Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_10.1728.261ON61459730450.0
Skud_12.1568.261ON61259726940.0
YLR088W (GAA1)8.261ON61459826720.0
Smik_12.1478.261ON61359726460.0
SAKL0H17050g8.261ON58459718600.0
TDEL0F038808.261ON57959618260.0
ZYRO0C01672g8.261ON56959718050.0
NCAS0B038608.261ON58359617930.0
TBLA0F030808.261ON58359817690.0
AGR087C8.261ON57759717620.0
CAGL0L12232g8.261ON59159917570.0
Kpol_543.378.261ON57859517370.0
NDAI0J013908.261ON58360017130.0
Ecym_43098.261ON57759717070.0
KLLA0F19118g8.261ON57859816890.0
KLTH0G13706g8.261ON58459716870.0
Kwal_56.238048.261ON57859716850.0
KAFR0B055508.261ON55558516800.0
KNAG0H032508.261ON58560016520.0
TPHA0A018208.261ON58159716000.0
SAKL0H14564g8.366ON63678707.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_10.172
         (614 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088...  1177   0.0  
Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088...  1042   0.0  
YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subun...  1033   0.0  
Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088...  1023   0.0  
SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]...   721   0.0  
TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.2...   707   0.0  
ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {...   699   0.0  
NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {O...   695   0.0  
TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {O...   686   0.0  
AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON} S...   683   0.0  
CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON} sim...   681   0.0  
Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON} (82589..8...   673   0.0  
NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {...   664   0.0  
Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}...   662   0.0  
KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} simi...   655   0.0  
KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]...   654   0.0  
Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {...   653   0.0  
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...   651   0.0  
KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {O...   640   0.0  
TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {O...   620   0.0  
SAKL0H14564g Chr8 (1265769..1267679) [1911 bp, 636 aa] {ON} simi...    32   7.0  

>Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088W
           (REAL)
          Length = 614

 Score = 1177 bits (3045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/597 (96%), Positives = 577/597 (96%)

Query: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP
Sbjct: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240
           PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV
Sbjct: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240

Query: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300
           AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI
Sbjct: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS
Sbjct: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 AVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAGL 420
           AVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAGL
Sbjct: 361 AVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAGL 420

Query: 421 LMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF 480
           LMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF
Sbjct: 421 LMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF 480

Query: 481 PMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTXXXXXXXXXXXXXXXX 540
           PMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGT                
Sbjct: 481 PMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTLEKNQQRQKLKNLLLL 540

Query: 541 XXXXPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLILA 597
               PFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLILA
Sbjct: 541 ILTNPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLILA 597

>Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088W
           (REAL)
          Length = 612

 Score = 1042 bits (2694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/597 (84%), Positives = 543/597 (90%), Gaps = 2/597 (0%)

Query: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           MALLEKLHRR+VDMGLVPR+IALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRE+EWN+LRGYRSQIEE  NMTS+ERNN MGSWLQEFGTKTAIYE++QYGETL
Sbjct: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGVMHAPRGDGTEAMVLAIPWFNS+ EFNVGGA+LGVSLARFFSRWPVWSKNIIVVFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240
           P AALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVE+SYDGLNGELPNLDLVN+
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300
           AISI EHEGMKVSLHGLPY+QL +NDF+SRLKIL LGIRDWALSGVKNPHGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS
Sbjct: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 AVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAGL 420
           AVA SVAFA+SSLNAFINN YASISLFSEYNLVA+LVWFI++VVSF+ISQ+FL V   GL
Sbjct: 361 AVAFSVAFAISSLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVGL 420

Query: 421 LMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF 480
           LMTISLA CFLP+ LS KVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIG+LAF
Sbjct: 421 LMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSLAF 480

Query: 481 PMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTXXXXXXXXXXXXXXXX 540
           PMTFI+TI V +  E E GT+S+ S+KTE  D+  L +H+ +                  
Sbjct: 481 PMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDD--LFEHHGDTVLEKAKKRQQLKNLLLL 538

Query: 541 XXXXPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLILA 597
               PFISIT+F L+FD+EF GFDI+NKL+SAW+DLKCW+WF+LC+GWLPCWLLILA
Sbjct: 539 VLTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILA 595

>YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subunit
           of the GPI (glycosylphosphatidylinositol):protein
           transamidase complex, removes the GPI-anchoring signal
           and attaches GPI to proteins in the ER
          Length = 614

 Score = 1033 bits (2672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/598 (83%), Positives = 543/598 (90%), Gaps = 2/598 (0%)

Query: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           MALLEKLHRR+VDMGLVPR+IALLPVIS LCALFGFISIAILPMDGQYRRTYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRE+EWNILRGYRSQI+E VNMTS ERNNLMGSWLQEFGTKTAIYENEQYGETL
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGVMHAPRGDGTEAMVLA+PWFNS+ EFN+GGA+LGVSLARFFSRWPVWSKNIIVVFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240
           P AALRSWVEAYHTSLDLTGGSIEAAVVLDYSS EDFFEYVE+SYDGLNGELPNLDLVN+
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300
           AISI EHEGMKVSLHGLP +QL +N+F+SRLKILCLGIRDWALSGVK PHGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300

Query: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           QSVTLKAHG+ GHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS
Sbjct: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 AVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAGL 420
           AVALS+AFA+SSLNAFINN YA+ISLFSEYNLVA+LVWF+++V+SFV+SQ FL +  +GL
Sbjct: 361 AVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSGL 420

Query: 421 LMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF 480
           LMTIS+A CFLP+ LS K+HISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF
Sbjct: 421 LMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF 480

