Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_10.1718.260ON29582958154440.0
Skud_12.1558.260ON29592960140260.0
Smik_12.1468.260ON29582959139100.0
YLR087C (CSF1)8.260ON29582959139060.0
NCAS0B050108.260ON2952297791180.0
NDAI0B019808.260ON2959296986330.0
KAFR0B027208.260ON2982300785000.0
CAGL0L12210g8.260ON2981300083800.0
KNAG0G020308.260ON2998302081170.0
TDEL0F038708.260ON2942298878940.0
ZYRO0C01694g8.260ON3006304571420.0
Kpol_392.78.260ON2995302869060.0
TBLA0E044208.260ON3148257761880.0
TPHA0J007308.260ON3046290557670.0
SAKL0H17072g8.260ON2997304457580.0
KLTH0G13728g8.260ON2966302350040.0
Kwal_YGOB_56.238088.260ON2941300849470.0
Kwal_56.23810singletonOFF2763280245420.0
AGR088W8.260ON2887300036230.0
Ecym_43108.260ON2943154824380.0
KLLA0F19096g8.260ON2923158721330.0
Kwal_56.23808singletonOFF62601574e-12
KNAG0I029204.53ON445198850.66
TPHA0H010705.94ON1015125812.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_10.171
         (2958 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] ...  5953   0.0  
Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] ...  5407   0.0  
Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] ...  5362   0.0  
YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}...  5361   0.0  
NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {...  3516   0.0  
NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {...  3330   0.0  
KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {...  3278   0.0  
CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...  3232   0.0  
KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {...  3131   0.0  
TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {...  3045   0.0  
ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} simil...  2755   0.0  
Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..1...  2664   0.0  
TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa]...  2388   0.0  
TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] ...  2226   0.0  
SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} sim...  2222   0.0  
KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} sim...  1932   0.0  
Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp,...  1910   0.0  
Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR0...  1754   0.0  
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...  1400   0.0  
Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar ...   943   0.0  
KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa...   826   0.0  
Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C...    65   4e-12
KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.5...    37   0.66 
TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5....    36   2.3  

>Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 5953 bits (15444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2892/2958 (97%), Positives = 2892/2958 (97%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60
            MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNS 120
            KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNS
Sbjct: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNS 120

Query: 121  SGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180
            SGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG
Sbjct: 121  SGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180

Query: 181  SSADKLDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELKLNRGSLLLGNK 240
            SSADKLDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELKLNRGSLLLGNK
Sbjct: 181  SSADKLDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELKLNRGSLLLGNK 240

Query: 241  FTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLKFKL 300
            FTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLKFKL
Sbjct: 241  FTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLKFKL 300

Query: 301  DTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAGPSDDAFFQKWKGLSLYKASAGDAKTSDL 360
            DTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAGPSDDAFFQKWKGLSLYKASAGDAKTSDL
Sbjct: 301  DTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAGPSDDAFFQKWKGLSLYKASAGDAKTSDL 360

Query: 361  DDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPPD 420
            DDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPPD
Sbjct: 361  DDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPPD 420

Query: 421  FALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNILI 480
            FALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNILI
Sbjct: 421  FALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNILI 480

Query: 481  MEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGFK 540
            MEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGFK
Sbjct: 481  MEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGFK 540

Query: 541  NDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQLEAFLLR 600
            NDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQLEAFLLR
Sbjct: 541  NDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQLEAFLLR 600

Query: 601  EHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNPLDFNENC 660
            EHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNPLDFNENC
Sbjct: 601  EHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNPLDFNENC 660

Query: 661  YLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGRS 720
            YLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGRS
Sbjct: 661  YLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGRS 720

Query: 721  YDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFGEFFNFVT 780
            YDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFGEFFNFVT
Sbjct: 721  YDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFGEFFNFVT 780

Query: 781  SEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGSMKNDAEDNGPMKRSDLKRTTNET 840
            SEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGSMKNDAEDNGPMKRSDLKRTTNET
Sbjct: 781  SEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGSMKNDAEDNGPMKRSDLKRTTNET 840

Query: 841  DIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHVS 900
            DIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHVS
Sbjct: 841  DIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHVS 900

