRD 531

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/507 (72%), Positives = 428/507 (84%), Gaps = 11/507 (2%)

Query: 90  LNRFPHHTLKTANN-EFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQS 148
           LN   HH   + NN  F PAEQ TL DVNE VL A+YAVRGAIPMRAEELK QL ++P S
Sbjct: 75  LNTEIHH--HSHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHS 132

Query: 149 LPFNKIINANIGNPQQLQQKPLTYYRQVLSLLQYPEL---LNHNEQELVGSKLFKIDAIK 205
           LPFN IINANIGNPQQL+QKPL++YRQVLSLLQYPEL   L +N Q ++     K DAI 
Sbjct: 133 LPFNDIINANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTMI-----KQDAID 187

Query: 206 RAKSLIKDIGGSVGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYL 265
           RAK L+ DIGGSVGAYSSSQGV GIRK+VADFIT RD G  AYPEDIFLTAGAS+AV YL
Sbjct: 188 RAKRLLDDIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYL 247

Query: 266 LSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQ 325
           LSIFCRG ETGVLIPIPQYPLYTATLAL NS  LPYYL+E +GWST+PEE+E+++ ++I+
Sbjct: 248 LSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIE 307

Query: 326 NEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMK 385
           N IKP+VLVVINPGNPTGAVLS E+I QIF +AAKYG +VIADEVYQEN+F   +F+SMK
Sbjct: 308 NNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMK 367

Query: 386 KVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASIS 445
           KVLR LQ   PG +DNVQLASLHSTSKGVSGECGQRGGYMEL GF+H++RQV+LKLASIS
Sbjct: 368 KVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASIS 427

Query: 446 LCPVVTGQALVDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQK 505
           LCPVVTGQALVDLMV PP +GEES+E DQ ER +IH++L+ RA  L++ F  L+GI CQK
Sbjct: 428 LCPVVTGQALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQK 487

Query: 506 PQGAMYLFPKIDVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLR 565
           PQGAMYLFPK+++P+KAIQEA H +++PDEFYCK LLE TGICTVPGSGFGQEPGTYHLR
Sbjct: 488 PQGAMYLFPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLR 547

Query: 566 TTFLAPGVEWMKKWEIFHKEFFDQYRD 592
           TTFLAPG +W++ W  FH+EF++++++
Sbjct: 548 TTFLAPGTKWIEDWVDFHQEFYNKFKN 574

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/489 (74%), Positives = 421/489 (86%)

Query: 102 NNEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGN 161
           N  F PA QLT+ D+NENVLKA+YAVRG IP RAEELK QL + P SLPF+KIINANIGN
Sbjct: 49  NLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGN 108

Query: 162 PQQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAY 221
           PQQLQQ+PL++YRQVLSLLQYP LL+  E +   S ++K DAI RAK ++KDIGGSVGAY
Sbjct: 109 PQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAY 168

Query: 222 SSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPI 281
           S SQGV GIR++VA+FIT+RDGGE AYPEDIFLTAGASAAV YLLSI C+G +TGVLIPI
Sbjct: 169 SESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPI 228

Query: 282 PQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341
           PQYPLYTATLALNNS  LPY+LDE +GWS NP EIE V+K+A+Q+ IKP VLVVINPGNP
Sbjct: 229 PQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288

Query: 342 TGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDN 401
           TGAVLS E+I  I E+AAKYG VVIADEVYQENIF G +F+S+K VLR LQR+ PGKFDN
Sbjct: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348

Query: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461
           VQLASLHSTSKGVSGECGQRGGYME+ GF+HE+RQVILKLASISLCPVVTGQALVDLMV 
Sbjct: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408

Query: 462 PPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFK 521
           PP  GEESF  DQ++R +IH +L+ RA  L++TFNSL+GIECQKP GAMYLFPK+++P++
Sbjct: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468

Query: 522 AIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEI 581
           AIQEA  LEL+PDEFYCK+LLE TGICTVPGSGFGQ  GTYHLRTTFLAPG+EW+  W+ 
Sbjct: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528

Query: 582 FHKEFFDQY 590
           FH EF ++Y
Sbjct: 529 FHIEFMEKY 537

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/496 (68%), Positives = 416/496 (83%), Gaps = 8/496 (1%)

Query: 97  TLKTANNEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIIN 156
           TL    +  YPA++L +DD+N+NVLKA+YAVRG+IP+RAEELK  LE   Q LPF+ +IN
Sbjct: 25  TLYEHKHNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTVIN 83

Query: 157 ANIGNPQQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGG 216
           ANIGNPQQL+QKPLT+YRQVLS+LQYPELL        GS +FK DAI+RA+ L+K+IG 
Sbjct: 84  ANIGNPQQLKQKPLTFYRQVLSILQYPELLES------GSNIFKKDAIERARKLLKEIG- 136

Query: 217 SVGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETG 276
           SVG+YSSSQG+  IRK+VA+FITKRD GE + P DIFLTAGAS+AV YLLSI C+  ++G
Sbjct: 137 SVGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSG 196

Query: 277 VLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVI 336
           VLIPIPQYPLYTATLALNN+  LPYYLDE+ GWST+  EIE V+ +++   IKPT LV+I
Sbjct: 197 VLIPIPQYPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVII 256

Query: 337 NPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHP 396
           NPGNPTG++LS ES+ +I EVAA +G V+IADEVYQEN+F   +F+SMKKVLR+LQ+  P
Sbjct: 257 NPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFP 316

Query: 397 GKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALV 456
           G++D VQLASLHSTSKGVSGECGQRGGYMELTGF+ E++QVILKL SISLCPVVTGQALV
Sbjct: 317 GEYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALV 376

Query: 457 DLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKI 516
           DLMV PP +G+ES+E DQ ER++I   L+ RA+ L+E FNS+EG+ CQKP+GAMYLFPKI
Sbjct: 377 DLMVSPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKI 436

Query: 517 DVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWM 576
           D+PFK +Q++  L++TPDEFYCK LLE+TGICTVPGSGFGQ+PGTYHLRTTFLAPG EW+
Sbjct: 437 DLPFKVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWI 496

Query: 577 KKWEIFHKEFFDQYRD 592
            +W  FH EF+D+YRD
Sbjct: 497 DRWNKFHAEFYDKYRD 512

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/498 (69%), Positives = 417/498 (83%), Gaps = 5/498 (1%)

Query: 97  TLKTANNEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIIN 156
           T+   +  F PA++LT++D+NENVLKA+YAVRG IP RAE LK QL  +P SLPF K+IN
Sbjct: 28  TISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVIN 87

Query: 157 ANIGNPQQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSK--LFKIDAIKRAKSLIKDI 214
           ANIGNPQQL QKPLT+YRQVLSLLQYP +L   ++   G+   L+K DAI+RAK ++ DI
Sbjct: 88  ANIGNPQQLNQKPLTFYRQVLSLLQYPMVL---DETFSGNTKTLYKQDAIERAKRILNDI 144

Query: 215 GGSVGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPE 274
           G SVG+YSSSQGV G+RK+VA++I++RDGGE AY EDIFLTAGAS+AV+YLL+I C+G E
Sbjct: 145 GSSVGSYSSSQGVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKE 204

Query: 275 TGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLV 334
           +GVLIPIPQYPLYTATLALNN+  LPYYL+ENSGWSTN EEIE VV  AI+ +I P VLV
Sbjct: 205 SGVLIPIPQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRVLV 264

Query: 335 VINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRD 394
           VINPGNPTGA+LS ESI +IF+VAA +G VVIADEVYQENIFPG EF+SMKKVLR LQR 
Sbjct: 265 VINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRR 324

Query: 395 HPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQA 454
            PGK++NVQLASLHSTSKGVSGECGQRGGYMELTGFS E++  ILKL SISLCPVVTGQA
Sbjct: 325 VPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQA 384

Query: 455 LVDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFP 514
           LVDLM  PP +GE S+E DQ ER++IH +L  RA  L++ FN +EG+ CQKPQG+MYLFP
Sbjct: 385 LVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFP 444

Query: 515 KIDVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVE 574
           KID+P KA+++A  L++TPDE YC +LLE+TGICTVPGSGFGQ+PGT+HLRTTFLAPG  
Sbjct: 445 KIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTS 504

Query: 575 WMKKWEIFHKEFFDQYRD 592
           W+ +W  FH+ F ++YRD
Sbjct: 505 WIDQWREFHQIFCNKYRD 522

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/489 (68%), Positives = 398/489 (81%), Gaps = 2/489 (0%)

Query: 105 FYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQ 164
           F PA +L  DD+N+N++ A YAVRGAIPM+AEEL+ QL + P  LPFN I  ANIGNPQQ
Sbjct: 34  FEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQ 93

Query: 165 LQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSS 224
           L QKPLT+ RQV+S+LQYP LL++ EQ LV S  +K DA KRA  L++ IGGSVGAYS +
Sbjct: 94  LDQKPLTFSRQVVSILQYPPLLDYEEQ-LVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLA 152

Query: 225 QGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQY 284
           QGV GIR+SVADFIT+RD GETA P+DIFLT GAS A TYLLSI CR   TG++IPIPQY
Sbjct: 153 QGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQY 212

Query: 285 PLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGA 344
           PLYTA++ + NS  LPYYLDE SGWST  EEIE  V ++I+  + P V+VVINPGNPTGA
Sbjct: 213 PLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGA 272

Query: 345 VLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHP-GKFDNVQ 403
           VLS ++IAQI  +AAKYG VV+ADEVYQ NI+ G +F+SMKKVLR LQRDHP G++DNVQ
Sbjct: 273 VLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQ 332

Query: 404 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 463
           LAS+HSTSKGVSGECGQRGGYMEL GFS+E+RQVILKLASIS+C VVTGQALVDLM+ PP
Sbjct: 333 LASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPP 392

Query: 464 VEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAI 523
            EG++S+E D  ER  IH  + TR   LY+TF  LEGIECQ+PQGAMYLFPK+ +  KAI
Sbjct: 393 REGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAI 452

Query: 524 QEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFH 583
           +EA  L L PDEFYC +LL++TGICTVPGSGFGQ+ GTYH+RTTFLAPG +W+K WE FH
Sbjct: 453 EEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFH 512

Query: 584 KEFFDQYRD 592
           K F+D+YRD
Sbjct: 513 KAFYDKYRD 521

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/495 (65%), Positives = 408/495 (82%), Gaps = 1/495 (0%)

Query: 98  LKTANNEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINA 157
           L   NN+F PA +L+L D+NENV+ A++A+RG+I ++AE+L+ QL K+P  LPF++I  A
Sbjct: 4   LSLENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVA 63

Query: 158 NIGNPQQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGS 217
           NIGNPQ+L QKPLT+ RQV+S+LQYPELLN N   L   K+F  D+  RA+ L++DIGGS
Sbjct: 64  NIGNPQELNQKPLTFARQVVSILQYPELLN-NRDVLTKEKIFNSDSFDRAERLLRDIGGS 122

Query: 218 VGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGV 277
           VGAYS+SQGV GIRK+ A++ITKRDGGE +YPEDIFLT GA++A +YLLS+ CRGP+TGV
Sbjct: 123 VGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGV 182

Query: 278 LIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVIN 337
           LIPIPQYPLYTATLALN S  +PYYLDE S WSTN  EIE +V ++I+  IKP+V+VVIN
Sbjct: 183 LIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVIN 242

Query: 338 PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPG 397
           PGNPTGAVLS  +IA+IF++AAKYG VV+ADEVYQENIF G +F+S KKVLR LQ+ +PG
Sbjct: 243 PGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPG 302

Query: 398 KFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVD 457
           KFDN+QLAS+HSTSKGV GECGQRGGYMEL GF+ E+RQ++LKLA +++C VVTGQA+VD
Sbjct: 303 KFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVD 362

Query: 458 LMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKID 517
           LM+ PP +G+ S+E D+ ER  I + +  RA  LY  F+ L+GIECQKPQGAMYL+P + 
Sbjct: 363 LMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLI 422

Query: 518 VPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMK 577
           +  KAI +A  L LTPDEFYC +LL++TGICTVPGSGFGQ+ GTYHLRTTFLAPG+EW+ 
Sbjct: 423 LSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWIN 482

Query: 578 KWEIFHKEFFDQYRD 592
           KWE FHK F+++Y+D
Sbjct: 483 KWEKFHKHFYEKYQD 497

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/483 (69%), Positives = 398/483 (82%), Gaps = 6/483 (1%)

Query: 112 TLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLT 171
           TL DVN+ VL A+YAVRG IP+RAEEL+ +L ++P SLPFNKIINANIGNPQQL QKPLT
Sbjct: 41  TLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLT 100

Query: 172 YYRQVLSLLQYPELLNHNEQELVGS--KLFKIDAIKRAKSLIKDIGGSVGAYSSSQGVEG 229
           +YRQVLSLLQ P L+   E    G   KLFK DA++RAK ++K +GGSVGAYS+SQGV G
Sbjct: 101 FYRQVLSLLQNPALI---ESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAG 157

Query: 230 IRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTA 289
            R+SVA+FI +RDG E A   DIFLTAGAS+AV+ +LS+FC G E G LIPIPQYPLYTA
Sbjct: 158 FRQSVAEFIEERDG-EPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTA 216

Query: 290 TLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPE 349
           TLALN++  LPYYLDE SGWS + E++E VVK+AI+  ++PT LVVINPGNPTGA+LSPE
Sbjct: 217 TLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPE 276

Query: 350 SIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHS 409
           +I +I  VAAKY  VVIADEVYQEN F   +F SMKKVLR LQ+  PGK+DNVQLASLHS
Sbjct: 277 AIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHS 336

Query: 410 TSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEES 469
           TSKGVSGECGQRGGYMEL GFS E++QV LKLASISLCPVVTGQALVDLMVRPP +G+ S
Sbjct: 337 TSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDAS 396

Query: 470 FESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAIQEAHHL 529
           +E D+ ERN+IH  L+ ++  LYETF SLEG+ CQKPQGAMYLFPK+D+  KAI++A  L
Sbjct: 397 YELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESL 456

Query: 530 ELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFHKEFFDQ 589
            + PDE+YCK+LLE+TGICTVPGSGF Q PGTYHLRTTFLAPG EW+  W+ FH++F D+
Sbjct: 457 GMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDE 516

Query: 590 YRD 592
           +RD
Sbjct: 517 HRD 519

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/493 (65%), Positives = 399/493 (80%)

Query: 100 TANNEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANI 159
           T +  F PA ++T  D+N  V KA YAVRGAIP RA+ELK +L++ P  LPF+ IINANI
Sbjct: 15  TKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANI 74

Query: 160 GNPQQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVG 219
           GNPQQL QKPLT+ RQVLS+L+YPE+L     +L    LF+ DA+ RA+ L++DIGGS+G
Sbjct: 75  GNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIG 134

Query: 220 AYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLI 279
           AYS SQGV GIR+SVA+FITKRD GE A PE+I+LT GAS+A T LLS+ C+  +TG+LI
Sbjct: 135 AYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKDVQTGLLI 194

Query: 280 PIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339
           PIPQYPLYTA+ +L N+Q LPYYLDE S WST  +EIE VVK+A++  IKP+VL+VINPG
Sbjct: 195 PIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPG 254

Query: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKF 399
           NPTGAVLS ++IA+I  +AAKYG  +I+DEVYQEN+F G +F+SMKKVLR LQR +PGKF
Sbjct: 255 NPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKF 314

Query: 400 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 459
           DNVQLASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C VVTGQA+VDLM
Sbjct: 315 DNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLM 374

Query: 460 VRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVP 519
           V+PP  G+ES++ D SER  I  ++ TRA  L+ETFN LEGIECQKPQGAMYLFP++ +P
Sbjct: 375 VKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLP 434

Query: 520 FKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKW 579
            KA++E+  L + PDEFYC  LLESTGICTVPGSGFGQ+PGTYH+RTTFLAPG +W++ W
Sbjct: 435 EKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDW 494

Query: 580 EIFHKEFFDQYRD 592
           + FH++FF++YRD
Sbjct: 495 KHFHQDFFNKYRD 507

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/489 (65%), Positives = 395/489 (80%)

Query: 104 EFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQ 163
           +F PA ++T  D+N +V KA YAVRG+IP RA+ELK +L+K+P  LPF+ IINANIGNPQ
Sbjct: 19  DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQ 78