Query: 481 PMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGT-XXXXXXXXXXXXXXX 539
           PMTF+KTI VE  +E E  T+S+  IKTEP DE +L +++ + T                
Sbjct: 481 PMTFVKTI-VESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNLVL 539

Query: 540 XXXXXPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLILA 597
                PFISIT+FGL FDDEF GFDIINKLVSAW+DLKCWSWF+LC+GWLPCWLLILA
Sbjct: 540 LILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILA 597

>Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088W
           (REAL)
          Length = 613

 Score = 1023 bits (2646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/597 (82%), Positives = 539/597 (90%), Gaps = 1/597 (0%)

Query: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           MALLEKLHRR+VDMGLVPR+IA LPV+S +CALFGFISIAILPMDGQYRRTYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRE+EWNILRGYRSQIEE VNMTS ERNN+MGSWLQEFGTKTAIYENEQYGETL
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGVMHAPRGDGTEAMVLA+PWFNS+ +FNVGGA+LGVSLARFFSRWPVWSKNII+VFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180

Query: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240
           P AALRSWVEAYHTSLDLTGGSIEAAVV+DYSSAEDFFEYVE+SYDGLNGELPNLDLVNV
Sbjct: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240

Query: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300
           AISI EHEGMKVSLHGLP +QL  N+++SRLK+LCLGIRDWAL+GVKNPHGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300

Query: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           QSVTLKAHG+ GHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS
Sbjct: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 AVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAGL 420
           AVALSVAFA+SSLNAFINN YASIS+FSEYNLVA+LVWFI++V+SFV+SQ+FL +  AGL
Sbjct: 361 AVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAGL 420

Query: 421 LMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF 480
           LM IS+  CFLP+ LS KVHISEPLSYRLKNVAFLYFSLV TSLLMINFAMALLIGTLAF
Sbjct: 421 LMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTLAF 480

Query: 481 PMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTXXXXXXXXXXXXXXXX 540
           PMT +KTI +E   E E   +  ISIKTEP +ET+L ++Y++                  
Sbjct: 481 PMTLVKTI-IESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQELKNLLLL 539

Query: 541 XXXXPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLILA 597
               PFISIT+FG  FDDEFQGFD+INKLVSAW+DLKCWSWF+LC+GWLPCWLL+LA
Sbjct: 540 VLTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLA 596

>SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/597 (59%), Positives = 443/597 (74%), Gaps = 41/597 (6%)

Query: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAI-LPMDGQYRRTYISENALM 59
           MAL+EKLHRR +DMGL+P+ IALLP +S  CA+ G   +A+ +P DGQ+RRTYISENALM
Sbjct: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60

Query: 60  PSQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGET 119
           PSQAYSYFRETEWN+LRGYR+QIE     ++ ERN  + SWLQ+FG KTAIY NE+YGET
Sbjct: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120

Query: 120 LYGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSE 179
           LYG++HAPRGDGTEAMVLA PW+NSE ++N GG +L VSL+RFFSRWPVWSKNII+V SE
Sbjct: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180

Query: 180 NPHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVN 239
           +P AALRSWVEAYHTSLDLTGGSIEAAVV+D+  + DFF+YVE+ +DGLNGELPNLDLVN
Sbjct: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240

Query: 240 VAISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWR 299
           VA+ I EHEGMKVSLHG+  E+LG NDFFSR+K + LG+++ ALSG+K  HGNE FSGWR
Sbjct: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300

Query: 300 IQSVTLKAHGHGG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           I SVTLKA G  G  DITTFGRIPEA+FRS+NNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360

Query: 359 PSAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPA 418
           P+AVALSV+FA++SLN  +NN+Y S+ L S YN+ A+L + +A+ VSF+ +Q FL     
Sbjct: 361 PAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420

Query: 419 GLLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478
            LL+++++ +  +PI  + +V I  P SYRLK+ A+LYFS+V TSLL++NF++A  +G L
Sbjct: 421 ELLLSLNVLLLLMPIIFT-RVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCL 479

Query: 479 AFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTXXXXXXXXXXXXXX 538
           AFPMT ++T                    T  N   +L                      
Sbjct: 480 AFPMTLVRT--------------------TSGNLRARLKN------------------CV 501

Query: 539 XXXXXXPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLI 595
                 PFI+I +F +  D E QG  +   L SAW DL CW+WF++C+GWLP WLL+
Sbjct: 502 LLLISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKDLGCWTWFVICIGWLPSWLLV 558

>TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.261
           YLR088W
          Length = 579

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/596 (57%), Positives = 446/596 (74%), Gaps = 38/596 (6%)

Query: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           M+L+ KLHRRV+D+GLVP+++A LP++S L A+     +A+LP++G+YRRTYISENAL+P
Sbjct: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRETEWN LRGYR+QIE   N TS ERN  +  WL+EFG KTAIY++E++G+TL
Sbjct: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGV+HA RGDGTEA++LA PW N++   N+ G S+G++L RFFSRWPVWSKNIIVV SEN
Sbjct: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180

Query: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240
           P  ++RSWVEAYHTSLDLTGGSIEAAVVLDY    D+F++VE+ YDGLNGE PNLDLVN+
Sbjct: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240

Query: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300
           AISI EHEGMKVSLHG+  +++ DNDF+SRL I+  GI++ ALSG++  +GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300

Query: 301 QSVTLKAHG-HGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           Q+VTLKAHG  G HD+TTFGRIPEAMFRSINNLLEKFHQSFFFY+LLAPR FVSISSYLP
Sbjct: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360

Query: 360 SAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAG 419
            AV LS++FA++SL+A INN+Y  + L S YNL+++ +W I+++  F I+QLFL      
Sbjct: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420