Query: 901  KQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPTYFCQWDINLGELNINSD 960
            KQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPTYFCQWDINLGELNINSD
Sbjct: 901  KQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPTYFCQWDINLGELNINSD 960

Query: 961  IEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAERINISLNDPVMKSQSIV 1020
            IEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAERINISLNDPVMKSQSIV
Sbjct: 961  IEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAERINISLNDPVMKSQSIV 1020

Query: 1021 SVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSFLNFETKLRFTNFGQYK 1080
            SVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSFLNFETKLRFTNFGQYK
Sbjct: 1021 SVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSFLNFETKLRFTNFGQYK 1080

Query: 1081 DSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXXX 1140
            DSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYG                  
Sbjct: 1081 DSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLPTLPD 1140

Query: 1141 XXXYIIEDIVGEYATLLEATNPFKDLFAETPSTVEPLRASFTXXXXXXXXXPLEFKPVAF 1200
               YIIEDIVGEYATLLEATNPFKDLFAETPSTVEPLRASFT         PLEFKPVAF
Sbjct: 1141 TIDYIIEDIVGEYATLLEATNPFKDLFAETPSTVEPLRASFTEDDDEEAADPLEFKPVAF 1200

Query: 1201 TEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMVQVLDDIEIGIVKRLSNL 1260
            TEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMVQVLDDIEIGIVKRLSNL
Sbjct: 1201 TEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMVQVLDDIEIGIVKRLSNL 1260

Query: 1261 QEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDRINYQMSEKSLEKNRTSKSLEVAVLA 1320
            QEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDRINYQMSEKSLEKNRTSKSLEVAVLA
Sbjct: 1261 QEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDRINYQMSEKSLEKNRTSKSLEVAVLA 1320

Query: 1321 KVKTVRATVNQKKNPELSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQM 1380
            KVKTVRATVNQKKNPELSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQM
Sbjct: 1321 KVKTVRATVNQKKNPELSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQM 1380

Query: 1381 EWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTELISKLTAASEYYQISHDPYVITKPAF 1440
            EWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTELISKLTAASEYYQISHDPYVITKPAF
Sbjct: 1381 EWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTELISKLTAASEYYQISHDPYVITKPAF 1440

Query: 1441 IMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTNIDKVLKERKYSFAKDAKNIFMSVFS 1500
            IMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTNIDKVLKERKYSFAKDAKNIFMSVFS
Sbjct: 1441 IMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTNIDKVLKERKYSFAKDAKNIFMSVFS 1500

Query: 1501 TWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKLLKCTMGSFYLTVYGEGYEVEHNFVV 1560
            TWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKLLKCTMGSFYLTVYGEGYEVEHNFVV
Sbjct: 1501 TWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKLLKCTMGSFYLTVYGEGYEVEHNFVV 1560

Query: 1561 ADANLVVDLTPPVTSLSSNREETIEITGKVGSVKGKFSDKLLKLQDLIPLVVAVTEDDKS 1620
            ADANLVVDLTPPVTSLSSNREETIEITGKVGSVKGKFSDKLLKLQDLIPLVVAVTEDDKS
Sbjct: 1561 ADANLVVDLTPPVTSLSSNREETIEITGKVGSVKGKFSDKLLKLQDLIPLVVAVTEDDKS 1620

Query: 1621 DPKAELSKQFKMNTVLLVDKSEIQVVMDKTKVMSRTVGGRVSLLWENLKDSTSQAGSLVI 1680
            DPKAELSKQFKMNTVLLVDKSEIQVVMDKTKVMSRTVGGRVSLLWENLKDSTSQAGSLVI
Sbjct: 1621 DPKAELSKQFKMNTVLLVDKSEIQVVMDKTKVMSRTVGGRVSLLWENLKDSTSQAGSLVI 1680

Query: 1681 FSQKSEVWLKHGSTILGEAQLCDFSILATTEAWSHKPTILVNNQCADLHFRAMSTTEQMV 1740
            FSQKSEVWLKHGSTILGEAQLCDFSILATTEAWSHKPTILVNNQCADLHFRAMSTTEQMV
Sbjct: 1681 FSQKSEVWLKHGSTILGEAQLCDFSILATTEAWSHKPTILVNNQCADLHFRAMSTTEQMV 1740