Query: 164 QLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSS 223
           QL QKPLT+ RQVLS+L+YPE+L  + ++L    LF  DA+KRA+ L+KDIGGSVGAYS 
Sbjct: 79  QLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSH 138

Query: 224 SQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQ 283
           SQGV GIR++VADFIT RDGGE A PEDI+LT GAS+A T LLS+ C+   TG+LIPIPQ
Sbjct: 139 SQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIPIPQ 198

Query: 284 YPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 343
           YPLYTA+ +L N+Q LPYYLDE   WST  +EIE VV++A++  I+P+VL+VINPGNPTG
Sbjct: 199 YPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTG 258

Query: 344 AVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQ 403
           AVL+ E+IA+I  +AAKYG  VI+DEVYQEN+F   +F+SMKKVLR LQ  +PGKFDNVQ
Sbjct: 259 AVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQ 318

Query: 404 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 463
           LASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C VVTGQA+VDLMV PP
Sbjct: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPP 378

Query: 464 VEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAI 523
             G+ES+E D+ ER+ I  ++ TRA  LYETFN LEGIECQ PQGAMYLFP++ +P KA 
Sbjct: 379 QPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAF 438

Query: 524 QEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFH 583
           +E+  L + PDEFYC  LLESTGICTVPGSGFGQ+PGTYH+RTTFLAPG +W++ W+ FH
Sbjct: 439 RESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFH 498

Query: 584 KEFFDQYRD 592
           + FF++YRD
Sbjct: 499 QSFFNEYRD 507

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/489 (65%), Positives = 394/489 (80%)

Query: 104 EFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQ 163
           +F PA ++T  D+N  V KA YAVRGAIP RA+ELK +L+K+P+ LPF+ IINANIGNPQ
Sbjct: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQ 78

Query: 164 QLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSS 223
           QL QKPLT+ RQVL++L+YPE+L     EL    LF  DA++RA+ L+ DIGGS+GAYS 
Sbjct: 79  QLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSH 138

Query: 224 SQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQ 283
           SQGV GIR++VADFIT+RDGGE A PEDI+LT GAS+A T LLS+ C+  +TG+LIPIPQ
Sbjct: 139 SQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPIPQ 198

Query: 284 YPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 343
           YPLYTA+ +L N+Q LPYYLDE S WSTN +EIE VV++A++ +I+P+VL+VINPGNPTG
Sbjct: 199 YPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTG 258

Query: 344 AVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQ 403
           AVLS E+IA+I  +AAKYG  +I+DEVYQENIF   +F+SMKKVLR LQ  +PGKFDNVQ
Sbjct: 259 AVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQ 318

Query: 404 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 463
           LASLHS SKG   ECGQRGGYME+ GFS E+R  + KL SIS+C VVTGQA+VDLMV+PP
Sbjct: 319 LASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPP 378

Query: 464 VEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAI 523
             G+ES+E D  ER  I  ++ TRA  LYETF  LEGIECQKPQGAMYLFP++ +P KA+
Sbjct: 379 QPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKAL 438

Query: 524 QEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFH 583
            E+  L + PDEFYC  LLESTGICTVPGSGFGQ PGTYH+RTTFLAPG +W++ W+ FH
Sbjct: 439 CESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFH 498

Query: 584 KEFFDQYRD 592
           ++FF +YR+
Sbjct: 499 QDFFSKYRN 507

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  687 bits (1773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/492 (65%), Positives = 405/492 (82%), Gaps = 2/492 (0%)

Query: 100 TANNEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANI 159
           T+  + Y AE+L  +D+N NV+KA+YAVRGAIP  A++LK QL K P +LPF  +IN+NI
Sbjct: 73  TSREKSYFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNI 132

Query: 160 GNPQQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVG 219
           GNPQQL QKPL++ RQVLS+L+YP LL+H E+ LV S  +  D+I+RAK+L+ DIG S+G
Sbjct: 133 GNPQQLGQKPLSFGRQVLSILEYPALLDH-ERTLVDSMGYAPDSIERAKTLLTDIG-SIG 190

Query: 220 AYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLI 279
           AYS+SQGV GIR++VADFIT RD GE AYP+DIFLTAGAS+AV+ +LSI C+G +TGVLI
Sbjct: 191 AYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLI 250

Query: 280 PIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339
           PIPQYPLYTATL LN++  LPYYLDE++GWST+  EI  V +++++  IKPT LVVINPG
Sbjct: 251 PIPQYPLYTATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPG 310

Query: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKF 399
           NPTG+VL+ E+I  +F+VAAKYG VVIADEVYQ+NIFPG+EF+SMKK+LR LQ++ P K+
Sbjct: 311 NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKY 370

Query: 400 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 459
           DN+QLASLHS SKG+ GECG RGGY E  GF+ E++QVI KL+SISLC  V GQALVDLM
Sbjct: 371 DNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLM 430

Query: 460 VRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVP 519
             PP +GE S+E DQ ER +I      R+  LYE FNSLEG+ CQKPQGAMY+FP I +P
Sbjct: 431 CCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLP 490

Query: 520 FKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKW 579
           F AI+ A +L++TPDEFYC++LL++TGICTVPGSGFGQ+PGTYH+RTTFLAPGVEWMK+W
Sbjct: 491 FNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRW 550

Query: 580 EIFHKEFFDQYR 591
           E FH EFF++YR
Sbjct: 551 EKFHIEFFEKYR 562

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/507 (65%), Positives = 407/507 (80%), Gaps = 6/507 (1%)

Query: 87  LRHLNRFPHHTLKTANNEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDP 146
           LRHL+  P   L+   ++     + TL D+NE VL A+YAVRG IP+RAEELK +L ++P
Sbjct: 17  LRHLSTRP--GLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEP 74

Query: 147 QSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNH-NEQELVGSKLFKIDAIK 205
            SLPF+KIINANIGNPQQL QKPLT+YRQVL+LLQ P+L++  +  EL   K FK DA++
Sbjct: 75  GSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGEL--HKFFKPDAVE 132

Query: 206 RAKSLIKDIGGSVGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYL 265
           RAK ++K +GGSVGAYS+SQGV G R+SVA+FI +RDG E A  +DIFLT GAS AV+Y+
Sbjct: 133 RAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDG-EPASAQDIFLTTGASGAVSYI 191

Query: 266 LSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQ 325
           LS+FC GPE G LIPIPQYPLYTA+LALNNS  LPYYLDE SGWS + E+IE VV+++I+
Sbjct: 192 LSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIK 251

Query: 326 NEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMK 385
             I+PT LVVINPGNPTGA+L+ ++I  + +VAAKY  V+IADEVYQEN F   EF SMK
Sbjct: 252 KGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMK 311

Query: 386 KVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASIS 445
           KVLR LQ+  PGK+DNVQLASLHSTSKGVSGECGQRGGYMEL GFS E++QV LKLASIS
Sbjct: 312 KVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASIS 371

Query: 446 LCPVVTGQALVDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQK 505
           LCPVVTGQAL+DLMVRPP +G+ S+E D+ ER  IH+ L+ R+  LY+ F S+EG+ CQ+
Sbjct: 372 LCPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQE 431

Query: 506 PQGAMYLFPKIDVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLR 565
           PQGAMYLFPK+++  KAI +A    L PDE+YCK+LLE+TGICTVPGSGFGQ PGT+HLR
Sbjct: 432 PQGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLR 491

Query: 566 TTFLAPGVEWMKKWEIFHKEFFDQYRD 592
           TTFLAPG EW+  W+ FH++F + +RD
Sbjct: 492 TTFLAPGTEWIDSWKKFHEKFTEDHRD 518

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/493 (64%), Positives = 393/493 (79%)

Query: 100 TANNEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANI 159
           T + +F PA +LT  D+N +V KA YAVRGAIP RAEELK +L++   SLPFN IINANI
Sbjct: 15  TKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANI 74

Query: 160 GNPQQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVG 219
           GNPQQL QKPLT+ RQVLS+L+YPE+L  +  +L    LF  DA+KRA+ L+ DIGGSVG
Sbjct: 75  GNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVG 134

Query: 220 AYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLI 279
           AYS SQGV GIR++VADFIT+RDGGE A PEDI+LT GAS+A T LLS+ C+  +TG+L+
Sbjct: 135 AYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKDSQTGLLL 194

Query: 280 PIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339
           PIPQYPLYTA+ +L N+Q LPYYLDE + WST  +EIE VV +A++  I+P+VLVVINPG
Sbjct: 195 PIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPG 254

Query: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKF 399
           NPTGAVL+  +IA+I  +AAKYG  +I+DEVYQENIF   +F+SMKK+LR LQ  HPGKF
Sbjct: 255 NPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKF 314

Query: 400 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 459
           DNVQLASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C V TGQA++DLM
Sbjct: 315 DNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLM 374

Query: 460 VRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVP 519
           V+PP  G+ES++ D+ ER  I+ ++ TRA  LYETFN LEGI+CQKPQGAMYLFPK+ +P
Sbjct: 375 VKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLP 434

Query: 520 FKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKW 579
            KA++E+  L + PD  YC  LLESTGICTVPGSGFGQ+ GTYH+RTTFL PG +W++ W
Sbjct: 435 EKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDW 494

Query: 580 EIFHKEFFDQYRD 592
             FH++FF++YRD
Sbjct: 495 RQFHQDFFNKYRD 507

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/489 (66%), Positives = 394/489 (80%), Gaps = 4/489 (0%)

Query: 105 FYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQL--EKDPQSLPFNKIINANIGNP 162
           F PA+++TLDD+N+NVLK+ YAVRG+IP RAEEL+ +L       SL F  I++ANIGNP
Sbjct: 28  FKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGNP 87

Query: 163 QQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYS 222
           QQL QKPLT+ RQV+S+LQYPELLN     LV + +FK DA++RA++L+  IGGSVGAYS
Sbjct: 88  QQLDQKPLTFSRQVISILQYPELLNQ-RNILVSTGIFKSDAMERAETLLCHIGGSVGAYS 146

Query: 223 SSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIP 282
           SSQGV GIR++VA++IT RD GETA P+DIFLT GAS A +YLLS+ C+   TGVLIPIP
Sbjct: 147 SSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPIP 206

Query: 283 QYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPT 342
           QYPLYTAT+ L +++ LPYYL+E SGWSTN  EIE VV +AI + +KP+V+VVINPGNPT
Sbjct: 207 QYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPT 266

Query: 343 GAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNV 402
           G+VLS + I  I  + AKYG V+IADEVYQENIF G EF+SMKKVLR LQ+ +PGK+D V
Sbjct: 267 GSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDAV 325

Query: 403 QLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRP 462
           QLASLHSTSKGVSGECGQRGGYMEL GF  E+RQ ILKLASISLC V+TGQALVDLMV P
Sbjct: 326 QLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNP 385

Query: 463 PVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKA 522
           P +G+ES+E D  ER +IHE L  RA  LY  F  L+G+ECQKPQGAMYLFPK+  P   
Sbjct: 386 PKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTL 445

Query: 523 IQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIF 582
           I EA +  ++PDEFYC  LLE+TGICTVPGSGFGQ+ GTYHLRTTFLAPG +W +KW++F
Sbjct: 446 ITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLF 505

Query: 583 HKEFFDQYR 591
           H+EFF +Y+
Sbjct: 506 HEEFFSKYQ 514

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/489 (63%), Positives = 393/489 (80%), Gaps = 3/489 (0%)

Query: 105 FYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQ 164
           F PAE+L+++D+N++ + A YAVRG+IPMRAE+L AQ+  DP SLPF+KII ANIGNPQQ
Sbjct: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62

Query: 165 LQQKPLTYYRQVLSLLQYPELLNHNE--QELVGSKLFKIDAIKRAKSLIKDIGGSVGAYS 222
           + QKPLT+ RQVLS+L+YP +LN  E  ++LV   +++ D I+RA+ ++  IGGSVGAYS
Sbjct: 63  VGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYS 122

Query: 223 SSQGVEGIRKSVADFITKRDGG-ETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPI 281
           +SQGV G R++VADFI KRDG  + A P DIFLT GAS+AV YLLSI C GPE GVLIPI
Sbjct: 123 ASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPI 182

Query: 282 PQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341
           PQYPLYTATL L+NS  +PYYL E++ WSTN +EIE  +KE++ N +KP  +V+INPGNP
Sbjct: 183 PQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNP 242

Query: 342 TGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDN 401
           TGA+LS   +A I  ++AKYG  +IADEVYQENIFPG EF+SM+KVL +LQ + PG +DN
Sbjct: 243 TGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDN 302

Query: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461
           VQLASLHSTSKG  GECGQRGGYMEL GF  E+  ++LKLASIS+C VVTGQAL+DL+  
Sbjct: 303 VQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTC 362

Query: 462 PPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFK 521
           PP  G+ S++ DQ ERN I + L  RA  LY  F SLEG+ECQ+PQGAMYLFPK+ +P K
Sbjct: 363 PPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDK 422

Query: 522 AIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEI 581
           AI++A  LE+ PDE+YC++LL++TGICTVPGSGFGQ+PGTYHLRTTFL PG EW+++W  
Sbjct: 423 AIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWRE 482

Query: 582 FHKEFFDQY 590
           FH++F++++
Sbjct: 483 FHQQFYERF 491

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/497 (61%), Positives = 394/497 (79%), Gaps = 2/497 (0%)

Query: 96  HTLKTANNEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKII 155
           HT++T  ++F PA +L++ D+N NV+KA +AVRG IPM+A+EL+ QL K+P SLPFN+I 
Sbjct: 4   HTIQTDLHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEIT 63

Query: 156 NANIGNPQQLQQKPLTYYRQVLSLLQYPELLNH-NEQELVGSKLFKIDAIKRAKSLIKDI 214
            ANIGNPQ+L QKPLT+ RQV+S+LQYPELLN  NE       ++  D+  RA+ L+ +I
Sbjct: 64  VANIGNPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEI 123

Query: 215 GGSVGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPE 274
           GGSVGAYS+SQGV GIRK++A++IT+RD GE+A P DIF+T GA+AA +YLLSI   GP+
Sbjct: 124 GGSVGAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQ 183

Query: 275 TGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIE-TVVKEAIQNEIKPTVL 333
           TGVL+PIPQYPLYTA LAL+N+  LPYYL+E SGWS +  EIE T+ K A+   I+P V+
Sbjct: 184 TGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVM 243

Query: 334 VVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQR 393
           V+INPGNPTG++LS +S+ +IF +AAKYG V+IADEVYQEN+F G +F+S KKVLR LQ+
Sbjct: 244 VIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQK 303

Query: 394 DHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ 453
             P +++NVQLASLHSTSKG+ GECGQRGGYME+ GF++++R +ILKLA I +CPVVTGQ
Sbjct: 304 QFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQ 363

Query: 454 ALVDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLF 513
           A++DLM+ PP +G++S++ D  ER  IH  +  RA  LY+ F+ +EGI+CQKPQGAMYLF
Sbjct: 364 AMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLF 423

Query: 514 PKIDVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGV 573
           P++ +  K I EA   E+ PDEFYC +LL  TGICTVPGSGFGQ+P TYHLRTTFLAPG 
Sbjct: 424 PRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGD 483

Query: 574 EWMKKWEIFHKEFFDQY 590
           +W+ KWE FHK F  +Y
Sbjct: 484 QWINKWEKFHKAFLKRY 500

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/491 (63%), Positives = 389/491 (79%), Gaps = 4/491 (0%)

Query: 103 NEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQL--EKDPQSLPFNKIINANIG 160
           ++F PA ++++ D+N+ ++ A YAVRG+I MRAEEL+ +L  +  P S PF +II ANIG
Sbjct: 22  HDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIG 81

Query: 161 NPQQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGA 220
           NPQQL QKPLT+ RQV+S+L+YP LL   +  L+   ++K DA++RA+ L   IG SVGA
Sbjct: 82  NPQQLDQKPLTFSRQVMSILEYPGLLKFKDV-LLSQGIYKKDALERAELLQSQIGASVGA 140

Query: 221 YSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIP 280
           YS +QGV GIR++ A FI+KRD  E A  +DIFLT GAS AVTYL+   C+   TG+LIP
Sbjct: 141 YSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIP 200