Query: 420 LLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLA 479
           +L++ S  I FLP+ L  K  I+EPL+YRLK+VAFL+FSLV TSLLM+NF +A  +G  A
Sbjct: 421 ILISFSALISFLPLLLKKK--IAEPLAYRLKSVAFLFFSLVLTSLLMVNFFLAFAMGLTA 478

Query: 480 FPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTXXXXXXXXXXXXXXX 539
           FPMT ++T ++           +N S++ +  +   L                       
Sbjct: 479 FPMTLVRTSSL-----------NNYSLRIKLKNSILL----------------------- 504

Query: 540 XXXXXPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLI 595
                PFI+  +F   F+ +  GF +  +  +AW +L CW+WF++C+GWLP WL++
Sbjct: 505 -LLSNPFIASYIFCQCFEPDLPGFTVFTEFATAWKELGCWTWFVICIGWLPSWLMV 559

>ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 569

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/597 (57%), Positives = 436/597 (73%), Gaps = 50/597 (8%)

Query: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           MAL+E+L RRVV+MGLVP++IALLP++S +CA+   + +A LP++GQ+RRTYISENALMP
Sbjct: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRE+EWNILRGYRSQIE    +++ ERN  M  WLQEFG KT+IY NE+YG++L
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180
           YG++HA RGDGTEA++LA+PW+N+E + NVGGASLG+SL+RFFSRWPVWSKNII+VFSEN
Sbjct: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180

Query: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240
           P+ ALRSWV+AYHTSLDLTGGSIEAA+VLDY    D+F+Y E+SY GLNGELPNLDLVN+
Sbjct: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240

Query: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300
           A+SI EHEG+ VSLHG+  E + D  ++SRLKIL  GI   A +G++   GNEAFSGWRI
Sbjct: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300

Query: 301 QSVTLKAHGH--GGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           QSVT+KAHG   G +DITTFGRIPEAMFRSINNLLEKFHQS+FFY+L+APR FVSISSYL
Sbjct: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360

Query: 359 PSAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPA 418
           P+ V L+  FA++SLN+ + N Y+++S +S YNL A+L W ++++VSFV SQLFL V   
Sbjct: 361 PATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420

Query: 419 GLLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478
            LL+   + +  LP+A      I+EPLS+RL+  AFLY SLV TSL+M+NF +A ++G L
Sbjct: 421 ILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGIL 480

Query: 479 AFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTXXXXXXXXXXXXXX 538
           AFPMT +             GT+ +++ K                               
Sbjct: 481 AFPMTAV-------------GTQRSLTFKK----------------------------YA 499

Query: 539 XXXXXXPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLI 595
                 P +S  +             ++ KL+SAW DL CW+WF+LCLGWLP W LI
Sbjct: 500 LLIISNPLVSFFIVK-------PHPQLLQKLISAWQDLGCWTWFVLCLGWLPSWTLI 549

>NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/596 (57%), Positives = 444/596 (74%), Gaps = 35/596 (5%)

Query: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           M L E++ R+V+  GL+P+VI+LLP+ISTLC + G + I ILP +GQYR TYISENALMP
Sbjct: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIVIIGILPFEGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRE+EWNI+RGYRSQI E  N ++ ERN +M  WLQ+FGTKT IY+N + G+TL
Sbjct: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGV HAPRGDGTE+MVLAIPWFN++ EFNV GA+LGV+LAR+FSRWPVWSKNIIVVF+EN
Sbjct: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180

Query: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240
           P AALRSWVEAYHTSLDLTGGSIEAA+VLD++   D F+Y+E+ YDGLNGELPNLD+VN+
Sbjct: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240

Query: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300
            +   EHEGMKVSLHG P++++ ++  FSRLKIL   I++ ALSGVK  +GNEAFSGWRI
Sbjct: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300

Query: 301 QSVTLKAHGHGG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           QSVTL+A G  G  D+T+FGR+PEAMFRSINNLLEKFHQSFFFYL+LAPR FVSISSYLP
Sbjct: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360

Query: 360 SAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAG 419
           S VA+S+ FA++SLN++ NN Y ++  FS Y L+++L WF+++VV+F++S +F+      
Sbjct: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420

Query: 420 LLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLA 479
           +L+ +++ IC  P  L G   + + LSYRL++ AFL+ SL+ TSLLM+NF +A  +G L+
Sbjct: 421 ILLAVNIIICLYPAILKGNAFMKDLLSYRLRSTAFLFMSLLLTSLLMVNFPLAFGMGLLS 480

Query: 480 FPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTXXXXXXXXXXXXXXX 539
           FPMT +KTI  + P    T  ++++ +                                 
Sbjct: 481 FPMTQVKTITSDTPTISRTRVKNSVLL--------------------------------- 507

Query: 540 XXXXXPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLI 595
                PFI+  +F LL D+EF G D+  +LVSA  +L CW+W +LC+GW   WLL+
Sbjct: 508 -LVSNPFIATWLFSLLCDNEFSGLDVFERLVSASRELGCWTWLVLCVGWWTPWLLV 562

>TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/598 (56%), Positives = 441/598 (73%), Gaps = 39/598 (6%)

Query: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           MALL  +HRRV+DMGLVP+++  LP++S   A  G +   +LPMDGQYR TYISENALMP
Sbjct: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRE+EWNILRGYR++I+   +M S +RN +M  WL+EFGTKT++Y N++YG+TL
Sbjct: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180
           YG+ +APRGDGTEA+VLAIPW+N++ EFN GGA+LG++L+RFFSRWP+WSKNIIVVFSEN
Sbjct: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180

Query: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240
           P  ALRSWV+AYH SLDLTGGSIEAA+V+DY S+ DFF+YVE+ Y G+NGELPNLDL+N+
Sbjct: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240