Query: 1741 NAITEIKESVLKVKEQIKFKPKSKNKSQFVGSRINTVLSCYFSNVSSEIMPLSPFYIRHE 1800
            NAITEIKESVLKVKEQIKFKPKSKNKSQFVGSRINTVLSCYFSNVSSEIMPLSPFYIRHE
Sbjct: 1741 NAITEIKESVLKVKEQIKFKPKSKNKSQFVGSRINTVLSCYFSNVSSEIMPLSPFYIRHE 1800

Query: 1801 AKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGFSKEAYSLINV 1860
            AKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGFSKEAYSLINV
Sbjct: 1801 AKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGFSKEAYSLINV 1860

Query: 1861 DISISMIKLTFSEPRRIVNSFLQDEKLASQGIXXXXXXXXXXXTTDPMNAKKETPAKMIN 1920
            DISISMIKLTFSEPRRIVNSFLQDEKLASQGI           TTDPMNAKKETPAKMIN
Sbjct: 1861 DISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLSSLNSLFLTTDPMNAKKETPAKMIN 1920

Query: 1921 WTLDTNISYFGILVPVASTYFVFELHMXXXXXXXXXXXXXPEQTRLTGQLSIENILFLIK 1980
            WTLDTNISYFGILVPVASTYFVFELHM             PEQTRLTGQLSIENILFLIK
Sbjct: 1921 WTLDTNISYFGILVPVASTYFVFELHMLLLSLTNTNNGLLPEQTRLTGQLSIENILFLIK 1980

Query: 1981 ERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLDM 2040
            ERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLDM
Sbjct: 1981 ERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLDM 2040

Query: 2041 VQYYSKRHAPNIWNIRMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGDDPGLMF 2100
            VQYYSKRHAPNIWNIRMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGDDPGLMF
Sbjct: 2041 VQYYSKRHAPNIWNIRMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGDDPGLMF 2100

Query: 2101 GYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFKR 2160
            GYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFKR
Sbjct: 2101 GYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFKR 2160

Query: 2161 CGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAFQELKKNILDMPHESNMENSSPD 2220
            CGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAFQELKKNILDMPHESNMENSSPD
Sbjct: 2161 CGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAFQELKKNILDMPHESNMENSSPD 2220

Query: 2221 AAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTINC 2280
            AAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTINC
Sbjct: 2221 AAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTINC 2280

Query: 2281 TYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEKKPNFTK 2340
            TYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEKKPNFTK
Sbjct: 2281 TYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEKKPNFTK 2340

Query: 2341 PSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQ 2400
            PSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQ
Sbjct: 2341 PSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQ 2400

Query: 2401 PLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVFFN 2460
            PLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVFFN
Sbjct: 2401 PLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVFFN 2460

Query: 2461 VKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNMSTLSSNSNVDVGTEIPWCFTLIFTN 2520
            VKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNMSTLSSNSNVDVGTEIPWCFTLIFTN
Sbjct: 2461 VKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNMSTLSSNSNVDVGTEIPWCFTLIFTN 2520

Query: 2521 LSGDVDLGPSLGVISLRSQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANAS 2580
            LSGDVDLGPSLGVISLRSQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANAS
Sbjct: 2521 LSGDVDLGPSLGVISLRSQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANAS 2580

Query: 2581 WVSEVKWPLENSKNTHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSKGI 2640
            WVSEVKWPLENSKNTHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSKGI
Sbjct: 2581 WVSEVKWPLENSKNTHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSKGI 2640

Query: 2641 LPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPSESKQPI 2700
            LPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPSESKQPI
Sbjct: 2641 LPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPSESKQPI 2700

Query: 2701 LYKDILRSLKLLRTDLSVNISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTD 2760
            LYKDILRSLKLLRTDLSVNISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTD
Sbjct: 2701 LYKDILRSLKLLRTDLSVNISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTD 2760