Query: 281 IPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGN 340
           IPQYPLYTA++ ++N++ LPYYLDE SGWST  EEIE  V  AI+N IKP+ +VVINPGN
Sbjct: 201 IPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGN 260

Query: 341 PTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFD 400
           PTGAVLS + I +I  VAAKYG V+IADEVYQ+NIF G EF+SMKK+LR LQ+ +PGK+D
Sbjct: 261 PTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYD 319

Query: 401 NVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMV 460
           NVQLASLHSTSKGVSGECGQRGGYME+ GFS E+R ++LKLASI++C VVTGQALVDLMV
Sbjct: 320 NVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMV 379

Query: 461 RPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPF 520
            PP  G+ES+E DQ ERN IH  L  RA  LY+TF++LEGIECQKPQGAMYLFP++ +P 
Sbjct: 380 DPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPD 439

Query: 521 KAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWE 580
           +AI+EA  L++  DEFYC KLLE+TGICTVPGSGFGQ  GTYH+RTTFL+PG EW+  W+
Sbjct: 440 RAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWK 499

Query: 581 IFHKEFFDQYR 591
            FH++F  +Y+
Sbjct: 500 KFHEKFMKEYQ 510

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/521 (59%), Positives = 394/521 (75%), Gaps = 12/521 (2%)

Query: 79  SGQSSLKDLRHLNRFPHHTLK-------TANNEFYPAEQLTLDDVNENVLKARYAVRGAI 131
           SG  +  D+ H    PH T+        T+   F P + L L+D+N NVL+A+YAVRG I
Sbjct: 19  SGLQATMDVLH--GLPHATMGLRSISSGTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKI 76

Query: 132 PMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNHNEQ 191
           P RA EL+ QL +DP SLPF KII ANIGNPQQL QKPL++ R+VLSLL+ P LL    +
Sbjct: 77  PARAMELERQLSRDPDSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPME 136

Query: 192 ELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQGVEGIRKSVADFITKRDGGETAYPED 251
            L  + ++K DA++RAK +++D+  S+GAYS SQGV G RK+VA++++ RDG E A  ED
Sbjct: 137 VL--NLIYKPDAVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDG-EPASAED 193

Query: 252 IFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWST 311
           IFLT GAS   + ++ + C+G E+GVLIPIPQYPLYTAT+ LNN+  LPYYLDE SGWS 
Sbjct: 194 IFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSL 253

Query: 312 NPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371
           N +++E ++ E+I+  +KP  LVVINPGNPTGA+L  ES+ +IF +AAKY  VVIADEVY
Sbjct: 254 NIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVY 313

Query: 372 QENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFS 431
           QEN+F G +F SMKKVLR LQR +   F NVQL SLHSTSKG+SGECGQRGGYMEL GFS
Sbjct: 314 QENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFS 373

Query: 432 HEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTL 491
            ++R+VILK+ASI LC  V GQALVDLM+  P  G+ES+E D SER+SI   L  R+ +L
Sbjct: 374 DDIREVILKMASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSL 433

Query: 492 YETFNSLEGIECQKPQGAMYLFPKIDVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVP 551
           +ETFN+LEG+EC+KPQG+MYLFP++ +P KAI+ A  L++ PDEFYC +LL STGICTVP
Sbjct: 434 WETFNNLEGVECRKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVP 493

Query: 552 GSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFHKEFFDQYRD 592
           GSGFGQ P T HLRTTFL PG EW++ WE+FHK F+D+YRD
Sbjct: 494 GSGFGQAPDTCHLRTTFLCPGTEWIESWELFHKSFYDKYRD 534

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/491 (60%), Positives = 380/491 (77%), Gaps = 2/491 (0%)

Query: 103 NEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNP 162
            +F P  ++TL D+N  ++K +YAVRG IP RAEELK QLEKDP+SLPFNKIINANIGNP
Sbjct: 7   TDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNP 66

Query: 163 QQLQQKPLTYYRQVLSLLQYPELLNHNE--QELVGSKLFKIDAIKRAKSLIKDIGGSVGA 220
           QQL QKPL++ R+VLS+LQYP++L      Q L+  ++++ D ++RA+ L+ +IGGSVGA
Sbjct: 67  QQLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGA 126

Query: 221 YSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIP 280
           YS SQGV GI+++VAD+ITKRD GE AYPEDIFLT GAS+AV+++L +FC GP TGVLIP
Sbjct: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIP 186

Query: 281 IPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGN 340
           IPQYPLYTAT+ L  +  + YYL+E   WS N  E+E  ++E+I++ IKPT +V+INPGN
Sbjct: 187 IPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGN 246

Query: 341 PTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFD 400
           PTG++L+ + IA I  ++AKYG ++IADEVYQEN+F G EF+S+KKVLR LQR + G ++
Sbjct: 247 PTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYE 306

Query: 401 NVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMV 460
            VQLASLHSTSKG+ GECGQRGGYMEL G + ++R  ++KL SIS+C VVTGQAL+D++V
Sbjct: 307 TVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVV 366

Query: 461 RPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPF 520
            PP  G+ES+E DQ ERN+I   L +R+  L++ F SLEG+EC +PQGAMYLFPK   P 
Sbjct: 367 SPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQ 426

Query: 521 KAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWE 580
           K I  A  L    D  YCK+LLE TGICTVPGSGFGQ+P TYHLRTTFL PG  W+  W 
Sbjct: 427 KFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWR 486

Query: 581 IFHKEFFDQYR 591
            FH EF ++YR
Sbjct: 487 KFHTEFCERYR 497

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/535 (59%), Positives = 404/535 (75%), Gaps = 20/535 (3%)

Query: 60  VLQRHSSSWMAAQGQKRSISGQ--SSLKDLRHLNRFPHHTLKTANNEFYPAEQLTLDDVN 117
           +L+R+SS    +  Q R +  +  SS+KD                + F PAE +TL DVN
Sbjct: 5   MLRRNSSGTAVSVLQGRVLRTRRLSSVKD---------------GSRFVPAEPMTLADVN 49

Query: 118 ENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVL 177
           ENV+KA+YAVRG IP RAEEL+ +LE+ P SLPF+KII ANIGNPQQL QKPLT+YRQV+
Sbjct: 50  ENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQANIGNPQQLGQKPLTFYRQVI 109

Query: 178 SLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQGVEGIRKSVADF 237
           SL+Q P+LL    + L   + FK D + RA+ +++D GGSVGAYS+SQGV+G R++VA F
Sbjct: 110 SLMQNPQLLEMPAEWL--QQAFKADVVVRARRMLQDAGGSVGAYSASQGVKGYRRTVAQF 167

Query: 238 ITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ 297
           I +RDG   A P++++LTAGAS+AV+ LLS FC+GPETGVLIPIPQYPLYTAT+  NN+ 
Sbjct: 168 IERRDG-IPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAV 226

Query: 298 PLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEV 357
            LPYYL+E  GWSTNP+E+E V+ ++ +  I P  LVVINPGNPTG+VLS + +  I  +
Sbjct: 227 ALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTL 286

Query: 358 AAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSGE 417
           AAKYG VVIADEVYQ+N+F   +F+SM+KVL++LQ   P  + NVQLASLHS SKG+SGE
Sbjct: 287 AAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGE 346

Query: 418 CGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQSER 477
           CGQRGGYMEL GF  E+R+V +KLASISLCPVVTGQALVDLMV PP +G+ S+E    E 
Sbjct: 347 CGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPSQGDPSYEQYTQET 406

Query: 478 NSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAIQEAHHLELTPDEFY 537
            SI+ +L  R+  L++TF SLEGIEC  PQGA+YLFPK+ +P KAI+ A  L +  DE Y
Sbjct: 407 RSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAAQKLGIPADELY 466

Query: 538 CKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFHKEFFDQYRD 592
           C +LL+ TGICTVPG+GFGQ PGTYH+RTTFL PG +W++ W+ FHK+F+D+YRD
Sbjct: 467 CSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKFYDKYRD 521

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/496 (60%), Positives = 383/496 (77%), Gaps = 12/496 (2%)

Query: 105 FYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQ 164
           F PA + +L+D+NE++LKA YA+RG IP RAEEL  QL ++ +SLPF KI+ ANIGNPQQ
Sbjct: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67

Query: 165 LQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSS 224
           L Q+PLT+ RQV+SL+Q+P+LL   +  L+  K++  D+I+RA  L+  IGGSVGAYSSS
Sbjct: 68  LDQQPLTFQRQVMSLVQFPDLLKSKDI-LLAQKIYSKDSIERATKLLNSIGGSVGAYSSS 126

Query: 225 QGVEGIRKSVADFITKRDG---------GETAYPEDIFLTAGASAAVTYLLSIFCRGPET 275
           QGV  IRK+VA FI KRD           ETA   ++FLTAGAS AV ++L +F +    
Sbjct: 127 QGVLDIRKNVARFILKRDLHHDPTQDLIDETA--SNVFLTAGASTAVDHILPLFAKDESC 184

Query: 276 GVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVV 335
           GVL+PIPQYPLYTA + L  S+ LPYYL+E++ WST+P++IE +V +AI+  IKPT LVV
Sbjct: 185 GVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVV 244

Query: 336 INPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDH 395
           INPGNPTGA+L+ +SI  I ++AA+YG V+IADEVYQEN++   EF+S KKVL  L++++
Sbjct: 245 INPGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNY 304

Query: 396 PGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQAL 455
           P K+DNVQLASLHS SKGV+GECGQRGGYME+TGFS+++++V+LK+ASIS+C VVTGQ L
Sbjct: 305 PSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQIL 364

Query: 456 VDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPK 515
           VDLMV PP  G+ES+E DQ ER+ IH  L  ++ TLY+ F  L GI CQKPQGAMYLFP+
Sbjct: 365 VDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPR 424

Query: 516 IDVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEW 575
           + +   AI  A  L L PDEFYC KLLE+TGICTVPGSGFGQ PGTYHLRTTFL PG+EW
Sbjct: 425 LHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEW 484

Query: 576 MKKWEIFHKEFFDQYR 591
           +  WE FH EF ++Y+
Sbjct: 485 INSWEKFHLEFMEKYK 500

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/494 (59%), Positives = 375/494 (75%), Gaps = 10/494 (2%)

Query: 107 PAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQ 166
           PA + +L+D+++++L   YA+RG IP RA+EL+ QL   P  LPF KII ANIGNPQQL+
Sbjct: 8   PAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQQLE 67

Query: 167 QKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQG 226
           Q+PLT+ RQVLSL++YP L+N ++  LV +K++  DAIKRA++++  IGGSVGAYSSSQG
Sbjct: 68  QEPLTFQRQVLSLVEYPNLVN-SKNILVENKIYAPDAIKRAETILNSIGGSVGAYSSSQG 126

Query: 227 VEGIRKSVADFITKRDGGETAYPE---------DIFLTAGASAAVTYLLSIFCRGPETGV 277
           +  IRK+VA  I +RD  E    +         +IFLT GA+ AV+Y+L +F +    GV
Sbjct: 127 ILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDENCGV 186

Query: 278 LIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVIN 337
           L+PIPQYPLYTA + L NS+ LPYYL+E+  WST+PEEIET++K+AI   IKPT LV+IN
Sbjct: 187 LLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLVIIN 246

Query: 338 PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPG 397
           PGNPTGA+LS ESI QI  +AAKYG V+IADEVYQ NI+   +F+S KK+L  L+  +P 
Sbjct: 247 PGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQYPK 306

Query: 398 KFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVD 457
           K+DNVQLASLHS SKGV+GECGQRGGY EL GFS E++++ILKLASI +C VVTGQ LVD
Sbjct: 307 KYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQILVD 366

Query: 458 LMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKID 517
           LM +PP +G+ S++ DQ ERN+I   L  ++ TLY+ F+ L GI CQKPQGAMYLFP++ 
Sbjct: 367 LMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFPRLH 426

Query: 518 VPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMK 577
           +    I EA    L PDEFYC KLLE+TGICTVPGSGFGQ+ GTYH+RTTFL  G+EW+K
Sbjct: 427 LTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIEWIK 486

Query: 578 KWEIFHKEFFDQYR 591
            WE FH EF +QY+
Sbjct: 487 LWEKFHLEFMNQYK 500

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 76/160 (47%), Gaps = 27/160 (16%)

Query: 221 YSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAA---VTYLLS-----IFCRG 272
           Y + QG   +RK +A+  +  D   T   E++ LT GA AA     Y L+       C  
Sbjct: 55  YGAIQGSHALRKLIAEMYSNED--VTLSEENVILTNGAIAANFLTHYTLAGKGDHFICIS 112

Query: 273 PETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTV 332
           P    L  IPQ  ++ A + L        +L + + +  N  E+E ++K         T 
Sbjct: 113 PTYQQLSSIPQ--MFGAEVEL-------LHLRKETNYQPNIVELERMIK-------PNTK 156

Query: 333 LVVIN-PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371
            +V+N P NP  +V+  E++ +I E+A K+G VV  DEVY
Sbjct: 157 CIVLNTPNNPLSSVIPTETLREIAELADKHGIVVFCDEVY 196

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 82/176 (46%), Gaps = 17/176 (9%)

Query: 218 VGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAV-TYLLSIFCRGPETG 276
           V  YS ++G   + KS+ D  +      T  PE++ +T GA+  +   L+ I  +  E  
Sbjct: 84  VNQYSPTRGRPTLIKSLTDLYSPL-YKLTLKPENVLVTTGANEGILACLMGILNQNDEVI 142

Query: 277 VLIP-----IPQYPLYTATLA---LNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEI 328
           V  P     IP   L    +    +N  + L   + + + W+ + E+ E V+        
Sbjct: 143 VFEPFFDQYIPNIELCGGKVVYVPINPPKDLDKRVTKGTEWTLDFEQFENVITN------ 196

Query: 329 KPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSM 384
           K   +++  P NP G V + E + +I ++  K+  ++I+DEVY +N++   EF  +
Sbjct: 197 KTKAIIINTPHNPIGKVFTREELKRIGDICVKHNVIIISDEVY-DNLYFVDEFTRI 251

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 64/124 (51%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ--PLPYYLDENS 307
           E++ L  G+   +  L+   C   +  +LI  P Y +Y+    +N+ +   +P  +++NS
Sbjct: 88  ENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVVEDNS 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
                 + IET     +QN+    ++ + +PGNPTGA++ PE+I ++  ++      V+ 
Sbjct: 148 FQMDTEKVIET-----LQNDPSIKLVFITSPGNPTGALIKPENIEKL--LSQWQSGFVVV 200

Query: 368 DEVY 371
           DE Y
Sbjct: 201 DEAY 204

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 63/124 (50%), Gaps = 9/124 (7%)

Query: 251 DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYP--LYTATLALNNSQPLPYYLDENSG 308
           D+  TAG + A    L +FC   +T +L     +   LY A     N  P+P  LDE   
Sbjct: 135 DVLATAGNTNAWESTLRVFCNRGDT-ILAEAYSFSSSLYAAEAQGVNVFPVP--LDE--- 188

Query: 309 WSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIA 367
           +   PE++E+++        KP +L  I  G NPTG+ LS +  A+I+ +A K+  ++I 
Sbjct: 189 FGIIPEKLESIMDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKAKIYRIAQKHNFIIIE 248

Query: 368 DEVY 371
           DE Y
Sbjct: 249 DEPY 252

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 62/126 (49%), Gaps = 13/126 (10%)

Query: 251 DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALN----NSQPLPYYLDEN 306
           D+  T G + A   +L IFC   +T   I   Q+   ++  A      N  P+P  LDE+
Sbjct: 134 DVLATIGNTGAWESVLRIFCNRGDT---ILAEQFAFSSSISAAEAQGVNVFPIP--LDEH 188

Query: 307 SGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVV 365
                 P ++ET++    +   KP +L  +  G NPTG+ LS +   +I+ +A K+  ++
Sbjct: 189 G---IIPSKLETILDNWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFII 245

Query: 366 IADEVY 371
           I DE Y
Sbjct: 246 IEDEPY 251

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 79/168 (47%), Gaps = 14/168 (8%)

Query: 221 YSSSQGVEGIRKSVADFITKRDG----GETAYPEDIFLTAGASAAVTYLLSIFCRGPETG 276
           YS +QG++ +   +  FITK +      ET Y  DI L  G+S ++  +    C    T 
Sbjct: 137 YSETQGMKPLLDFIKTFITKLNNTPPYNETLY--DIMLANGSSDSMFKVFETLCDESTTV 194