Query: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300
           AI I EHEGM+VSLHGLP E L  N++FSRL+ L LG +D  LSG+K  HGNEAFSG+RI
Sbjct: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300

Query: 301 QSVTLKAH---GHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357
           Q++TLKA     +  HDIT+FGRI EA FRS+NNLLEKFHQSFFFYL+LAP+ FVSISSY
Sbjct: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360

Query: 358 LPSAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLP 417
           LPSAV  SVAFA+SSL+++INN Y+++ +FSEYNL+A L++ I++  SF +++L L    
Sbjct: 361 LPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420

Query: 418 AGLLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGT 477
             LL+  S+ +  LP  L  +  I EPLSYRLK++AFLY SLV TSLL++NF++A  IG 
Sbjct: 421 PRLLVLGSVFLSVLPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIGI 480

Query: 478 LAFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTXXXXXXXXXXXXX 537
           L F MT +KTI +           S++ ++        L+                    
Sbjct: 481 LGFAMTAVKTITIH----------SSMRVRVRNTMHLLLSN------------------- 511

Query: 538 XXXXXXXPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLI 595
                  PF S+ +F  +FD +  G  I  + + +W  L CW+WFI+C+GWLP W+L+
Sbjct: 512 -------PFTSVLLFTYIFDKDIYGIKIFYEFIHSWNTLNCWTWFIICVGWLPPWILV 562

>AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR088W
           (GAA1)
          Length = 577

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/597 (54%), Positives = 436/597 (73%), Gaps = 40/597 (6%)

Query: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAI-LPMDGQYRRTYISENALM 59
           MA+LEKLHR+VVDMGLVP++I  L  IS +  L     + + LPM+GQYRRTYISENALM
Sbjct: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGET 119
           PSQAYSYFRE+EWNILRGYRS+I+    +T+ ERN ++ SW++E+G K A+Y ++++GET
Sbjct: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120

Query: 120 LYGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSE 179
           LY V+HA RGDGTEAMVLA PW   E ++N GG +L V++ R+FSRWPVWSKNII+V SE
Sbjct: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180

Query: 180 NPHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVN 239
           +PHA+LRSWV+AYHT LDLTGGSIEAA+VLDY    D+F++VE+SY+GLNG +PNLDL+N
Sbjct: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240

Query: 240 VAISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWR 299
           VA+ I EHEGMKV+LHG P+E+LG + +FSR+++L  GI+D ALSG+K   GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300

Query: 300 IQSVTLKAHG-HGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           IQSVTLKA G +G  DITTFGR+PEAMFRS+NNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360

Query: 359 PSAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPA 418
           P+AV LS++FA+ + ++ +NN++AS+ L S YN+ A+L + +A++VS + +++F  +   
Sbjct: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWALLAFSVALLVSAITAEVFFYLPAP 420

Query: 419 GLLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478
            LL+  ++ + F+P AL  K  I +P S+R K  A+LYFS V +SLL++NF +A ++G L
Sbjct: 421 ALLLAFNVVVSFMPFALV-KYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLL 479

Query: 479 AFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTXXXXXXXXXXXXXX 538
           AFPMTF++T               + S++ +  +   L                      
Sbjct: 480 AFPMTFVRTTV-------------HASVRQKMKNSLLLLL-------------------- 506

Query: 539 XXXXXXPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLI 595
                 PFISI VF  LF+ E  GF +   L+ AW DL CW+W++LCLGW P W+++
Sbjct: 507 ----SNPFISICVFVHLFEPELTGFSVFYSLIDAWNDLGCWTWYVLCLGWYPAWIMV 559

>CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088w required for attachment of GPI anchor onto
           proteins
          Length = 591

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/599 (57%), Positives = 449/599 (74%), Gaps = 37/599 (6%)

Query: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           M+LL+K++RR+ + G + +++  LP +S L  +   + +AILP+DGQYRRTYISENALMP
Sbjct: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNLLVVVAIVLLAILPLDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRETEWNILRGYRSQIE   + +  +RN ++  WLQE G KTA+YE+E++G+TL
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGV+HA RGDGTEAMVLAIPW N + +FN+GGA+LGVSL++FF RWPVWSKNIIVVFSE+
Sbjct: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180

Query: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240
             AALR+WV+AYHTSLDLT GSIEAAVVLDY S  DFFEYVE+SYDGLNGELPNLDLVN+
Sbjct: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300
           A+SI EHEGMKVSLHGLP  ++ + D+F+RLKI+ +GI++WALSGVK  HGNEAFSGWRI
Sbjct: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300

Query: 301 QSVTLKAHGHGGH-DITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           QSVTL+AHG+ G  DIT FGRIPEAMFRS+NNLLEKFHQS+FFYLLLAPR FVSIS+YLP
Sbjct: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360

Query: 360 SAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAG 419
           SAV +SVAFA+ SL++ INNDY SI   S   LV  ++   ++ VSF+IS++ + +    
Sbjct: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420

Query: 420 LLMTISLAICFLPIALSGK-VH-ISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGT 477
            L+  S+A+ FLP+ +S K +H I++ ++YRLK++  +Y+SL+ TSLLM+NFA+  +IG 
Sbjct: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKSIGSIYYSLILTSLLMVNFALTFMIGL 480

Query: 478 LAFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTXXXXXXXXXXXXX 537
           LAFP+T +  I+ +  A+    +R +I   T                             
Sbjct: 481 LAFPLTKLAVISTKTIADE---SRKSILKNT----------------------------- 508