Query: 2761 LQLQVLDVSAALSTSKEELDEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEE 2820
            LQLQVLDVSAALSTSKEELDEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEE
Sbjct: 2761 LQLQVLDVSAALSTSKEELDEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEE 2820

Query: 2821 KTNNLEYLFACSFSDKISVRWNLGPINFIKEMWTTHVKALAVRRSQTANISFGQTXXXXX 2880
            KTNNLEYLFACSFSDKISVRWNLGPINFIKEMWTTHVKALAVRRSQTANISFGQT     
Sbjct: 2821 KTNNLEYLFACSFSDKISVRWNLGPINFIKEMWTTHVKALAVRRSQTANISFGQTEEELE 2880

Query: 2881 XXXXXXXNASKFNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPVQ 2940
                   NASKFNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPVQ
Sbjct: 2881 ESIKREENASKFNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPVQ 2940

Query: 2941 KLVYLAEKQYVKILDDTH 2958
            KLVYLAEKQYVKILDDTH
Sbjct: 2941 KLVYLAEKQYVKILDDTH 2958

>Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] {ON}
            YLR087C (REAL)
          Length = 2959

 Score = 5407 bits (14026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2594/2960 (87%), Positives = 2756/2960 (93%), Gaps = 3/2960 (0%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60
            MEA+SQLRGVPLTHQKDFSWVFLVDWILTV+ CLT IFYMGRIYAYLV+FILEWLLWKRA
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60

Query: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNS 120
             IKINVETLR+SLLGGRI+FKHLSVIHKDYTIS+LEGSLTWKYWLLNCRKAELIEN K+S
Sbjct: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKDS 120

Query: 121  SGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180
              KN++LPCKF LECEGLE FIYNRT+AYDNVINLLSKDERDKFEKYLNEHSFPE FSDG
Sbjct: 121  LSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPESFSDG 180

Query: 181  SSADKLDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELKLNRGSLLLGNK 240
            SSADKLDEDLSESAYTTNSD+SIINDRDYQET+IGK PK L F PIELK NRGSLLLGNK
Sbjct: 181  SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLLGNK 240

Query: 241  FTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLKFKL 300
            FTPSVMILSYENGEG+IDVLPPKERLDLYRNKT +E KNFEISIKQNIGYDDAIGLKFKL
Sbjct: 241  FTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL 300

Query: 301  DTGKVSKLWKTFVRVLRVVTKPVIPRRGKK-AGPSDDAFFQKWKGLSLYKASAGDAKTSD 359
            DTGKVSKLWKTFVRVLR+VTKP+I ++ KK  GPSDD+FFQKWKGLSLYKA+ GDAK SD
Sbjct: 301  DTGKVSKLWKTFVRVLRIVTKPIISKKNKKKTGPSDDSFFQKWKGLSLYKAAPGDAKPSD 360

Query: 360  LDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPP 419
            LDDIEFDFT+HEYAKFTSILKCPK+T++YDVDV G VPHGAHPTIPDIDGPDVGNNGAPP
Sbjct: 361  LDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGNNGAPP 420

Query: 420  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNIL 479
            DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRT+KP+KKLPPGSRR+YTLFRMN+L
Sbjct: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFRMNVL 480

Query: 480  IMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGF 539
            IMEDTTWRIPTRE+SKDAEFLQHYK+TSEEYRPFGWMDLRFCKDTYANFN+ +CPTVEGF
Sbjct: 481  IMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPTVEGF 540

Query: 540  KNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQLEAFLL 599
            +N+FHVHFVETEIRSSVNHDILLKSKVF+LDGDIGYPLGWNS  IWIINMKS+QLEAFLL
Sbjct: 541  QNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLEAFLL 600

Query: 600  REHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNPLDFNEN 659
            REHITLVADTLSDFSAG+PTPYELFRPFVYK+NWEM+GYSIYLNVNDHNIVNNPLDFNEN
Sbjct: 601  REHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660

Query: 660  CYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 719
            CYLSLHGD+L IDITVPRESILGTYTD+SYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR
Sbjct: 661  CYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720