Query: 277 VLIPIPQYPLYTATLALNNSQPLPYYLDEN-SGWSTNPEEIETVV-----KEAIQNEIKP 330
           ++      P+ +  +A   ++ +P  L+ N      + E +E ++     K   ++  KP
Sbjct: 195 LMEEFTFVPVISNVMA-TGAKCIPLKLNLNYEDQGIDIEYLENLLDNWGGKSNTKHLSKP 253

Query: 331 TVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP 377
            +L  I+ G NP G  LS E   +I+ +A ++  +++ D+ Y    FP
Sbjct: 254 KILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDDPYCYLTFP 301

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 73/151 (48%), Gaps = 9/151 (5%)

Query: 221 YSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIP 280
           Y S  G   +R  VA   +  +   TA  +++ +T GA  A  +L+     GP   ++  
Sbjct: 55  YGSIWGTPVLRDLVAKIHSSDEIQLTA--DNVLITNGAIGA-NFLVHYTAAGPGDHIICV 111

Query: 281 IPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGN 340
            P Y   ++  ++  +     +L+   G++ N +++++ V+   +       +V+ NP N
Sbjct: 112 DPTYQQLSSVPSMFGADVELLHLEAEDGYTPNIQKLKSKVRANTK------YIVLNNPNN 165

Query: 341 PTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371
           P G+V+S E + +I + A +    ++ DEVY
Sbjct: 166 PLGSVISTEKMTEIIDYAERNEIFIVCDEVY 196

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 85/184 (46%), Gaps = 23/184 (12%)

Query: 238 ITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ 297
           + K  G E    +++ L  G+   +  L+   CR     +L   P Y +Y+    +N+ +
Sbjct: 73  LDKTPGIEPLTEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMYSVCANINDVE 132

Query: 298 PL--PYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIF 355
            +  P   ++NS     PE + T     ++N+ K  +L + +PGNPTG +++ + I  I 
Sbjct: 133 IVECPLITEDNSFQMNVPEVLST-----LKNDPKIKLLFITSPGNPTGKLVNKKDIEFIL 187

Query: 356 EVAAKYGTVVIADEVYQENIFP---GTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSK 412
           E       +V+ DE Y +  F    GT + SM K++         K+ N+ +    S S 
Sbjct: 188 ENWT--NGLVVVDEAYID--FADAEGTTY-SMAKLVT--------KYPNLTVLQTLSKSF 234

Query: 413 GVSG 416
           G++G
Sbjct: 235 GLAG 238

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 65/125 (52%), Gaps = 11/125 (8%)

Query: 250 EDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ--PLPYYLDENS 307
           +++ L  G+  ++  L+   C   +  +LI  P Y +Y+    +N+ +   +P  +++NS
Sbjct: 88  DNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVEDNS 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
                 + IET     +Q +    +  V +PGNPTGA++    IA I ++ +++ + ++A
Sbjct: 148 FQMNTDKVIET-----LQGDSNIKIAFVTSPGNPTGALI---DIASIEKILSQWQSGIVA 199

Query: 368 -DEVY 371
            DE Y
Sbjct: 200 IDEAY 204

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 65/125 (52%), Gaps = 11/125 (8%)

Query: 251 DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPL---PYYLDENS 307
           D+  T G + A    L +FC   + G +I + +   +++ LA   +Q +   P  +DE+ 
Sbjct: 132 DVVATTGNTNAWESTLRVFC---DKGDVI-LAEAHSFSSCLAAAQAQGIITFPIPIDEHG 187

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVI 366
                PE++E ++    +   KP +L  I  G NPTG+ LS +   +I++VA K+  ++I
Sbjct: 188 ---IIPEKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIII 244

Query: 367 ADEVY 371
            DE Y
Sbjct: 245 EDEPY 249

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 62/125 (49%), Gaps = 11/125 (8%)

Query: 251 DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPL---PYYLDENS 307
           DI LT G +      L +FC     G +I + +   ++++LA   +Q +   P  +DE+ 
Sbjct: 132 DIILTTGNTNGWESTLRVFCN---KGDVI-LAEAHSFSSSLASAEAQGITTFPIPIDEHG 187

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVI 366
                PE++E ++        KP +L  I  G NPTG  L+ E   +I+ +A K+  ++I
Sbjct: 188 ---IIPEKLEEILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDFLII 244

Query: 367 ADEVY 371
            DE Y
Sbjct: 245 EDEPY 249

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 62/126 (49%), Gaps = 13/126 (10%)

Query: 250 EDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ----PLPYYLDE 305
           E++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+ +    PL Y   +
Sbjct: 89  ENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSMYSVCAEINDIEIVECPLLY---K 145

Query: 306 NSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVV 365
           N+ +  + E + TV    +QN+    +L + +PGNPTGA +  E I  + +       +V
Sbjct: 146 NNSFQMDTESVLTV----LQNDPLIKLLFITSPGNPTGARIETERIETVLQNWTD--GLV 199

Query: 366 IADEVY 371
           + DE Y
Sbjct: 200 VVDEAY 205

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 80/170 (47%), Gaps = 19/170 (11%)

Query: 250 EDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ--PLPYYLDENS 307
           +++ L  G+  ++  L+   C   +  +LI    Y +YT    +N+ +   +P  L E  
Sbjct: 88  DNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLLLSEED 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGT-VVI 366
            +  + E+I     E +QN+    ++ + +PGNPTG  +    I +I    +++ T +V+
Sbjct: 148 KFQIDEEKI----LETLQNDPSIKLVFITSPGNPTGTFIDVNRIEKIL---SQWQTGLVV 200

Query: 367 ADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSG 416
            DE Y +    G++  S+  +          K++N+ +    S S G++G
Sbjct: 201 VDEAYID-FVEGSDKGSLAPL--------ATKYENIAVLQTLSKSFGLAG 241

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 108/259 (41%), Gaps = 36/259 (13%)

Query: 186 LNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVG-AYSSSQGVEGIRKSVADFITKRDG- 243
           + H   EL   ++ K+D  K  K    DI  +    Y  SQG    +  + +FI + +  
Sbjct: 68  IGHPISELSNDEVCKVDLKKDVKVHEGDIPLARSLQYGFSQG----QPELLEFIREHNKL 123

Query: 244 -GETAYPE-DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPL-- 299
             +  Y + D+  TAG + A    L +FC     G +I + +   +++ LA   +Q +  
Sbjct: 124 IHDMQYEDWDVVATAGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSCLAAAQAQGITT 179

Query: 300 -PYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEV 357
            P  +D+       P ++E ++        KP +L  I  G NPTG  L+ E   +IF +
Sbjct: 180 FPVPIDDKG---IIPAKLEAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRI 236

Query: 358 AAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQ-----RDHPGKFDNVQLASLHSTSK 412
           A K+  ++I D  Y         F  M K  R LQ     R  P +     LASL  T  
Sbjct: 237 AQKHDFLIIEDAPYY--------FLQMDKYERDLQKRAVTRAQPRESHKDFLASLDKTFL 288

Query: 413 GVSGECGQRGGYMELTGFS 431
            V  +    G  + L  FS
Sbjct: 289 SVDTD----GRVIRLDSFS 303

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 61/125 (48%), Gaps = 11/125 (8%)

Query: 251 DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ---PLPYYLDENS 307
           D  LT G +      L IFC     G +I + +   ++++LA   +Q     P  +D + 
Sbjct: 132 DSILTTGNTNGWESTLRIFCN---KGDVI-LAEAHSFSSSLASAEAQGVITFPVPIDSDG 187

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVI 366
                PE++E+++        KP +L  I  G NPTG+ LS E    I+++A K+  ++I
Sbjct: 188 ---IIPEKLESILDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDFIII 244

Query: 367 ADEVY 371
            DE Y
Sbjct: 245 EDEPY 249

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 57/126 (45%), Gaps = 13/126 (10%)

Query: 251 DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALN----NSQPLPYYLDEN 306
           ++  T G + +    L IFC   +T   I   QY   ++  A      N  P+P   D  
Sbjct: 135 NVLATTGNTGSWESTLRIFCNRGDT---ILAEQYTFSSSVYAAEAQGINVFPVPLDAD-- 189

Query: 307 SGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVV 365
                 PE +E ++     +  KP +L  I  G NPTG+ LS +   +I+ +A K+  ++
Sbjct: 190 ---GLIPERLEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLI 246

Query: 366 IADEVY 371
           I DE Y
Sbjct: 247 IEDEPY 252

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 61/126 (48%), Gaps = 13/126 (10%)

Query: 250 EDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNN--SQPLPYYLDENS 307
           E+I L  G+  ++  L+ + C   +  ++I  P Y +Y+    +N+     +P   ++NS
Sbjct: 88  ENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVAEDNS 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTV--LVVINPGNPTGAVLSPESIAQIFEVAAKYGTVV 365
                 + +ET+ ++       PT+  + + +PGNPT A++    I ++       G +V
Sbjct: 148 FQMDTSKVLETLAQD-------PTIKLIFITSPGNPTAALIDTAEIEKVLNNWT--GGLV 198

Query: 366 IADEVY 371
           + DE Y
Sbjct: 199 VVDEAY 204

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 70/353 (19%), Positives = 131/353 (37%), Gaps = 46/353 (13%)

Query: 218 VGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAV-TYLLSIFCRGPETG 276
           V  YS ++G   +  S+    +   G E    E++ +T GA+  + + L+ I   G E  
Sbjct: 92  VNQYSPTKGRPSVINSLKKLYSPLYGQELK-DENVTITTGANEGILSSLMGILNPGDEVI 150

Query: 277 VLIP-----IPQYPLYTATLA---LNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEI 328
           V  P     IP   L    +    +N  + +   + E   W+ + EE+            
Sbjct: 151 VFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRIVEGKDWTIDYEELAKAFTS------ 204

Query: 329 KPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVL 388
           K   L++  P NP G V + E + +I  +  +   V+I+DEVY+   F  +         
Sbjct: 205 KTKALILNTPHNPIGKVFTKEELTKIGNLCVENNVVIISDEVYEFLYFTDSY-------- 256

Query: 389 RHLQRDHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCP 448
                         ++A+L      ++   G  G     TG+       ++ L    L  
Sbjct: 257 -------------TRIATLSPEIGQLTLTVGSAGKTFAATGWRIGW---VISLNPELLSY 300

Query: 449 VVTGQALVDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSL---EGIECQK 505
           V  G   +      P++   +   + + +    E + T  +  +E F S+    G+    
Sbjct: 301 VSKGHTRICFSSPSPIQEAVANSIEDALKGDYFEAMRTDYIRKFEIFTSVFKEMGLPYTI 360

Query: 506 PQGAMYL---FPKIDVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGF 555
           P+G  ++   F K++VP         L+   D      L+   G+  +P + F
Sbjct: 361 PEGTYFILVDFSKVNVPEDYPYPEELLDKGKDFRISYWLINELGVVAIPPTEF 413

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 59/124 (47%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ--PLPYYLDENS 307
           E++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+ +    P    +NS
Sbjct: 87  ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVKCPLITSDNS 146

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
             +   E I+T      QN+    ++ + +PGNPTGA +    I +I +   +   +V+ 
Sbjct: 147 FQANTDEVIKTA-----QNDPSIKLIFITSPGNPTGAKVETSRIEKILQNWDR--GMVVV 199

Query: 368 DEVY 371
           DE Y
Sbjct: 200 DEAY 203

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 77/170 (45%), Gaps = 20/170 (11%)

Query: 218 VGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAV-TYLLSIFCRGPETG 276
           V  YS ++G   +  S+ D  T     E    E++ +T GA+  + + L+ +   G E  
Sbjct: 85  VNQYSPTRGRPSLINSLIDLYTPIYNKELK-AENVVVTTGANEGILSCLMGLLNSGDEVI 143

Query: 277 VLIP-----IPQYPLYTATLALNNSQPLPYYLDENSG----WSTNPEEIETVVKEAIQNE 327
           V  P     IP   L    +      P P  LD+ +     W+ + E+ E    +AI ++
Sbjct: 144 VFEPFFDQYIPNIELCGGKVVYVPINP-PKELDQRNTRGEEWTIDFEQFE----KAITSK 198

Query: 328 IKPTVLVVIN-PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIF 376
            K    V+IN P NP G V + + +  +  +  K+  V+I+DEVY+   F
Sbjct: 199 TKA---VIINTPNNPIGKVFTHDELTTLGNICVKHNVVIISDEVYEHLYF 245

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 85/169 (50%), Gaps = 15/169 (8%)

Query: 221 YSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAV-TYLLSIFCRGPETGVLI 279
           YS ++G   + K++AD  T   G + +  ++I +  GA+ A+ + L+ +  +G E  V++
Sbjct: 77  YSPTRGRPNLIKALADLYTPLYGQQLS-ADNITVHTGANEAIFSCLMGLLNKGDE--VIV 133

Query: 280 PIPQYPLYTATLALNNSQ----PL--PYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVL 333
             P +  Y + + L        P+  P  LD+     T  E    ++++ I +  K    
Sbjct: 134 FEPFFDQYISNIELAGGVVRYVPINPPRELDDRVTRGTEWEIDWDILEKTINSRTK---C 190

Query: 334 VVIN-PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEF 381
           V+IN P NP G V + E + ++ ++      V+I+DEVY E+++   EF
Sbjct: 191 VIINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVY-EHLYFSDEF 238

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 77/168 (45%), Gaps = 24/168 (14%)

Query: 218 VGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAV-TYLLSIFCRGPETG 276
           V  YS ++G   +  S+    +   G E    E+I +T GA+  + + L+ +   G E  
Sbjct: 89  VNQYSPTRGRASLLNSLIKLYSPFYGKELK-QENITITTGANEGILSCLMGLLNAGDE-- 145

Query: 277 VLIPIPQYPLYTATLAL----------NNSQPLPYYLDENSGWSTNPEEIETVVKEAIQN 326
           V++  P +  Y + + L          N  + L   + E + W        T+  E  +N
Sbjct: 146 VIVFEPFFDQYISNIELMGGKVVYVPINPPKDLDQRITEGTEW--------TIDFEQFRN 197

Query: 327 EIKP-TVLVVIN-PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ 372
            I P T  V++N P NP G V + E + ++ E+  +   ++I+DEVY+
Sbjct: 198 AITPKTKAVIVNSPHNPIGKVFTKEELTKLGEICVENNVIIISDEVYE 245

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 80/371 (21%), Positives = 152/371 (40%), Gaps = 54/371 (14%)

Query: 203 AIKRAKSLIKDIGGSVGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAV 262
           AIK A+  + DI   V  YS ++G   +  ++    T   G E    E++ +T GA+  +
Sbjct: 73  AIKEAQKAL-DIP-LVNQYSPTRGRVSLLNALIKQYTPIYGSELK-QENVTITTGANEGI 129

Query: 263 -TYLLSIFCRGPETGVLIPIPQYPLYTATLAL----------NNSQPLPYYLDENSGWST 311
            + L+ +   G E  V++  P +  Y + + L          N  + L   + E + W+ 
Sbjct: 130 LSCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKIVYVPINPPKELDQRVTEGTEWTV 187

Query: 312 NPEEIETVVKEAIQNEIKPTVLVVIN-PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEV 370
           + E+     K AI ++ K    V+IN P NP G V + E + QI  +  +   ++I+DEV
Sbjct: 188 DMEQF----KNAITSKTKA---VIINTPHNPIGKVFTREELLQIGNICVEKNVIIISDEV 240

Query: 371 YQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGF 430
           Y E+++   EF  +  +   +           QL     ++       G R G++     
Sbjct: 241 Y-EHLYFTDEFTRIATLSPEIG----------QLTLTVGSAGKTFAATGWRIGWV--ISL 287

Query: 431 SHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMT 490
           + E+ Q + K A   +C               P++   +   + +  ++  EK+    + 
Sbjct: 288 NSELLQYVSK-AHTRIC----------FASPSPLQEACANSINDALESNYFEKMRQEYIQ 336

Query: 491 LYETFNSL---EGIECQKPQGAMYL---FPKIDVPFKAIQEAHHLELTPDEFYCKKLLES 544
            ++ F S+    G+   KP+G  ++   F K+ +P         L    D      L+  
Sbjct: 337 KFKIFTSVFEELGLPYTKPEGTYFVLADFSKVKIPEDYPYPKEILNKGKDFRISHWLINE 396