Query: 538 XXXXXXXPFISITVFGLLFDDEFQG-FDII-NKLVSAWIDLKCWSWFILCLGWLPCWLL 594
                  PFIS+ +F    D +F G F +I N+++++W  L CW+WFI+CLGWLP WL+
Sbjct: 509 FILFITNPFISLWLFTATMDTDFNGSFSVIYNRMITSWDTLGCWTWFIICLGWLPYWLI 567

>Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON}
           (82589..84325) [1737 nt, 579 aa]
          Length = 578

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/595 (55%), Positives = 428/595 (71%), Gaps = 37/595 (6%)

Query: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           M++LE L RR++D GL+P+ +A LP +S L      + +  LPMDGQ+RRTYISENALMP
Sbjct: 1   MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSVMLMLYLPMDGQFRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRETEWNILRGYR +IE   + +S ERN +M SWL+EFG KT++Y+N++YG++L
Sbjct: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGV +APRGDGTE+MVLA+PW+N+E EFNV GA+LGVSLARF SRWPVWSKNIIVVFSEN
Sbjct: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180

Query: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240
           P  ALRSWVEAYHTSLDLTGGSIEAAVVLDY    D+FEY+EV Y+G NG LPNLDLVN+
Sbjct: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240

Query: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300
           AISI EHEG+KVSLHGL  +++G+ D++SRLK++ LG ++ AL+GV+  +GNEAFSGWRI
Sbjct: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300

Query: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           Q++TLKA G   HD+TTFGR+ EAMFRSINNLLEKFHQSFFFY LLAPR FVSI SYLP+
Sbjct: 301 QALTLKARGDTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLPA 360

Query: 361 AVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAGL 420
           AV LS++FA++S+++F+NN Y S+   S YNL++ + W ++++V F +   F       L
Sbjct: 361 AVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPLL 420

Query: 421 LMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF 480
           L+  ++ I  +P+A    + ISEPL+YRLK ++F+Y SLV TSLL++NF +A  +G  A+
Sbjct: 421 LLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLFAY 480

Query: 481 PMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTXXXXXXXXXXXXXXXX 540
           PMT +                 N+ +KT  +    ++                       
Sbjct: 481 PMTLVM-----------LNNTDNLRLKTRNSILLAISN---------------------- 507

Query: 541 XXXXPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLI 595
               PFI+  +F  + + +  G + I  LV AW  L  W+WFI C+GW P W+L+
Sbjct: 508 ----PFIAFWLFITIVESKLDGIEAIYGLVDAWNKLGSWTWFIFCIGWFPSWILV 558

>NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/600 (55%), Positives = 425/600 (70%), Gaps = 42/600 (7%)

Query: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           M LLE++ R +V  GL+P+++A LP IS +      + IAILPMDGQYR TYISENALMP
Sbjct: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRETEWNI+RGYR+++    N TS ERN +M SWL EFG KT IYEN    E L
Sbjct: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NEVL 119

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGV HAPRGDGTEA+VLA+PWFN + EFN  GA++GV+LAR+FSRWPVWSKNIIVVFSEN
Sbjct: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179

Query: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240
           P +ALRSWVEAY+TSLDLTGGSIEAA+VLD     D+F+Y+EV YDGLNGELPNLDLVN+
Sbjct: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239

Query: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300
            I I EHEGM+VSLHG P++Q+ +N++++RLKIL   I+  A SG+   HGNEAFSGWRI
Sbjct: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299

Query: 301 QSVTLKAHGHGGH-DITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           QS+TLK  G+ G  DIT FGR+PEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP
Sbjct: 300 QSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 360 SAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAG 419
           SAV LSVAF ++ ++++INN   ++  FS Y L+  +VW + +V  F+++QLFL +    
Sbjct: 360 SAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQLFLILPIPS 419

Query: 420 LLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLA 479
           LL+ I++ I    I +  K      +S RL++ AFL+ SL+ TSLLM+NF ++ +IG +A
Sbjct: 420 LLLLINIVISISSIIIQNKKLFKPAVSNRLRSFAFLHLSLILTSLLMVNFPLSFMIGLMA 479

Query: 480 FPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTXXXXXXXXXXXXXXX 539
           FPMT +++I      +          IK E                              
Sbjct: 480 FPMTKVRSITANTAPQ----------IKLE--------------------------NIIL 503

Query: 540 XXXXXPFISITVFGLLFDDE----FQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLI 595
                PFI++ ++  +  +      QG  +IN+L+SAW D++CW+WF+LCLGWLP W+++
Sbjct: 504 LMISNPFIALIIYNNVSSNSGLQGLQGLRVINRLISAWKDMRCWTWFVLCLGWLPSWIMV 563

>Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}
           similar to Ashbya gossypii AGR087C
          Length = 577

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/597 (53%), Positives = 425/597 (71%), Gaps = 40/597 (6%)

Query: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAI-LPMDGQYRRTYISENALM 59
           MA+LEKLHRR+VDMGLVPR+IA LP IS  CAL     + + LP++GQYRRTYISENALM
Sbjct: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGET 119
           PSQAYSYFRE+EWNILRGYR ++E   ++   ERN ++ SW++E+G KT+I  N QYGET
Sbjct: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120

Query: 120 LYGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSE 179
           LYG++H  RGDGTEAMVLA PW  ++  +N GGA+L +SLAR+F+RWPVWSKNIIVV S 
Sbjct: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180

Query: 180 NPHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVN 239
           +P A+LR+WV+AYHT LDLTGGSIE+AVVLDY    D+F+Y+E+ Y+GLNG LPNLDL+N
Sbjct: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIGYNGLNGGLPNLDLIN 240

Query: 240 VAISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWR 299
            A+ I EHEGMKVSLHG+P+ +L  + +  RLK L  GI+D  L+G+KN  G+EAF+GWR
Sbjct: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300