Query: 720  SYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFGEFFNFV 779
            +YDFT+KG YLLYSELDIDNVD+L I CTSNSTVLHCYGFVMRYL NVKMNYFGEFFNFV
Sbjct: 721  AYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780

Query: 780  TSEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGSMKNDAEDNGPMKRSDLKRTTNE 839
            TSEEYTGVLGAREVGE++TKSSV+DLASTLDS YQN S+KN++ED  P+KRSDLKRTTNE
Sbjct: 781  TSEEYTGVLGAREVGEIITKSSVLDLASTLDSGYQNSSLKNESEDKDPVKRSDLKRTTNE 840

Query: 840  TDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHV 899
            TDIWFTFSVWNGALILPETIYS DPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHV
Sbjct: 841  TDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHV 900

Query: 900  SKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPTYFCQWDINLGELNINS 959
            SK INEVFDFIRRNNGA+EQEHG LSDLTIHGHRM+GLPPTEPTYFCQWDINLG+L I+S
Sbjct: 901  SKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEPTYFCQWDINLGDLTIDS 960

Query: 960  DIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAERINISLNDPVMKSQSI 1019
            DIEF+KGFF SFYK+GFGYNDLENILLYDTET++DMTSLTVHAERI IS NDPVMKSQS+
Sbjct: 961  DIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAERIKISFNDPVMKSQSV 1020

Query: 1020 VSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSFLNFETKLRFTNFGQY 1079
            V+ ESLLFTLIDFENERYSQRID+K+PKL +SLSCVMGDG +TSFL FETKLRFTNF QY
Sbjct: 1021 VTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTSFLKFETKLRFTNFEQY 1080

Query: 1080 KDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXX 1139
            KD DKKRSEQRRYI  +DSPYHRCPFLLPLFYQDSDTYQKLYG                 
Sbjct: 1081 KDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLPTLP 1140

Query: 1140 XXXXYIIEDIVGEYATLLEATNPFKDLFAETPSTVEPLRASFTXXXXXXXXXPLEFKPVA 1199
                +IIEDIVGEYATLLE TNPFKD+FAETPSTVEP RAS T         PLEFKP+A
Sbjct: 1141 DTIDFIIEDIVGEYATLLETTNPFKDIFAETPSTVEPSRASSTEDDNDERADPLEFKPIA 1200

Query: 1200 FTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMVQVLDDIEIGIVKRLSN 1259
            FTE  NH+R NYVIDVSYILLD+DPLLFVFTKSLL++FYSEDMVQVLDDIEIGIVK+LSN
Sbjct: 1201 FTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYSEDMVQVLDDIEIGIVKQLSN 1260

Query: 1260 LQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDRINYQMSEKSLEKNRTSKSLEVAVL 1319
            LQEGI SISNID+H+AY+NLIWQETGEEGFELYLDRI+YQMSEKSLEKNRTSK LEVA L
Sbjct: 1261 LQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTSKLLEVATL 1320

Query: 1320 AKVKTVRATVNQKKNPELSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1379
            A++KTVR TVNQK+NP+LSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQ
Sbjct: 1321 ARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1380

Query: 1380 MEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTELISKLTAASEYYQISHDPYVITKPA 1439
            MEWLFEYCSDQGNLIQE   S +SIQ+TR S+KTELISKLTAASEYYQISHDPYVITKPA
Sbjct: 1381 MEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTELISKLTAASEYYQISHDPYVITKPA 1440

Query: 1440 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTNIDKVLKERKYSFAKDAKNIFMSVF 1499
            FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQ NI+KVLKERKY+ AKDAKNIFMSVF
Sbjct: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNIEKVLKERKYTSAKDAKNIFMSVF 1500

Query: 1500 STWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1559
            STWRNWEFSDVARSYIYGKLF  D+A+HK N +KKLLKCTMGSFYLTVYGEGYEVEHNFV
Sbjct: 1501 STWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560

Query: 1560 VADANLVVDLTPPVTSLSSNREETIEITGKVGSVKGKFSDKLLKLQDLIPLVVAVTEDDK 1619
            +ADANLVVDLTPPVTSLS NREETIEITG+VGSVKGKFSD+LLKLQDLIPLV AV   DK
Sbjct: 1561 IADANLVVDLTPPVTSLSLNREETIEITGRVGSVKGKFSDRLLKLQDLIPLVAAVGGGDK 1620