Query: 545 TGICTVPGSGF 555
            G+  +P + F
Sbjct: 397 LGVVAIPPTEF 407

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 6/68 (8%)

Query: 309 WSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIAD 368
           W+ N +E+E  +        K   L++  P NP G V + E + +I E+  K+  V+I+D
Sbjct: 183 WTVNYDELEAAITP------KTKALILNTPHNPVGKVFTREELLRIGEICVKHNVVIISD 236

Query: 369 EVYQENIF 376
           EVY+   F
Sbjct: 237 EVYEHLYF 244

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 60/123 (48%), Gaps = 7/123 (5%)

Query: 251 DIFLTAGASAAVTYLLSIFC-RGPETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGW 309
           D+  T G + A    L +FC RG      + + +   ++++LA   +Q +  +       
Sbjct: 132 DVVATTGNTNAWESTLRVFCNRGD-----VILAEAHSFSSSLASAEAQGIITFPVPIDAH 186

Query: 310 STNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIAD 368
              PE++E ++    +   KP +L  I  G NPTG+ L+ E   +I+ +A K+  ++I D
Sbjct: 187 GIIPEKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIED 246

Query: 369 EVY 371
           E Y
Sbjct: 247 EPY 249

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 60/124 (48%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPL--PYYLDENS 307
           ++I L  G+   V  L+   C      VL+  P Y +Y+    +N+++ +  P   ++NS
Sbjct: 88  KNICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSVFAMINDTEVVECPLITEDNS 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
                  +++ V+ E + N+    +L +  PGNPTGA +S + I  +    +    +V+ 
Sbjct: 148 F----DMDLDNVL-ETLSNDDSIKLLFITTPGNPTGASISTQKIEMLLNNWS--AGIVVV 200

Query: 368 DEVY 371
           DE Y
Sbjct: 201 DEAY 204

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 78/170 (45%), Gaps = 13/170 (7%)

Query: 250 EDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPL--PYYLDENS 307
           +++ L  G+   +  L+   C+     +++  P Y +Y+    +N+   +  P  +++NS
Sbjct: 85  KNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVCANINDVDVVNCPLIVEDNS 144

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
                   +ET+ K+ +       +L + +PGNPTG +++ + I  + E   K G VV+ 
Sbjct: 145 FQMDVKRTLETLKKDDLIR-----LLFITSPGNPTGKIIAIKDIIYVLE-HWKNGLVVV- 197

Query: 368 DEVYQENIFPGTEFNSMKKVLRHLQ-RDHPGKFDNVQLASLHSTSKGVSG 416
           DE Y +     T FN   K   +        K+ N+ +    S S G++G
Sbjct: 198 DEAYVDF---STYFNEETKKTEYFSVAKLVTKYPNLTVLQTLSKSFGLAG 244

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 60/126 (47%), Gaps = 13/126 (10%)

Query: 251 DIFLTAGASAAVTYLLSIFC-RGPETGVLIPIPQYPLYTATLALNNSQPL---PYYLDEN 306
           DI  TAG + A    L +FC RG      + + +   +++ LA   +Q +   P  +D+N
Sbjct: 133 DIIATAGNTNAWESTLRVFCNRGD-----VILAEAHSFSSCLAAAQAQGITTFPIPIDDN 187

Query: 307 SGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVV 365
                 PE++E ++        KP +L  I  G NPTG  L    + +I+ +A K+  ++
Sbjct: 188 G---IIPEKLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHDFLI 244

Query: 366 IADEVY 371
           + D  Y
Sbjct: 245 VEDAPY 250

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 56/126 (44%), Gaps = 13/126 (10%)

Query: 251 DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALN----NSQPLPYYLDEN 306
           D+  T G + +    L IFC   +T   I   +Y   ++  A      N  P+P   D  
Sbjct: 135 DVLATIGNTGSWESTLRIFCNRGDT---ILAEKYTFSSSVYAAEAQGVNVFPVPLDAD-- 189

Query: 307 SGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVV 365
                 PE +E ++        KP +L  I  G NPTG+ LS +   +I+ +A K+  ++
Sbjct: 190 ---GLIPERLEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFII 246

Query: 366 IADEVY 371
           I DE Y
Sbjct: 247 IEDEPY 252

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 74/168 (44%), Gaps = 16/168 (9%)

Query: 218 VGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAV-TYLLSIFCRGPETG 276
           V  YS ++G   + +S+    +     E    E++ +T GA+  + + L+ I   G E  
Sbjct: 84  VNQYSPTRGRVSLLESLIKLYSPLYNAELK-AENVTVTTGANEGILSCLMGILNPGDEVI 142

Query: 277 VLIP-----IPQYPLYTATLA---LNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEI 328
           V  P     IP   L    +    +N  + +   + + + W+ + E+    + +      
Sbjct: 143 VFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRVVKGTEWTVDYEQFANAITD------ 196

Query: 329 KPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIF 376
           K   +++  P NP G V + E + +I E+  K   V+I+DEVY+   F
Sbjct: 197 KTKAVIINTPHNPIGKVFTREELTRIGEICVKKNVVIISDEVYEHLYF 244

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 84/182 (46%), Gaps = 21/182 (11%)

Query: 221 YSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAV-TYLLSIFCRGPETGVLI 279
           YS ++G   + KS+ DF +     ET    ++ +T GA+  +   L+ +   G E  V++
Sbjct: 88  YSPTRGRPSLLKSLTDFYSPI-YNETLNESNVTITTGANEGILASLVGLLNPGDE--VIV 144

Query: 280 PIPQYPLYTATLALNNSQ----PL--PYYLDE----NSGWSTNPEEIETVVKEAIQNEIK 329
             P +  Y + + +   +    PL  P  L E     + W  + + +   + E      +
Sbjct: 145 FEPFFDQYISNIEIPGGKVRYVPLVAPKELSERVTIGAEWKIDFDILNKTINE------R 198

Query: 330 PTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLR 389
              +++  P NP G V + E + Q+ ++  K    +I+DEVY E+++ G EF  +  + +
Sbjct: 199 TKCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVY-EHLYFGDEFTRIATISK 257

Query: 390 HL 391
            +
Sbjct: 258 EI 259

>Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar to
           Ashbya gossypii AGR167W
          Length = 488

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 90/198 (45%), Gaps = 14/198 (7%)

Query: 180 LQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIG-GSVGAYSSSQGVEGIRKSVADFI 238
           ++ PE+L+    E  GS   K+  + + +   KDI       Y +S+G   +   + + I
Sbjct: 60  IEIPEMLSSKGDE--GSVTGKLCKLAKDQENPKDIPLARALQYGNSRGQRELVSFLKEHI 117

Query: 239 TKRDGGETAYPE-DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ 297
            K    +  Y + D+ +TAG++ A    L +FC  P   VL+   +   Y++++    +Q
Sbjct: 118 VKFH--QIPYSDWDVLITAGSTQAWDASLRLFCN-PGDSVLL---ESWTYSSSVEAAEAQ 171

Query: 298 PLPYYLDENSGWSTNPEEIETVVKEAIQ---NEIKPTVLVVINPG-NPTGAVLSPESIAQ 353
            +     E  G    PE++E +++           P +L VI  G NP G  L+ E    
Sbjct: 172 GMYCVGVEIDGHGVVPEKLEWLLQNWDDLHPGRSLPKLLYVIPTGQNPMGVTLADERKPL 231

Query: 354 IFEVAAKYGTVVIADEVY 371
           I+ +  KY  V+I D+ Y
Sbjct: 232 IYNIIQKYDMVLIEDDPY 249

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 64/125 (51%), Gaps = 11/125 (8%)

Query: 251 DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPL---PYYLDENS 307
           ++ +TAG ++A    L IFC   +T     + +   ++++L+   +Q +   P  +D+  
Sbjct: 132 ELLVTAGNTSAWESTLRIFCNRGDT----ILAEAHSFSSSLSAAQAQGIITFPVPIDDKG 187

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVI 366
                PE++  ++        KP +L  I  G NPTG+ L  E  +Q++++A K+  +++
Sbjct: 188 ---IIPEKLAAIMDNWNPETPKPKLLYTIPTGQNPTGSSLDAERKSQVYKIAQKHDFLIV 244

Query: 367 ADEVY 371
            DE Y
Sbjct: 245 EDEPY 249

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 78/189 (41%), Gaps = 37/189 (19%)

Query: 220 AYSSSQGVEGIRKSVADFITK------RDGGETAYPEDIFLTAGASAAVTYLLSIFCRGP 273
            Y S++G   +R ++ +F+ +      RD    + PE + LT+GAS  V  +L +    P
Sbjct: 50  TYGSNEGALWVRTAITEFVNEKAFKFDRDDKARSKPEYLNLTSGASYGVLNIL-LQATLP 108

Query: 274 ETGV----LIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVK--EAIQ-- 325
            TGV     I  P Y L                +DE    S + E +E  +K  E+I   
Sbjct: 109 HTGVTKQAFIVSPTYFLINDCFIDAGFGGKLTAIDEKGEESIDLELLEAKLKHFESIDPN 168

Query: 326 --NEIKPTVLVVINP--------------------GNPTGAVLSPESIAQIFEVAAKYGT 363
             NE    + ++ NP                     NP+G   + E+  ++ E+A KY  
Sbjct: 169 PVNENGKELSIIKNPIDISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKYDM 228

Query: 364 VVIADEVYQ 372
           ++I D+VY 
Sbjct: 229 LIITDDVYD 237

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 69/152 (45%), Gaps = 12/152 (7%)

Query: 221 YSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIP 280
           Y S +G + +R  +A        G     +++ +T GA AA  +L+     GP   V+  
Sbjct: 55  YGSIKGSDKLRSLIASMY-----GPEFNKDNVLVTNGAIAA-NFLIYYTLVGPGDHVICV 108

Query: 281 IPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGN 340
            P Y    +   +  ++     L +  G+  N E ++ ++K   +      ++++ NP N
Sbjct: 109 DPTYAQLYSVPKMFGAEVSLLKLQKEDGFIPNIETLKKMIKSNTK------LIIINNPNN 162

Query: 341 PTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ 372
           P G+ +S E++  I ++  +    +  DEVY+
Sbjct: 163 PLGSAISTETLNDICQLCEENNIYLHCDEVYK 194

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 73/168 (43%), Gaps = 16/168 (9%)

Query: 218 VGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAV-TYLLSIFCRGPETG 276
           V  YS ++G   +  S+ D  +     +   PE++ +T GA+  + + L+ I   G E  
Sbjct: 85  VNQYSPTRGRPRLINSLIDLYSPFYKKQLT-PENVLVTTGANEGILSCLMGIINPGDEVI 143

Query: 277 VLIP-----IPQYPLYTATLA---LNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEI 328
           V  P     IP   L    +    +N  + L   + + + W+ + +E    +        
Sbjct: 144 VFEPFFDQYIPNIELCGGKVVYVPINPPKELDNRVTKGTEWTVDFDEFTRAITP------ 197

Query: 329 KPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIF 376
           K   +++  P NP G V + E + ++  +  +   ++IADEVY+   F
Sbjct: 198 KTKAVIINTPHNPIGKVFTREELTKLGNICVENNVIIIADEVYEHLYF 245

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 61/127 (48%), Gaps = 15/127 (11%)

Query: 251 DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ-----PLPYYLDE 305
           D+F TAG + A    L +FC     G +I + +   ++++LA   +Q     P+P   D 
Sbjct: 134 DVFATAGNTNAWESTLRLFCN---RGDVI-LAEAHSFSSSLASAEAQGVITFPVPIDAD- 188

Query: 306 NSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTV 364
                  PE++  ++     N  KP +L  I  G NPTG  ++      I+++A K+  +
Sbjct: 189 ----GIIPEKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFL 244

Query: 365 VIADEVY 371
           ++ DE Y
Sbjct: 245 IVEDEPY 251

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 60/137 (43%), Gaps = 17/137 (12%)

Query: 250 EDIFLTAGASAAV-TYLLSIFCRGPETGVLIP-----IPQYPLYTATLALNNSQPLPYYL 303
           E++ +T GA+  + + L+ +   G E  V  P     IP   L    +      P P  L
Sbjct: 132 ENVTVTTGANEGILSCLMGLLNSGDEVIVFEPFFDQYIPNIELCGGKVVYVPINP-PKEL 190

Query: 304 DENSG----WSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAA 359
           D+ +     W+ + E+ E  +        K   +++  P NP G V + E +  +  +  
Sbjct: 191 DQRNTKGEEWTIDFEQFENAITS------KTKAVIINTPHNPIGKVFTREELTTLGNICV 244

Query: 360 KYGTVVIADEVYQENIF 376
           K+  V+I+DEVY+   F
Sbjct: 245 KHNVVIISDEVYEHLFF 261

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 69/152 (45%), Gaps = 9/152 (5%)

Query: 221 YSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIP 280
           Y + +G + +R  VA   + +   E    +D  L    +    +L+S    GP   V+  
Sbjct: 55  YGAIKGSDELRSLVASLYSDK---EVKLDKDNVLITNGAIGANFLVSYTLAGPGDHVICV 111

Query: 281 IPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGN 340
            P Y   ++   +  ++     L+  + +  +  ++++++K   +       +V+ NP N
Sbjct: 112 DPTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMIKGNTK------CIVLNNPNN 165

Query: 341 PTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ 372
           P G+V+   ++ +I  +A K    VI DEVY+
Sbjct: 166 PLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 64/138 (46%), Gaps = 10/138 (7%)

Query: 251 DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWS 310
           D+  TAG++ A    L +FC   ET   + + +Y  Y+++L    +Q L     +     
Sbjct: 128 DLITTAGSTQAWDACLRLFCNRGET---VLMEEYT-YSSSLEAAVAQGLNCVAMKMDKDG 183

Query: 311 TNPEEIETVVKE---AIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
              +++  ++++   A+Q      +  + N  NPTG  L  E   ++  +A++Y  ++I 
Sbjct: 184 IKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIE 243

Query: 368 DEVY---QENIFPGTEFN 382
           D+ Y   Q N F   E N
Sbjct: 244 DDPYYFLQMNEFGAPELN 261

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 78/191 (40%), Gaps = 36/191 (18%)

Query: 249 PEDIFLTAGASAAV-TYLLSIFCRGPETGVLIPIPQYPLYTATL--------ALNNSQPL 299
           PE+I +T GA+  +   L+S+   G E  VL P     +Y   +         L   + L
Sbjct: 99  PENIQVTTGANVGIFACLMSLLNPGDEVIVLEPFFDQYIYNIKVLGGIVKHVPLTPPKDL 158

Query: 300 PYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAA 359
                + S W+ + ++  + + E      K   +++ +P NPTG V + E +  +  +  
Sbjct: 159 KTRRTKGSEWTLDFDQFRSAISE------KTKAVIINSPHNPTGKVFTREELLTLGNICV 212

Query: 360 KYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECG 419
           +    +I+DEVY EN++   E                     V+LASL      ++   G
Sbjct: 213 EKNVYIISDEVY-ENLYFTPE--------------------CVKLASLSPEISNITLTIG 251

Query: 420 QRGGYMELTGF 430
             G    +TG+
Sbjct: 252 SAGKIFAVTGW 262

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 85/184 (46%), Gaps = 20/184 (10%)

Query: 203 AIKRAKSLIKDIGGSVGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAV 262
           AI  AKS + D+   V  YS ++G   + KS+ + + K   G+    +++ +T GA+  +
Sbjct: 61  AINAAKSAL-DVP-LVNQYSPTRGRPSLIKSLVE-LYKPVFGDFIDNQNVLVTTGANEGI 117

Query: 263 -TYLLSIFCRGPETGVLIP-----IPQYPLYTATLALNNSQPLPYYLDENSG---WSTNP 313
            + L+ I   G E  V  P     IP   L    +      P       N+    W  + 
Sbjct: 118 LSCLMGILNAGDEVIVFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTGDEWQIDW 177

Query: 314 EEIETVVKEAIQNEIKPTVLVVIN-PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ 372
           + +E    +   N+ K    V+IN P NP G V + + + ++ ++  ++ TVVI+DEVY+
Sbjct: 178 DALE----KTFNNKTKA---VIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVYE 230