Query: 300 IQSVTLKAHGHGG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           IQSVTLKAHG  G  D+TTFGR+PEA+FRS+NNLLEKFHQSFFFYLLL+PR FVSI SYL
Sbjct: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYL 360

Query: 359 PSAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPA 418
           P+A+ALS +FA++S ++ +NN+Y+ + L S YN+ A+  + +A+++SFV ++ F  +   
Sbjct: 361 PAAIALSASFAIASADSILNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420

Query: 419 GLLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478
            LL+  ++A+ F+   +  K  I +P SYR K  A LYFS+V TSLL++NFA+AL +G L
Sbjct: 421 SLLLAFNVALSFISFTVI-KYKIQKPFSYRFKAFAHLYFSIVLTSLLVVNFALALAVGVL 479

Query: 479 AFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTXXXXXXXXXXXXXX 538
           AFPM+  KT              +N +++ +  +   L                      
Sbjct: 480 AFPMSLTKTT-------------TNATMQQKLRNSLLL---------------------- 504

Query: 539 XXXXXXPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLI 595
                 PFI+  +   LF+ +  G  + + L+ AW  L CW+W++LC+GW P W+L+
Sbjct: 505 --MSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWTQLGCWTWYVLCIGWYPSWILV 559

>KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} similar
           to uniprot|P39012 Saccharomyces cerevisiae YLR088W GAA1
           Subunit of the GPI:protein transamidase complex removes
           the GPI-anchoring signal and attaches GPI
           (glycosylphosphatidylinositol) to proteins in the ER
          Length = 578

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/598 (54%), Positives = 421/598 (70%), Gaps = 40/598 (6%)

Query: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGF-ISIAILPMDGQYRRTYISENALM 59
           MAL+EKLHRR++ +GL+P+ I+ L  +S LC + G    + +LP DGQ+RRTYISENAL+
Sbjct: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60

Query: 60  PSQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNL-MGSWLQEFGTKTAIYENEQYGE 118
           PSQAYSYFRE+EWNILRGYR+Q++    +++T  +N  +  WLQEFG KTAIY++EQYGE
Sbjct: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120

Query: 119 TLYGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFS 178
           TLYG+ HAPRGDGTEAMV+A PW+N  +E+N GGA+L +SL RFFSRWPVWSKNII+V S
Sbjct: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180

Query: 179 ENPHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLV 238
           E+P A+LRSWV AYHTSLDLTGGSIE+A+VLDY    D F+Y+E+ YDGLNGE PNLDLV
Sbjct: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240

Query: 239 NVAISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGW 298
           NVA+ I EHEG+KVSLHGLP+ +L  ND+ SRLK + LGI+D  LSG+KN +GNEAFSGW
Sbjct: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300

Query: 299 RIQSVTLKAHG-HGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357
           RIQS+TLKA G  G HDITTFGR+PEA+ RS+NNLLEKFHQSFFFYLLLAPR F+SI +Y
Sbjct: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360

Query: 358 LPSAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLP 417
           L +AVA+SVAF  ++LN  +NN Y  + L S YN+ ++L + I++V +F  SQLF+    
Sbjct: 361 LATAVAVSVAFVFAALNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420

Query: 418 AGLLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGT 477
             +L+ +S     LP+    ++ I EP SYR K  A++Y ++V TSLL++NF++A+++G 
Sbjct: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480

Query: 478 LAFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTXXXXXXXXXXXXX 537
           LAFPMT   TI        E+  R  +SIK                              
Sbjct: 481 LAFPMTRTTTII-------ESNLR--LSIKN----------------------------L 503

Query: 538 XXXXXXXPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLI 595
                  PFI+        +    GF +   L+ A   L CW+W+I+CLGW P WLL+
Sbjct: 504 VLLIISNPFIATWAVVNFVEPRLSGFKVFYALIEASQQLGCWTWYIICLGWYPSWLLV 561

>KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/597 (53%), Positives = 423/597 (70%), Gaps = 42/597 (7%)

Query: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAIL-PMDGQYRRTYISENALM 59
           MAL+EKL RR++D+GL+PR++  LP +S LC + G   + +L P++GQYR TYISENALM
Sbjct: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGET 119
           PSQAYSYFRETEWNILRGYR+QI+     +S ERN ++ SW QEFG KTA YE++ +G T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120

Query: 120 LYGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSE 179
           +YGV+HAPRGDGTEAMVLA PW+N + E+N+GGA+L  +L+RFFSRWPVWSKNII+VFS+
Sbjct: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180

Query: 180 NPHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVN 239
           +P A+LRSWV AYHTSLDLTGGSIE+AVVLDY  + DFF+YVE+ Y GLNGELPNLDLVN
Sbjct: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 VAISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWR 299
           VA+ I EHEGMKVSL+G+  E++   ++FS++K + +G++  ALSGV++ +GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMMVGVKKMALSGVQSCYGNEAFSGWR 300

Query: 300 IQSVTLKAHGHGG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           IQ++ L+A G  G  DITTFGRIPEA FRS+NNLLEKFHQSFFFYLLLAPR FVSI+SYL
Sbjct: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 359 PSAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPA 418
           P+AVA SV+F +++L+  + +  ++   FS +NL AV+ + +A+++SF +S LF     +
Sbjct: 361 PAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSAVIGFTVALLLSFALSILFSHWQYS 420

Query: 419 GLLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478
            LL++ +  I  LP A+ G+  I    SY+ K+VAFLY S+V TSLL+INFA+A  IG L
Sbjct: 421 SLLISCNAVIAVLP-AIFGRQGIEASHSYQFKSVAFLYLSVVLTSLLVINFALAFGIGLL 479

Query: 479 AFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTXXXXXXXXXXXXXX 538
           AFP+  +K     R     T                                        
Sbjct: 480 AFPLILVKAPMTSRQRVKNT---------------------------------------I 500

Query: 539 XXXXXXPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLI 595
                 PFIS  +F   F+ +  G  + ++LV AW  L CW+W ++C+GWLP WLL+
Sbjct: 501 LLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQKLGCWTWSVVCIGWLPSWLLV 557

>Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {ON}
           YLR088W (GAA1) - Possible component of GPI:protein
           transamidase [contig 173] FULL
          Length = 578

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/597 (54%), Positives = 421/597 (70%), Gaps = 42/597 (7%)

Query: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFG-FISIAILPMDGQYRRTYISENALM 59
           MAL+E+L R+V+D+GL+PR++  LP +S LC + G F    +LP++GQYR TYISENALM
Sbjct: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGET 119
           PSQAYSYFRETEWNILRGYR+QI+   N +S ERN ++GSWLQEFG KTA+YE+E  G T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120

Query: 120 LYGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSE 179
           LYGV+HAPRGDGTEAMVL+ PWFN + EFN GG +L V+LAR+FSRWPVWSKNIIVVFS+
Sbjct: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180

Query: 180 NPHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVN 239
           +P A+LRSWV+AYHTSLDLTGGSIE+AVVLDY    DFF+YVE+ Y GLNGELPNLDLVN
Sbjct: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 VAISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWR 299
           VAI + EHEGMKVSL+G+P +++ + D+F+R+K + +GI+  ALSGV+  +GNEAFSGWR
Sbjct: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300

Query: 300 IQSVTLKAHG-HGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           IQ+V L+A G HG  DITTFGR+PEA+FRS+NNLLEKFHQSFFFYLLLAPR FVSI+SYL
Sbjct: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 359 PSAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPA 418
           P+AVA SV+F +++L+  +    ++       N+ AV+ + +A++ SF +S  F      
Sbjct: 361 PAAVAFSVSFIVAALDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420

Query: 419 GLLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478
            +L++ S+     PI L+ +V I    ++RLK VA+LY S+V TSLL++NFA+A  IG L
Sbjct: 421 VILISWSVMTALAPILLN-RVRIQSSYAHRLKAVAYLYLSVVLTSLLVVNFALAFGIGLL 479

Query: 479 AFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTXXXXXXXXXXXXXX 538
           AFP+  +K     R     +      +                                 
Sbjct: 480 AFPLILVKNSTTPRLLFKNSLLLLLSN--------------------------------- 506

Query: 539 XXXXXXPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLI 595
                 PFIS  +F   F+    G  I+ +LV AW +  CW+W ++C+GWLP WLLI
Sbjct: 507 ------PFISTCLFAYFFEPLLPGLQILEQLVQAWNEFGCWTWCVVCIGWLPSWLLI 557

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/585 (57%), Positives = 421/585 (71%), Gaps = 44/585 (7%)

Query: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           M L+E++ R+V  MGLVP++   LP+ S + AL   ISIAILP+DGQYR TYISENALMP
Sbjct: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKIIALISLISIAILPIDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRETEWNILRGYR+Q+E  V++  TERN++M +WL + G KT  + N     T+
Sbjct: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNS----TI 116

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180
           YG+ H+PRGDGTEA+VLAIPW NSE +FN GGA+LGVSLARFF RWP+WSKNIIVVFSE+
Sbjct: 117 YGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSED 176

Query: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240
             A+LRSWVEAYHTSLDLTGGSIEAAV+LDY+S  DFF+YVE+ YDGLNGELPNLDLVN+
Sbjct: 177 TGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNI 236

Query: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300
           A+SI EHEGMKVSLHGLP E+L +   +SR K+L   I+D +L+G+K PHGNEAFSGWRI
Sbjct: 237 AVSITEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKDSSLAGIKKPHGNEAFSGWRI 296

Query: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           Q++TLKA G GG DITTFGRIPEAMFRSINNLLEKFHQSFF+YLLLAPR FVSISSYLP+
Sbjct: 297 QALTLKACGEGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLPA 356

Query: 361 AVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAGL 420
           AV LS+AFA SSL  F+N++  SI   S Y L A++VWF+++  SF  +  +L      +
Sbjct: 357 AVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPVM 416

Query: 421 LMTISLAICFLPIALSGKVHISE---PLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGT 477
           LM I +   F+P+ +S  + ++E    +++R+K  AF YFSLV TSLLMINF +AL IG 
Sbjct: 417 LMFICILFSFIPL-ISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGV 475

Query: 478 LAFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTXXXXXXXXXXXXX 537
           LAFPMT +K I+   P   +    S + + +                             
Sbjct: 476 LAFPMTLVK-ISNTLPTSSQALKNSMLLLVSN---------------------------- 506

Query: 538 XXXXXXXPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWF 582
                  P+ISI  F  +FD E  G   +++L+ AW D+ CW+WF
Sbjct: 507 -------PYISICAFSNIFDSELTGLATLDRLIPAWNDMNCWTWF 544

>KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {ON}
           Anc_8.261 YLR088W
          Length = 585

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/600 (54%), Positives = 431/600 (71%), Gaps = 40/600 (6%)

Query: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           M L E L R+ V +GL+P+++A LP++S L A+   + I I+PM+GQYR TYISENALMP
Sbjct: 1   MGLFETLQRKAVKLGLLPKLLAALPLLSALTAVVSVVMILIIPMNGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIE--ETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGE 118
           SQAYSYFRETEWNILRGYR++IE   +  +++++R +++  WL EFG KTA+Y NE+ G+
Sbjct: 61  SQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMGD 120