Query: 373 ENIF 376
              F
Sbjct: 231 HLYF 234

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/126 (21%), Positives = 62/126 (49%), Gaps = 13/126 (10%)

Query: 250 EDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ----PLPYYLDE 305
           E++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+ +    PL Y   E
Sbjct: 88  ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCANINDIEVVECPLIY---E 144

Query: 306 NSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVV 365
           ++ +  N +++  ++K    N+    ++ + +PGNPTG  +  + I ++ +       +V
Sbjct: 145 DNSFQLNSDKVLDILK----NDPLIKLVFITSPGNPTGVKIETKRIEKVLQNWD--NGLV 198

Query: 366 IADEVY 371
           + DE Y
Sbjct: 199 VVDEAY 204

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (47%), Gaps = 14/128 (10%)

Query: 251 DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPL---PYYLDENS 307
           DI  T G++      L IFC   +T +L    +Y  Y++++   ++Q L   P  LD   
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDTVLL---EEY-TYSSSVEAADAQGLNCIPMPLD--- 184

Query: 308 GWSTNPEEIETVV---KEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGT 363
           G    PE++E ++    +   +   P +L  I  G NPTG  LS      I+ +A KY  
Sbjct: 185 GEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDM 244

Query: 364 VVIADEVY 371
           ++I DE Y
Sbjct: 245 IIIEDEPY 252

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 75/176 (42%), Gaps = 21/176 (11%)

Query: 250 EDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGW 309
           ++I L  G+  ++  ++   C   E  V++  P Y +Y     +N+      Y++     
Sbjct: 88  KNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKVCADINDVG----YVEVPLIS 143

Query: 310 STNPEEI-ETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIAD 368
           S N  +I E  + E +  +    V+ + +PGNPTGA +    + ++         +V+ D
Sbjct: 144 SDNSFQIDEDRILEQLNLDKSIKVVFITSPGNPTGACIEVGRVEKLLR--NWTAGIVVVD 201

Query: 369 EVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQRGGY 424
           E Y        +F++ K  L  L   HP       L  L + SK  SG  G R G+
Sbjct: 202 EAY-------IDFSADKPSLSPLVNKHP------NLVVLQTLSKA-SGLAGIRLGF 243

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 60/127 (47%), Gaps = 15/127 (11%)

Query: 251 DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ-----PLPYYLDE 305
           D+  TAG + A    L +FC     G +I +  +  ++++LA   +Q     P+P   D 
Sbjct: 134 DVLATAGNTNAWESTLRVFCN---RGDVILVEAHS-FSSSLASAEAQGVITFPVPIDAD- 188

Query: 306 NSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTV 364
                  PE++  V++       KP +L  I  G NPTG  ++      I+++A KY  +
Sbjct: 189 ----GIIPEKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFL 244

Query: 365 VIADEVY 371
           ++ DE Y
Sbjct: 245 IVEDEPY 251

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 80/208 (38%), Gaps = 34/208 (16%)

Query: 221 YSSSQGVEGIRKSVADFITK------RDGGETAYPEDIFLTAGASAAVTYLL---SIFCR 271
           Y S +G   +R+++  F         RD    + PE + L++GAS  V  +L   ++   
Sbjct: 51  YGSDEGALWVREAITRFNNDETFRFARDDKARSRPEFLNLSSGASYGVLSILLQATLAHT 110

Query: 272 GPETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKE--------- 322
           G      I  P Y L                +DE+   S +   +E  ++E         
Sbjct: 111 GYTRQAFIVSPTYFLINDCFIDAGFGSKITAIDEDGQGSIDLALLERKLQEFEDKFTEEE 170

Query: 323 -------------AIQNEIKPTVLVVI-NPGNPTGAVLSPESIAQIFEVAAKYGTVVIAD 368
                        A+  +I   V+  I    NPTG   S E+  ++ E+A KY  ++IAD
Sbjct: 171 DQEKLQAITDPAKAVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDMLIIAD 230

Query: 369 EVYQENIF--PGTEFNSMKKVLRHLQRD 394
           +VY    F  P       KK   HL R+
Sbjct: 231 DVYDMLDFSPPFDNLPQPKKRFVHLDRE 258

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 84/185 (45%), Gaps = 22/185 (11%)

Query: 203 AIKRAKSLIKDIGGSVGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAV 262
           AIK A+  + DI   V  YS ++G   +  S+    +     E    E++ +T GA+  +
Sbjct: 72  AIKEAQKAL-DIP-MVNQYSPTRGRPSLINSLIKLYSPIYNTELK-AENVTVTTGANEGI 128

Query: 263 -TYLLSIFCRGPETGVLIP-----IPQYPLYTATLALNNSQPLPYYLDENSG----WSTN 312
            + L+ +   G E  V  P     IP   L    +      P P  LD+ +     W+ +
Sbjct: 129 LSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINP-PKELDQRNTRGEEWTID 187

Query: 313 PEEIETVVKEAIQNEIKPTVLVVIN-PGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371
            E+ E    +AI ++ K    V+IN P NP G V + E +  +  +  K+  V+I+DEVY
Sbjct: 188 FEQFE----KAITSKTKA---VIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVY 240

Query: 372 QENIF 376
           +   F
Sbjct: 241 EHLYF 245

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 59/127 (46%), Gaps = 15/127 (11%)

Query: 251 DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ-----PLPYYLDE 305
           ++  + G + A    L IFC   + G ++   +Y  +++ LA   +Q     P+P     
Sbjct: 131 EVIASVGNTNAWESTLRIFC---DRGDVVLFEEYS-FSSCLAACEAQGVTTIPIPI---- 182

Query: 306 NSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTV 364
              +   PE++E ++     N  KP +L  I  G NPTG  L  +    I+ +A K+  +
Sbjct: 183 -DAFGIVPEKLEDLLDNWTPNAPKPKLLYTIPTGQNPTGTSLPNDRREAIYRIAQKHDFL 241

Query: 365 VIADEVY 371
           ++ DE Y
Sbjct: 242 IVEDEPY 248

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 61/125 (48%), Gaps = 11/125 (8%)

Query: 250 EDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPL--PYYLDENS 307
           +++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+ + +  P  + +NS
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDNS 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGT-VVI 366
            +  N E + T+    + N+    ++   +PGNPTGA +       I EV  K+   +V+
Sbjct: 148 -FQMNTEAVLTI----LNNDPLIKIMFATSPGNPTGAKI---KTCLIEEVLQKWDNGIVV 199

Query: 367 ADEVY 371
            DE Y
Sbjct: 200 VDEAY 204

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 64/124 (51%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPL--PYYLDENS 307
           +++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+ + +  P  + +NS
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLVVSDNS 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
            +  + E + T+    ++N+    ++ V +PGNPTGA +    I Q+ +   + G VV+ 
Sbjct: 148 -FQMDVEAVLTI----LENDPLIKLVFVTSPGNPTGAKIKTSLIEQVLQ-NWQNGLVVV- 200

Query: 368 DEVY 371
           DE Y
Sbjct: 201 DEAY 204

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/122 (20%), Positives = 60/122 (49%), Gaps = 7/122 (5%)

Query: 251 DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLPY-YLDENSGW 309
           +I L  G+  ++  ++   C      +L+  P Y +Y+    +N+ + +    + E++ +
Sbjct: 89  NICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCAKINDVEVVTCPLITEDNSF 148

Query: 310 STNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADE 369
             + ++    V + + N+ +  +L + +PGNPTGA +    I ++ +   +   +V+ DE
Sbjct: 149 QMDSDK----VLDILNNDQEIKLLFITSPGNPTGAQIETARIEKVLQNWDR--GLVVVDE 202

Query: 370 VY 371
            Y
Sbjct: 203 AY 204

>AGR167W Chr7 (1059790..1061328) [1539 bp, 512 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGL202W (ARO8)
          Length = 512

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 57/125 (45%), Gaps = 8/125 (6%)

Query: 251 DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWS 310
           D+ +TAG++ A    + +FC   ++ V+        Y++++    +Q L     E     
Sbjct: 127 DVLVTAGSTQAWDATMRLFCNEGDSVVMEAFT----YSSSVEAAEAQGLYCVGMEVDSEG 182

Query: 311 TNPEEIETVVKEAI---QNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVI 366
             PE +  ++ E         +P VL  I  G NP G+ L     AQI+ +A +Y  +++
Sbjct: 183 IVPERLAELLAEWDTQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIV 242

Query: 367 ADEVY 371
            D+ Y
Sbjct: 243 EDDPY 247

>TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa]
           {ON} Anc_8.204 YER152C
          Length = 444

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 79/202 (39%), Gaps = 30/202 (14%)

Query: 220 AYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETG--- 276
            Y S +G   +R+ V + I +      + PE I LT+GAS  +  +L +    P TG   
Sbjct: 50  TYGSDEGALWVRQEVCNMINQIGSDINSKPEYINLTSGASYGILNIL-LQTTLPHTGYTK 108

Query: 277 -VLIPIPQYPL---------------------YTATLALNNSQPLPYYLDENSGWSTNPE 314
              I  P Y L                     YT+       + L Y+  E      N  
Sbjct: 109 QAFIVSPTYFLINDCFIDAGFGSKMTAIKEKGYTSIDLEYLKEKLEYFEQEIPDVPQNST 168

Query: 315 EIETVVKEAIQNEIKPTVLVVI-NPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ- 372
           +I    K  +Q +I   V   I    NP+G     E+  Q+ ++A KY  ++I D+VY  
Sbjct: 169 DI-IQNKNNLQKKIYKYVFYCIPTFSNPSGITWDYETRIQLIKIAKKYDMLIICDDVYDL 227

Query: 373 -ENIFPGTEFNSMKKVLRHLQR 393
            +  F     +++   L HL R
Sbjct: 228 LDYNFDSNATSNVAPRLVHLDR 249

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP 377
           +P++L  I+ G NPTG  +S E+ A+I+++A KY  +++ D+ Y    +P
Sbjct: 225 RPSILYTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPYSYMSYP 274

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 6/72 (8%)

Query: 305 ENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTV 364
           E + W+ + +E+   +        K   L++  P NP G V + E + QI ++  +   V
Sbjct: 179 EGTEWTVDYDELRAAITP------KTKALILNTPHNPVGKVFTREELLQIGQICVENNVV 232

Query: 365 VIADEVYQENIF 376
           +I+DEVY+   F
Sbjct: 233 IISDEVYEHLYF 244

>SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTE 380
           KP VL  I  G NPTG  LSPE    I+E+A  +  +++ D+ Y    FP  +
Sbjct: 245 KPRVLYTIATGQNPTGMTLSPEKRKAIYELAETHNFIIVEDDPYGYLKFPAYD 297

>CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152c
          Length = 436

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 70/177 (39%), Gaps = 26/177 (14%)

Query: 220 AYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETG--- 276
            Y   +G   +R+ + DF   R  G  + PE + L++G+S     +L +    P T    
Sbjct: 52  TYGPDEGALWVRQQICDF-NNRLFGSDSKPEFLNLSSGSSYGCLSVL-LHTTLPHTNFTR 109

Query: 277 -VLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVK-------------E 322
              I  P Y L                +DE    S N E++ + ++              
Sbjct: 110 QAFIISPTYFLINDCFIDAGFGSKLTAIDEEGEDSINFEQLLSKLRHFEELYGNSNGDVS 169

Query: 323 AIQNEIKPT-------VLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ 372
            IQN  KPT       +  V    NP+G   S E+  ++ E+A +Y  ++I D+VY 
Sbjct: 170 IIQNPNKPTKKVYKYVMYCVPTFANPSGKSYSLETRTKLIEIARRYDMLIICDDVYD 226

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 81/202 (40%), Gaps = 29/202 (14%)

Query: 221 YSSSQGVEGIRKSVADFITKR-----DGGETAYPED-IFLTAGASAAVTYLL---SIFCR 271
           Y S +G   +R+ +  F+  +     DG  T    D + L +GAS  +  +L   ++   
Sbjct: 50  YGSDEGALWVREQICTFLNDQVFKFDDGARTRTQVDHLNLNSGASYGMLNILLQTTLPHN 109

Query: 272 GPETGVLIPIPQYPLYTATL----------ALN-------NSQPLPYYLDENSGWSTNPE 314
           G      I  P Y L               A+N       + + L   LD + G S    
Sbjct: 110 GYTRQAFIITPTYFLINDCFRDAGFKGRITAINEKSHDSIDFESLVAALDHHEGESQPDS 169

Query: 315 EIETVVKEAIQNEIKPTVLVVI-NPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ- 372
             E +   A+  +I   VL  I    NP+G   S E+  ++ ++A KY  +VI+D+VY  
Sbjct: 170 TTEIIQGPALTKKIYKYVLYCIPTFANPSGNTYSLETRRRLIDIARKYDMLVISDDVYDI 229

Query: 373 -ENIFPGTEFNSMKKVLRHLQR 393
            +   P  E  S    + H+ R
Sbjct: 230 LDYTTPSNELASPPLRMVHIDR 251

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (47%), Gaps = 14/128 (10%)

Query: 251 DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPL---PYYLDENS 307
           DI  T G++      L IFC   +T +L    +   Y++++   ++Q L   P  LD   
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDTVLL----EDYTYSSSVEAADAQGLNCVPMPLD--- 184

Query: 308 GWSTNPEEIETVVK--EAIQNEI-KPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGT 363
           G    P ++E ++    ++  E+  P +L  I  G NPTG  LS      I+ +A +Y  
Sbjct: 185 GEGIVPSKLEEMLANWSSLYGEMPMPKLLYTIPTGQNPTGCTLSDNRKPHIYRLAQQYDI 244

Query: 364 VVIADEVY 371
           ++I D+ Y
Sbjct: 245 IIIEDDPY 252

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 61/125 (48%), Gaps = 7/125 (5%)

Query: 250 EDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSG- 308
           +++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+ + +   L  + G 
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSDGS 147

Query: 309 WSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIAD 368
           +  + E + T++K    N+    ++ V +PGNPTGA +    I ++ +       +V+ D
Sbjct: 148 FQMDTEAVLTILK----NDSLIKLMFVTSPGNPTGAKIKTSLIEKVLQNWD--NGLVVVD 201

Query: 369 EVYQE 373
           E Y +
Sbjct: 202 EAYVD 206

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 313 PEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371
           PE++E ++ E      +P +L  I  G NPTG  L+ +   +I+ +A K+  ++I DE Y
Sbjct: 189 PEKLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPY 248

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 64/326 (19%), Positives = 126/326 (38%), Gaps = 65/326 (19%)

Query: 250 EDIFLTAGA-SAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLA--------LNNSQPLP 300
           E+I +T GA  A +  L+++   G E  V+ P     ++   +A        L N     
Sbjct: 99  ENILVTTGAIQALLESLMALIKPGDEVIVIEPFFDPYIHLIKIAGGVVKYVPLTNPNQGK 158

Query: 301 YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360
             + E + W  + E +     +      K  ++++ NP NP G V + + + ++  +   
Sbjct: 159 KRILEANDWILDRETLRAAFTD------KTKLMIINNPNNPLGKVFNRDELLEMATLCVN 212

Query: 361 YGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQ 420
            G  +IADEVY+   F     + +  +   + +         +  ++ S  K +    G 
Sbjct: 213 NGAYIIADEVYEFLQFTPNPLSRISNLSEAIAQ---------KTITIGSAGK-IFRVTGW 262

Query: 421 RGGYMELTGFSHEMRQVILKLASI----SLCPVVTGQALVDLMVRPPVEGEESFESDQSE 476
           R G+M       + R+++ K+ ++      C     Q    L ++  +E           
Sbjct: 263 RVGWM-----ISKNRELVEKVTAVHVRMGFCSPSISQVASGLGIQRALECGYFL------ 311

Query: 477 RNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYL---FPKIDVP-------------- 519
             S+  + + +   +Y+  + L G+   KPQGA ++   F K+ +P              
Sbjct: 312 --SMPNEFDRKFSIIYKALDYL-GVSYTKPQGAHFIITDFSKVKIPEDYQFPEYLKNRAR 368

Query: 520 -----FKAIQEAHHLELTPDEFYCKK 540
                +   QE   L L   EFYC++
Sbjct: 369 DFFISYWLTQEFCILLLPCSEFYCEE 394

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 66/136 (48%), Gaps = 15/136 (11%)