Query: 119 TLYGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFS 178
           TLYGV+HAPRGDGTEAMVL  PW NSE EFN+GG++L ++L+R+FSRWPVWSKNIIVVFS
Sbjct: 121 TLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVFS 180

Query: 179 ENPHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLV 238
           +NP  ALRSWVEAYHTSLDLTGGSIEAAV+LDY S  D+F Y E+ ++GLNGELPNLDLV
Sbjct: 181 DNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDLV 240

Query: 239 NVAISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGW 298
           NVA+ I +HEGMKVSLHGLP  +L  N+++SRLK+L LG++D  L+G+K  HGNE FSGW
Sbjct: 241 NVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSGW 300

Query: 299 RIQSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           RIQ+VTLKA G G  DITTFGRIPEAMFRSINNLLEKFHQSFFFY LL+P  FVSISSYL
Sbjct: 301 RIQAVTLKARGEGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISSYL 360

Query: 359 PSAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPA 418
           PSAV LS+ FA+++++A +NN YAS +L   Y L+A L   I+++VSF+++  FL    +
Sbjct: 361 PSAVLLSITFAIAAVDATVNNAYAS-ALHITYTLLAALASVISLLVSFLVAHWFLYSTTS 419

Query: 419 GLLMTI-SLAICFLPIALSGKVH-ISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIG 476
            L + + S+ +   P+ +S   + + EP+ YR++ + ++Y+SL+ TSLLM+NF +A  IG
Sbjct: 420 PLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRTLGYIYYSLILTSLLMLNFPLAFSIG 479

Query: 477 TLAFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTXXXXXXXXXXXX 536
              +PMT +K + +   ++     R+++ +                              
Sbjct: 480 LFGYPMTLVKPLNIYSKSQMSLKLRNSVLL------------------------------ 509

Query: 537 XXXXXXXXPFISITVFGLLFDD-EFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLI 595
                   PF++  +   + ++ EF   D+   L SAW DL CW+WF+LCLGWLP WLL+
Sbjct: 510 ----VISNPFVATWLICTVVENSEFPNLDVFAALFSAWKDLNCWTWFVLCLGWLPTWLLV 565

>TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {ON}
           Anc_8.261 YLR088W
          Length = 581

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/597 (50%), Positives = 425/597 (71%), Gaps = 38/597 (6%)

Query: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           MAL+E LHRR   +GL+P+VI  L ++S +  L     I  LP+DGQYRRTYISENAL+P
Sbjct: 1   MALIEVLHRRATKLGLLPKVIGKLSIVSNILVLISIGLILCLPLDGQYRRTYISENALLP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRE+EWNILRGYR+ IE  ++  +  RN ++ SWL +FG K A+Y+N   G+TL
Sbjct: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGV ++ RGDGTEA+VLA+PW+N++ E N+GGA+LG+SL+R+FSRWP+WSKNII+V SEN
Sbjct: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180

Query: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240
           PH A++SWV+AYH SLDLTGGS+EAA+VLD+ S  ++FE+VE+ ++G+NGELPNLD+VNV
Sbjct: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240

Query: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300
           AIS+IEHEG+KVSL GL   ++  + +F+RLK L  G+++ ALSG +  +GNEAFSG RI
Sbjct: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300

Query: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           Q++TLKA G  GHDITTFGRIPEA+FRS+NNLLEKFHQSFFFY L+APR FVSI SYLPS
Sbjct: 301 QALTLKACGTEGHDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLPS 360

Query: 361 AVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAGL 420
           AV LS++F +S+ +++INN Y ++ L    +++A++++F ++ +SF+  Q+  + L   L
Sbjct: 361 AVCLSISFGISAAHSYINNQYITVPLSDNSSILALIIFFGSIAISFIFLQINETFLQPHL 420

Query: 421 LMTISLAICFLPIALSGK--VHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478
           ++   L I FLP+    +  + I   LSYRLK+ AF+Y SLV TSLL++NFA+A  +G L
Sbjct: 421 MILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMGLL 480

Query: 479 AFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTXXXXXXXXXXXXXX 538
           AFP+TF K+ +              I+ K++      +N  Y                  
Sbjct: 481 AFPLTFTKSCS------------EMITFKSK-----VINCFY------------------ 505

Query: 539 XXXXXXPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLI 595
                 PFI+I +F  +F+D+   F++ + L+S++  +  W+W I C+GW   W ++
Sbjct: 506 -LAISNPFIAIFIFVSIFEDDITNFEVFSDLISSFKYMGNWTWAITCIGWFTTWQMV 561

>SAKL0H14564g Chr8 (1265769..1267679) [1911 bp, 636 aa] {ON} similar
           to uniprot|P54072 Saccharomyces cerevisiae YLR152C
           Hypothetical ORF
          Length = 636

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 400 IAMVVSFVISQLFLSVLPAGLLMTIS-LAICFLPIALSGKVHISEPLSYRLKNVAFLYFS 458
           IA  V+ V  Q F  ++ AG+   IS L I ++    +G V  S+ +    K VA+    
Sbjct: 92  IANFVTSVPRQWFWGLMFAGVFPNISDLPIAYVQSMSNGSVFSSDEVD---KGVAYCCIF 148

Query: 459 LVSTSLLMINFAMALLIG 476
           L S S LM+NF M  ++G
Sbjct: 149 LTSQSFLMMNFGMFRVVG 166

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,169,832
Number of extensions: 2431703
Number of successful extensions: 8332
Number of sequences better than 10.0: 24
Number of HSP's gapped: 8482
Number of HSP's successfully gapped: 40
Length of query: 614
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 498
Effective length of database: 40,180,143
Effective search space: 20009711214
Effective search space used: 20009711214
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 69 (31.2 bits)