Query: 250 EDIFLTAGASAAV-TYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPL------PYY 302
           E++ +T GA+  + + L+ +   G E  V++  P +  Y + + L   + +      P  
Sbjct: 116 ENVTVTTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYISNIELCGGKVVYVPINPPKE 173

Query: 303 LDENSGWSTNPEEIETVVKEAIQNEIKP-TVLVVIN-PGNPTGAVLSPESIAQIFEVAAK 360
           LD  +   T  EE  T+  E  +  I P T  V+IN P NP G V + E +  +  +  K
Sbjct: 174 LDLRN---TRGEEW-TIDFEQFEKAITPKTKAVIINTPHNPIGKVFTREELTTLGNICVK 229

Query: 361 YGTVVIADEVYQENIF 376
           +  ++I+DEVY+   F
Sbjct: 230 HNVIIISDEVYEHLYF 245

>Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,
           443 aa] {ON} complement(37728..38465,38468..39061) [1332
           nt, 444 aa]
          Length = 443

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 98/432 (22%), Positives = 174/432 (40%), Gaps = 56/432 (12%)

Query: 159 IGNPQQLQQKPLTYYRQVLSLL-QYPELLNHNEQEL-VG------SKLFKIDAIKRAKSL 210
           I N   L Q PL    +VL L  Q+ +  N N+  L VG       K+  + AI +A+ +
Sbjct: 22  IRNVSTLTQIPLAPPDRVLGLTEQFVKDKNTNKVNLTVGIYKDGHGKVSTLPAITKAQEI 81

Query: 211 IKDIGGSVG---AYSSSQGVEGIRKSVADFITKRDG----GETAYPED--IFLTA----G 257
           I D+  ++    +Y    G    R +V +F+  RD     G+    ++   F+ +    G
Sbjct: 82  I-DLDDALNKNLSYLPISGCPNYRDNVLNFLF-RDSVPKYGDKLIADNRVSFIQSLSGTG 139

Query: 258 ASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIE 317
           A A  + LLS F       V IP P +P +     +N  + L YY   N G  T    +E
Sbjct: 140 AIAVASKLLSSFI---SDTVWIPNPSWPNHDNIFHMNGFKNLKYYSYYNDGKITIDRWLE 196

Query: 318 TVVKEAIQNEIKPTVLVVINPG--NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENI 375
           +   E   +  K    ++++    NPTG   + +   +I +   +   + I D  YQ   
Sbjct: 197 STETEVRSSNSKLPQSIILHACCHNPTGFDPTIDQWNEIIDTVYELDMIPIIDMAYQ--- 253

Query: 376 FPGTEFNSMKK---VLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELT---- 428
             G E  S+     +LRH   +   K     L    S +K + G  G+R G + +     
Sbjct: 254 --GLESGSLYDDAYLLRHCLDESRYKGWKHGLFLCQSFAKNM-GLYGERVGSLSIVVPPN 310

Query: 429 ------GFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQSERNSIHE 482
                     ++++++  + S    P   G  + +L++  P E    +  D    +SI  
Sbjct: 311 LEKAKLSIDSQLKKIVRGIYS---SPPGYGCRIANLVLSQP-ELRNQWHQDV---HSIVG 363

Query: 483 KLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVP-FKAIQEAHHLELTPDEFYCKKL 541
           +L      +Y+      G+     Q  M+ F ++D+   + +++ + + LT D       
Sbjct: 364 RLTNVRKQMYDKL-GWSGLVDSSQQHGMFYFTRLDIDQVQLLKDKYSIYLTSDGRLSLSG 422

Query: 542 LESTGICTVPGS 553
           +  + I  V GS
Sbjct: 423 INDSNIDYVCGS 434

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 70/147 (47%), Gaps = 20/147 (13%)

Query: 249 PEDIFLTAGASAAV-TYLLSIFCRGPETGVLIPIPQYPLYTATLA----------LNNSQ 297
           P ++ +T GA+ A+ + L+ +  +G E  V++  P +  Y + +           L+  +
Sbjct: 118 PSNVQVTTGANEAILSCLVGLLNQGDE--VIVFEPFFDQYISNIEIPGGKVTYVPLHPPK 175

Query: 298 PLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEV 357
            L   +   + W+ + +E+   +        K   L++  P NP G V + E + +I  +
Sbjct: 176 ELENRVTHGTEWTVDYDELRAAITP------KTKALILNTPHNPIGKVFTREELLEIGNI 229

Query: 358 AAKYGTVVIADEVYQENIFPGTEFNSM 384
             +   V+I+DEVY E+++  +EF  +
Sbjct: 230 CVENNVVIISDEVY-EHLYFTSEFTRI 255

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 74/184 (40%), Gaps = 33/184 (17%)

Query: 221 YSSSQGVEGIRKSVADFITKR-----DGGETAYPEDIFLTAGASAAVTYLLSIFCRGPET 275
           Y S  G   +R  +A+F  K             P+ + LT+GAS  +  +L +    P T
Sbjct: 49  YGSDNGSAWVRACIAEFSNKVFKLPVHSSAATRPDHLNLTSGASYGIMNIL-VQTTLPHT 107

Query: 276 G----VLIPIPQYPLY-------------TATLALNNSQPLPYY-----LDENSGWS--- 310
           G      I  P Y L              TA     +   L +      L ENS      
Sbjct: 108 GYTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKLFENSANGERE 167

Query: 311 -TNPEEIETVVKEAIQNEIKPTVLVVI-NPGNPTGAVLSPESIAQIFEVAAKYGTVVIAD 368
               E ++ +  +  Q ++   V+ ++    NPTGA+ S  S  ++ E+A KY  ++I+D
Sbjct: 168 QKTEESLDIINAQGGQKKVYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISD 227

Query: 369 EVYQ 372
           +VY 
Sbjct: 228 DVYD 231

>Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W
           (REAL)
          Length = 513

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 76/349 (21%), Positives = 131/349 (37%), Gaps = 70/349 (20%)

Query: 221 YSSSQGVEGIRKSVADFITKRD----GGETAYPEDIFLTAGASAAVTYLLSIFCRGPETG 276
           Y+ ++G+  +   V D + + +      ET    D+ L+ G++ ++  +    C    T 
Sbjct: 102 YAETKGLPPLLHFVKDMVCRINRPVFSDETESNWDVILSGGSNDSMFKVFETIC-DESTT 160

Query: 277 VLIPIPQYPLYTATLALNNSQPLPYYLD-----ENSG------------WSTNPEEIETV 319
           V+I    +    + +    ++ +P  +D     E  G            WST P      
Sbjct: 161 VMIEEFTFTPAMSNVEATGAKVIPIKMDLTFDRERQGIDVEDLTRLLDNWSTGP------ 214

Query: 320 VKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPG 378
                ++  KP VL  I  G NPTG  +      +I+++A K+  +++ D+ Y    FP 
Sbjct: 215 ----YKHLNKPKVLYTIATGQNPTGMSVPRWKREKIYQLAQKHDFLIVEDDPYGYMYFPS 270

Query: 379 --------TEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSGEC-------GQRGG 423
                     ++S    +     D   K       +L + ++ +  E        G R  
Sbjct: 271 YNPQNPLENPYDSSDLTIERYLNDFLMK----SFLTLDTDARVIRLETFSKIFAPGLRLS 326

Query: 424 YMELTGFSHEMRQVILKLASISL-CPVVTGQALVDLMVRPPVEGEES---------FESD 473
           ++    F   + Q IL LA I+   P  T QA+V   ++   E E S         FES 
Sbjct: 327 FIVANKF---LLQKILDLADITTRAPSGTSQAIVYSTIKAMAESEMSSSVSFRDAMFESW 383

Query: 474 QSERNSIHEKLNTRA----MTLYETFNSLEG-IECQKPQGAMYLFPKID 517
                 I  K N R       LYET +   G     +P   M++  K+D
Sbjct: 384 IKWIMQIASKYNHRKNVTLKALYETESYQAGHFTVMEPSAGMFIIIKLD 432

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 38.1 bits (87), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 63/124 (50%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPL--PYYLDENS 307
           +++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+ + +  P  + +NS
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDNS 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
            +  + E   T++K    N+    ++ V +PGNPTGA +    I +I +   + G VV+ 
Sbjct: 148 -FQMDTEAALTILK----NDPLIKLIFVTSPGNPTGAKIKTCLIEKILQ-NWENGLVVV- 200

Query: 368 DEVY 371
           DE Y
Sbjct: 201 DEAY 204

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 38.1 bits (87), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 60/124 (48%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPL--PYYLDENS 307
           +++ L  G+  ++  ++   C   +  +L   P Y +Y+    +N+ + L  P   ++NS
Sbjct: 87  DNLCLGVGSDESIDAVIRACCVPGKEKILTLPPTYSMYSVCANINDVEVLECPLIYEDNS 146

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
               + + I  +  + +   IK  ++ + +PGNPTGA +    I +I E  +  G  V+ 
Sbjct: 147 FQPDSQKVISILSSDPL---IK--LVFLTSPGNPTGAKIDSNIIIKILE--SWDGGFVVV 199

Query: 368 DEVY 371
           DE Y
Sbjct: 200 DEAY 203

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 38.5 bits (88), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 56/125 (44%), Gaps = 8/125 (6%)

Query: 251 DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPL---PYYLDENS 307
           DI  T G++ A    L IFC   +T +L    +   Y++++   ++Q L   P  +D   
Sbjct: 133 DIITTTGSTQAWDASLRIFCNKGDTVLL----EEFTYSSSVEAADAQGLNCIPVPMDNQG 188

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVI 366
                 EE+ +   +       P +L  I  G NPTG  LS      I+ +A KY  +++
Sbjct: 189 IIPEKLEEMLSNWTDRYPGIPMPKLLYTIPTGQNPTGCTLSECRKPCIYRLAQKYDILIV 248

Query: 367 ADEVY 371
            D+ Y
Sbjct: 249 EDDPY 253

>ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137W ARO9 Aromatic aminotransferase catalyzes the
           first step of tryptophan phenylalanine and tyrosine
           catabolism
          Length = 504

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP 377
           KP  L  +  G NPTG  LSP    +I+E+A K+  +++ D+ Y    FP
Sbjct: 207 KPKALYTVATGQNPTGMTLSPTKRRRIYEIAQKHDFLIVEDDPYGYLFFP 256

>TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2.102
           YHR137W
          Length = 503

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP 377
           KP +L  I  G NPTG  LS E   +I+E+  K+  +++ D+ Y   +FP
Sbjct: 208 KPKMLYTIATGQNPTGMTLSMEKRRKIYEICQKHDIIILEDDPYGYLLFP 257

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 59/127 (46%), Gaps = 15/127 (11%)

Query: 251 DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ-----PLPYYLDE 305
           D+  TAG + A    L +FC     G +I + +   ++++LA   +Q     P+P   D 
Sbjct: 134 DVVATAGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSSLAAAEAQGIIAFPVPIDAD- 188

Query: 306 NSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTV 364
                  PE++  ++        KP +L  I  G NPTG  ++      I+++A K+  +
Sbjct: 189 ----GIIPEKLAKIMDNWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFL 244

Query: 365 VIADEVY 371
           ++ DE Y
Sbjct: 245 IVEDEPY 251

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 37.7 bits (86), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 67/152 (44%), Gaps = 12/152 (7%)

Query: 221 YSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIP 280
           Y + +G + +R  +A        G     +++ +T GA  A  +LL     G    V+  
Sbjct: 56  YGAIKGSKDLRTLIAGLY-----GVQFSADNVLVTNGAIGA-NFLLYYTLVGKGDHVICV 109

Query: 281 IPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGN 340
            P Y    +   +  ++     L E   +  N + +    K+AI++  K  ++++ NP N
Sbjct: 110 HPTYSQLYSVPKMFGAEVTLLELSEKDSFLPNLDTL----KKAIKSNTK--LIIINNPNN 163

Query: 341 PTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ 372
           P G V+S E +  I E+  +    +  DEVY+
Sbjct: 164 PLGCVISDELLTSICELCKEKNVYLHCDEVYR 195

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 37.4 bits (85), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 69/153 (45%), Gaps = 12/153 (7%)

Query: 220 AYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLI 279
           +Y + +G + +R S+A        G     +DI LT GA  A  +L      G    V+ 
Sbjct: 54  SYGAIKGSDELRTSIASLY-----GPDFTMDDILLTNGAIGA-NFLAFYTLVGAGDHVIC 107

Query: 280 PIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339
             P Y    +   +  ++     L +   +  N + +++++K   +      ++++ NP 
Sbjct: 108 VEPTYSQLYSVPEMFGAEVDLLTLKKEDDFLPNLQTLKSMIKNNTK------LIIINNPN 161

Query: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ 372
           NP G+V+  + + QI ++  +    + +DEVY+
Sbjct: 162 NPLGSVIKKDLLKQICKLCEENDIYLHSDEVYR 194

>Kwal_33.14582 s33 complement(728649..730226) [1578 bp, 525 aa] {ON}
           YHR137W (ARO9) - aromatic amino acid aminotransferase II
           [contig 102] FULL
          Length = 525

 Score = 37.4 bits (85), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 75/170 (44%), Gaps = 20/170 (11%)

Query: 221 YSSSQGVEGIRKSVADFITKRDGGETAYPE-DIFLTAGASAAVTYLLSIFCRGPETGVLI 279
           Y++++G+  +     DFI+  +    AY + D+ L  G S ++  +    C   E  VL+
Sbjct: 126 YTATRGMPPLIDFCKDFISYVN--PPAYADWDLTLANGTSDSLFKIFETLCDQGE-AVLV 182

Query: 280 PIPQYPLYTATLALNNSQPLPYYLDENSGWSTNP-----------EEIETVVKEAIQNEI 328
               +    + +      P+P  L+     S +P           E ++  V+    +  
Sbjct: 183 EEFTFAPTLSNIRAAGGVPVPVKLN----ISADPQVQGIDIGHLTELLDNWVQGPYAHLS 238

Query: 329 KPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP 377
           +P +L  I  G NPTG  LS E   QI+++A K+  +++ D+ Y    FP
Sbjct: 239 RPKLLYTIPTGQNPTGMTLSREKRQQIYDLAEKHDFIIVEDDPYGYLKFP 288

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 56/122 (45%), Gaps = 5/122 (4%)

Query: 251 DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWS 310
           D+  TAG +      L +FC     G +I + +   ++++LA   +Q +  +        
Sbjct: 134 DVLATAGNTNGWESTLRVFCN---RGDVI-LAEAHSFSSSLASAEAQGVITFPIPIDAGG 189

Query: 311 TNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADE 369
             PE++  ++        KP +L  I  G NPTG  ++      I+++A K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTAGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVEDE 249

Query: 370 VY 371
            Y
Sbjct: 250 PY 251

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 61/129 (47%), Gaps = 16/129 (12%)

Query: 251 DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALN----NSQPLPYYLDEN 306
           D+  T G ++A    L +FC   +T   I   +Y   ++ +A       + P+P  LDEN
Sbjct: 132 DVLATVGNTSAWESTLRVFCNRGDT---ILAEEYTFSSSLVAAEAQGVRAYPVP--LDEN 186

Query: 307 SGWSTNPEEIETVVK--EAIQNEI-KPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYG 362
                 PE +  ++   E   + + +P +L  +  G NPTG  LS +    ++ +A ++ 
Sbjct: 187 G---MVPERLGELLDNWERWHDGVPRPKLLYTVPTGQNPTGTCLSNDRRQAVYRLAQQHD 243

Query: 363 TVVIADEVY 371
            +++ DE Y
Sbjct: 244 LLIVEDEPY 252

>SAKL0D14630g Chr4 (1206755..1207567) [813 bp, 270 aa] {ON} highly
           similar to uniprot|Q08873 Saccharomyces cerevisiae
           YOR367W SCP1
          Length = 270

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 9/65 (13%)

Query: 349 ESIAQIFEVAAKYGTVVIADEVYQ-----ENIFPGTEFNSMKKVLRHLQRDHPGKFDNV- 402
           E I+Q  E A KYG  V  DE++Q     E+  P   + S+K + R+  + HP KF  + 
Sbjct: 161 EQISQFLEFARKYG--VPDDELFQTLDLYEDKDPAIVYQSLKSLSRYANKKHPDKFPVIG 218

Query: 403 -QLAS 406
            QLA+
Sbjct: 219 PQLAT 223

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (69%)

Query: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ 372
           NPTGA+ S  S  ++ E+A KY  ++I+D+VY 
Sbjct: 198 NPTGAIYSRSSRLKLLELARKYDILIISDDVYD 230

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 60/124 (48%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ--PLPYYLDENS 307
           E++ L  G+  ++  ++   C   +  ++   P Y +Y+   ++N+ +    P    +NS
Sbjct: 85  ENLCLGVGSDESIDAIIRATCVPGKEKIMAMPPTYGMYSVCASVNDVEIVKCPLVTSDNS 144

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
                   ++T+ K+ +   IK  ++ + +PGNPTGA +    I +I +   +   +++ 
Sbjct: 145 FQVDTEAVLDTLKKDPL---IK--LVFITSPGNPTGAKIETSRIEKILQNWDQ--GILVV 197

Query: 368 DEVY 371
           DE Y
Sbjct: 198 DEAY 201

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 59/124 (47%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPL--PYYLDENS 307
           E+  L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+   +  P   ++NS
Sbjct: 87  ENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLITEDNS 146

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367
            +  +  EI  +    + N+    ++ + +PGNPTGA +  + I  + +   +   +VI 
Sbjct: 147 -FQIDATEILNI----LANDPLIKLVFITSPGNPTGAKIEIDRIEYLLKNWDQ--GLVIV 199

Query: 368 DEVY 371
           DE Y
Sbjct: 200 DEAY 203

>YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromatic
           aminotransferase II, catalyzes the first step of
           tryptophan, phenylalanine, and tyrosine catabolism
          Length = 513

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 90/436 (20%), Positives = 161/436 (36%), Gaps = 90/436 (20%)

Query: 221 YSSSQGVEGIRKSVADFITKRD----GGETAYPEDIFLTAGASAAVTYLLSIFCRGPETG 276
           Y+ ++G+  +   V DF+++ +      ET    D+ L+ G++ ++  +    C    T 
Sbjct: 102 YAETKGLPPLLHFVKDFVSRINRPAFSDETESNWDVILSGGSNDSMFKVFETIC-DESTT 160

Query: 277 VLIPIPQYPLYTATLALNNSQPLPYYLD-----ENSG------------WSTNPEEIETV 319
           V+I    +    + +    ++ +P  ++     E+ G            WST P      
Sbjct: 161 VMIEEFTFTPAMSNVEATGAKVIPIKMNLTFDRESQGIDVEYLTQLLDNWSTGP------ 214

Query: 320 VKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ------ 372
                ++  KP VL  I  G NPTG  +      +I+++A ++  +++ D+ Y       
Sbjct: 215 ----YKDLNKPRVLYTIATGQNPTGMSVPQWKREKIYQLAQRHDFLIVEDDPYGYLYFPS 270

Query: 373 -------ENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQRGGYM 425
                  EN +  ++  + + +   L +       + ++  L + SK  +   G R  ++
Sbjct: 271 YNPQEPLENPYHSSDLTTERYLNDFLMKSFLTLDTDARVIRLETFSKIFA--PGLRLSFI 328

Query: 426 ELTGFSHEMRQVILKLASISL-CPVVTGQALVDLMVRPPVEG---------EESFESDQS 475
               F   + Q IL LA I+   P  T QA+V   ++   E          E  FE    
Sbjct: 329 VANKF---LLQKILDLADITTRAPSGTSQAIVYSTIKAMAESNLSSSLSMKEAMFEGWIR 385

Query: 476 ERNSIHEKLNTRA----MTLYETFNSLEG-IECQKPQGAMYLFPKI-----DVPFKAIQE 525
               I  K N R       LYET +   G     +P   M++  KI     D P    Q+
Sbjct: 386 WIMQIASKYNHRKNLTLKALYETESYQAGQFTVMEPSAGMFIIIKINWGNFDRPDDLPQQ 445

Query: 526 AHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIF--- 582
              L+         K L   G+  V G      P      + FL   + + +  +     
Sbjct: 446 MDILD---------KFLLKNGVKVVLGYKMAVCPNYSKQNSDFLRLTIAYARDDDQLIEA 496

Query: 583 -------HKEFFDQYR 591
                   KEFFD Y+
Sbjct: 497 SKRIGSGIKEFFDNYK 512

>NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON}
           Anc_2.102
          Length = 510

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP 377
           KP +L  I+ G NP G  LS E   +I+++A ++  +++ D+ Y    FP
Sbjct: 223 KPKILYTISTGQNPMGMTLSMEKREKIYQIAQQHDLIILEDDPYTYLTFP 272

>TBLA0A10320 Chr1 (2542498..2544363) [1866 bp, 621 aa] {ON}
           Anc_5.287 YHR045W
          Length = 621

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 8/60 (13%)

Query: 383 SMKKVLRHLQRDHPGKFDNVQL--ASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILK 440
           +MKK++ H+Q+ H   FDN +L  A+L   S G+  +CG+R      + F+  +R + L+
Sbjct: 403 NMKKIIDHIQKSHTNIFDNFRLNWATLL-FSYGIFSKCGERQ-----SRFTDNLRCIYLE 456

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 63/144 (43%), Gaps = 16/144 (11%)

Query: 250 EDIFLTAGASAAVTYLLSIFCR-GPETGVLIP-----IPQYPLYTATLALNNSQP---LP 300
           E++ +T GA+  +   L+     G E  V  P     IP   L    +     +P   L 
Sbjct: 130 ENVQVTTGANEGIFACLAGLVNPGDEVIVFEPFFDQYIPNIELLGGVVRYVPIRPPAELS 189

Query: 301 YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360
             + E + W  + + +   + E      K   +++ +P NP G V + E + ++  +  +
Sbjct: 190 KRVTEGTEWVIDYDMLRQTINE------KTKAVIINSPHNPIGKVFTREELLKLGNICVE 243

Query: 361 YGTVVIADEVYQENIFPGTEFNSM 384
            G  +I+DEVY E+++   EF  +
Sbjct: 244 KGIYIISDEVY-EHLYFTDEFTRI 266

>KLTH0B06270g Chr2 (508642..510219) [1578 bp, 525 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 525

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 61/147 (41%), Gaps = 36/147 (24%)

Query: 247 AYPE-DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLAL-----NNSQPLP 300
           AY E D+ L  G+S A   ++   C   ++ V + + ++  ++ TLA+       + PL 
Sbjct: 150 AYNEWDVTLANGSSDATFKIIETLC---DSSVTVLVEEF-TFSPTLAIITAAGGTTVPLK 205

Query: 301 ---------------YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGA 344
                          Y  D    WS  P            +  KP +L  I  G NPTG 
Sbjct: 206 LDITADPDVQGINVEYLTDLLDNWSQGPN----------AHLSKPKLLYTIPTGQNPTGM 255

Query: 345 VLSPESIAQIFEVAAKYGTVVIADEVY 371
            LS E   QI+ +A K+  ++I D+ Y
Sbjct: 256 TLSFEKRKQIYALAEKHDFIIIEDDPY 282

>CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137w ARO9 aromatic amino acid aminotransferase II
          Length = 537

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 29/136 (21%), Positives = 62/136 (45%), Gaps = 9/136 (6%)

Query: 251 DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWS 310
           D+ L++G+  ++      FC    T ++      P+ +   A   ++ +P  ++     S
Sbjct: 156 DVLLSSGSCDSMFKFFECFCDEKSTVLMEEFTFTPVISHVKA-TGAECIPLKMNLTKDPS 214

Query: 311 TNPEEIETVVK-------EAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYG 362
           T   +++ + +          ++  KP +L  I  G NPTG  +  E+  +I+E+A K+ 
Sbjct: 215 TQGIDVDYLTQLLDNWSSGPYKHLNKPRILYTICTGQNPTGVTIPMENRRKIYELAHKHN 274

Query: 363 TVVIADEVYQENIFPG 378
            +++ D+ Y    FP 
Sbjct: 275 FLILEDDPYGYLSFPS 290

>KAFR0B00790 Chr2 (152018..152443) [426 bp, 141 aa] {ON} Anc_5.329
           YDR308C
          Length = 141

 Score = 33.1 bits (74), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 31/48 (64%), Gaps = 2/48 (4%)

Query: 186 LNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQGVEGIRKS 233
           +N  +Q+LV  +  K++AIK+ +SL+KD+ G +  + S  G+   RKS
Sbjct: 94  INSLQQKLVDVEEQKLEAIKKKESLLKDVNGLIETFVS--GIAESRKS 139

>TDEL0F00900 Chr6 complement(153488..154969) [1482 bp, 493 aa] {ON}
           Anc_2.102 YHR137W
          Length = 493

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 63/148 (42%), Gaps = 37/148 (25%)

Query: 247 AYPE-DIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLPYYLDE 305
           AY E D+ L+ G+S ++  +   FC    T ++        +T +  ++N Q        
Sbjct: 114 AYDEWDVLLSNGSSDSMFKIFETFCDESTTVLM------EEFTFSPVISNVQ-------- 159

Query: 306 NSGWSTNPEEIETVVKEAIQN-EI--------------------KPTVLVVINPG-NPTG 343
           N+G +  P ++E     A Q  +I                    KP ++  I  G NPTG
Sbjct: 160 NTGATCVPIKMELTTDPAKQGIDIAYLTHLLENWTTIPQYSHLNKPKMIYTIATGQNPTG 219

Query: 344 AVLSPESIAQIFEVAAKYGTVVIADEVY 371
             LS E   QI+ +A K+  +++ D+ Y
Sbjct: 220 MTLSMEKRRQIYALAQKHDLLILEDDPY 247

>Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W
           (REAL)
          Length = 517

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 77/190 (40%), Gaps = 45/190 (23%)

Query: 221 YSSSQGVEGIRKSVADFITKRD----GGETAYPEDIFLTAGASAAVTYLLSIFCRGPETG 276
           Y+ S+G   + + V D +++ +      E     D+ L+ G++ ++  +    C    T 
Sbjct: 102 YAESKGTPPLLRFVKDMVSRINRPVFSDEMQSNWDVILSGGSNDSMFKVFETIC-DESTT 160

Query: 277 VLIPIPQYPLYTATLALNNSQP---------LPYYLDENS-------------GWSTNPE 314
           VLI       +T T A++N +          +   LD +S              WST P 
Sbjct: 161 VLIE-----EFTFTPAMSNVEATGAKVVPIKINLTLDRDSQGIDVDHLTQLLDNWSTGP- 214

Query: 315 EIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQE 373
                     ++  KP VL  I  G NPTG  +      +I+ +A K+  +++ D+ Y  
Sbjct: 215 ---------YKHLAKPRVLYTIATGQNPTGMSVPQWKREKIYRLAQKHDFLIVEDDPYGY 265

Query: 374 NIFPGTEFNS 383
             FP   FNS
Sbjct: 266 LYFP--PFNS 273

>KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.102
           YHR137W
          Length = 523

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371
           KPT++  +  G NPTG  LS E   QI+ +A ++  +++ D+ Y
Sbjct: 241 KPTLMYTVVTGQNPTGVSLSYEKRRQIYALAQRHNFIIVEDDPY 284

>Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W
           (AAT1) - aspartate aminotransferase, mitochondrial
           [contig 55] FULL
          Length = 422

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 47/117 (40%), Gaps = 4/117 (3%)

Query: 257 GASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEI 316
           GA A  + LLS+F       V IP P +P +      N  + + YY     G       I
Sbjct: 123 GALAVASKLLSLFM---SRSVWIPNPSWPNHANVFQNNGFKEINYYSYYKDGSLDIEGWI 179

Query: 317 ETVVKEAIQNEIKPTVLVV-INPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ 372
           + + K A +    P  +V+     NPTG   S E   +I +   +   + I D  YQ
Sbjct: 180 QDLEKHAQKEGEDPQCIVLHACCHNPTGIDPSKEQWQRILDKIHELNLIPIIDMAYQ 236

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 29/53 (54%)

Query: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQ 392
           NP+GA  S E   ++ ++A +Y  ++I+D+VY    F G   +S  +   H +
Sbjct: 200 NPSGATYSQECRLKLLDLARRYDILIISDDVYDLLGFHGQRTDSGIRKPSHFR 252

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 26/48 (54%)

Query: 329 KPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIF 376
           K   +++  P NP G V +   + ++ ++  K   V+I+DEVY+   F
Sbjct: 189 KTKAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYEHLYF 236

>Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137W
           (REAL)
          Length = 560

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 33/170 (19%), Positives = 76/170 (44%), Gaps = 15/170 (8%)

Query: 221 YSSSQGVEGIRKSVADFITKRD----GGETAYPEDIFLTAGASAAVTYLLSIFCRGPETG 276
           Y+ ++G+  + +   D + + +      ET    D+ L+ G++ ++  +   FC    T 
Sbjct: 150 YAETKGMPPLLQFTKDMVARINRPAFSDETDSNWDVILSGGSNDSMYKVFETFC-DESTT 208

Query: 277 VLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEI-------- 328
           V+I    +    + +    +  +P  ++ ++   T   +++  + + ++N          
Sbjct: 209 VMIEEFTFTPAVSNVEATGATVVPIKINLSADRETQSVDVD-YLSQLLENWSTGPYRHLN 267

Query: 329 KPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP 377
           KP VL  I  G NPTG  +      +I+E+A ++  +++ D+ Y    FP
Sbjct: 268 KPRVLYTIATGQNPTGMSVPQWKREKIYELAQRHDFLIVEDDPYGYLYFP 317

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 339 GNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ 372
            NP+G   S E+  ++ ++A KY  ++IAD+VY 
Sbjct: 205 ANPSGMSFSLETKKKLLDLARKYDMLIIADDVYD 238

>KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 445

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 62/149 (41%), Gaps = 30/149 (20%)

Query: 249 PEDIFLTAGASAAVTYLLSIFCRGPETG----VLIPIPQYPLYTATL----------ALN 294
           PE I LTAGAS  V  +L      P TG      I  P Y L   T           A++
Sbjct: 84  PEHINLTAGASYGVMNILEQTTL-PHTGYTRQAFIVSPTYFLINETFIDAGFGGKLTAID 142

Query: 295 N-----------SQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVI-NPGNPT 342
                        Q L Y+   +S  + N  E++ +       ++   V+ ++    NP 
Sbjct: 143 ELGHGKIDFDTLQQKLEYF---DSISNDNSSELQLITAPNANKKVYRYVIYLVPTYSNPG 199

Query: 343 GAVLSPESIAQIFEVAAKYGTVVIADEVY 371
           G   S E+  ++ E+A K+  ++++D+VY
Sbjct: 200 GQTYSLETRVKLIELARKHDMLIVSDDVY 228

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
           YER152C (REAL)
          Length = 450

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ 372
           NP+G   S E+  ++ E+A KY  +VI D+VY 
Sbjct: 203 NPSGNTYSLETRRRLIEIARKYDMLVITDDVYD 235

>Suva_15.383 Chr15 (671786..674143) [2358 bp, 785 aa] {ON} YHR182W
           (REAL)
          Length = 785

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 6/52 (11%)

Query: 189 NEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQGVEGIRKSVADFITK 240
           N+QE  G      DA+ +AK    D+ GS   Y     V  I+ S++D+I K
Sbjct: 309 NQQERNG------DAVTKAKKSYGDLTGSDNVYDEKPNVSSIKTSISDWIRK 354

>ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {ON}
           similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 450

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 22/32 (68%)

Query: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371
           NP+G   + E+  ++ E+A KY  +++AD+VY
Sbjct: 205 NPSGQTYTLETRRRLIEIARKYDMLILADDVY 236

>YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON}
           Protein with 2-aminoadipate transaminase activity;
           shares amino acid similarity with the aminotransferases
           Aro8p and Aro9p; YER152C is not an essential gene
          Length = 443

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 339 GNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQ--ENIFPGTEFNSMKKVLRHLQR 393
            NP+G   S E+  ++ ++A KY  ++I D+VY   +   P  E  S    + H+ R
Sbjct: 195 ANPSGNTYSLETRRRLIDIARKYDMLIITDDVYDILDYTTPSDELPSPPLRMVHIDR 251

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,972,167
Number of extensions: 2685295
Number of successful extensions: 7618
Number of sequences better than 10.0: 147
Number of HSP's gapped: 7791
Number of HSP's successfully gapped: 147
Length of query: 592
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 477
Effective length of database: 40,294,809
Effective search space: 19220623893
Effective search space used: 19220623893
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)