Query: 1620 SDPKAELSKQFKMNTVLLVDKSEIQVVMDKTKVMSRTVGGRVSLLWENLKDSTSQAGSLV 1679
            SD KAELSKQFKMNTVLLVDKSEIQ+VMD+TK+MSRTVGGRVSLLWENLKDSTSQAGSLV
Sbjct: 1621 SDAKAELSKQFKMNTVLLVDKSEIQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLV 1680

Query: 1680 IFSQKSEVWLKHGSTILGEAQLCDFSILATTEAWSHKPTILVNNQCADLHFRAMSTTEQM 1739
            IFSQKSEVWLKH S IL EAQL DFSILATTEAWSHKPTIL+NNQCADLHFRAMSTTEQ 
Sbjct: 1681 IFSQKSEVWLKHASIILCEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMSTTEQT 1740

Query: 1740 VNAITEIKESVLKVKEQIKFKPKSKNKSQFVGSRINTVLSCYFSNVSSEIMPLSPFYIRH 1799
            V  ITEI+ESVLK+K++IKFKPKSK +SQFVG +IN VLSCYFSNVSSEIMPLSPFYIRH
Sbjct: 1741 VTVITEIRESVLKIKDRIKFKPKSKKRSQFVGPKINIVLSCYFSNVSSEIMPLSPFYIRH 1800

Query: 1800 EAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGFSKEAYSLIN 1859
            EAKQLDIYFNKFGSNE+LLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGG SKE YSLIN
Sbjct: 1801 EAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISKEDYSLIN 1860

Query: 1860 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGIXXXXXXXXXXXTTD-PMNAKKETPAKM 1918
            VDISISMIKLTFSEPRRIVNSFLQDEKLASQGI           T+  P   KK+ PA+M
Sbjct: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLSSLKSLLFTSGLPKKKKKKAPARM 1920

Query: 1919 INWTLDTNISYFGILVPVASTYFVFELHMXXXXXXXXXXXXXPEQTRLTGQLSIENILFL 1978
            INWTLDT+I+YFGILVPVASTYFVFELHM             PE+ ++TGQ SIENILFL
Sbjct: 1921 INWTLDTSITYFGILVPVASTYFVFELHMLLLSLTNTNNGMLPEEAKVTGQFSIENILFL 1980

Query: 1979 IKERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLL 2038
            IKERSLPIGLSKLLDFSIKVSTLQRT DTEQSFQVESSHFRVCLSPDSLLRL+WGA+KLL
Sbjct: 1981 IKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLL 2040

Query: 2039 DMVQYYSKRHAPNIWNIRMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGDDPGL 2098
            D+  YYS+RHAPNIW+I+MFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAG DPGL
Sbjct: 2041 DLGHYYSRRHAPNIWDIKMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGSDPGL 2100

Query: 2099 MFGYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWF 2158
            M GYNRLFSAYEKDFGKFT+VDAFFSV+NGN SSTFFSEGNEK+KYNRSFLPNMQISYWF
Sbjct: 2101 MLGYNRLFSAYEKDFGKFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWF 2160

Query: 2159 KRCGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAFQELKKNILDMPHESNMENSS 2218
            KRCGELKDWFFRFHGEALDVNF+PSFMDVIDSTLQS+RAFQELKKNILD+  +S+ME+ +
Sbjct: 2161 KRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSVRAFQELKKNILDVSEDSHMEDDN 2220

Query: 2219 PDAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTI 2278
            P A  + E+ASNSLAPFLDNIRSVN NFKYDGGVFRVYTYDDIEAKSEPSFE+KSPVVTI
Sbjct: 2221 PYATSSMESASNSLAPFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTI 2280

Query: 2279 NCTYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEKKPNF 2338
            NCTYKH+E++AKPHRIR LI VDPT NTLYAGCAPLLMEFSESLQ MIKKHST + KP+F
Sbjct: 2281 NCTYKHNENEAKPHRIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHST-DDKPSF 2339

Query: 2339 TKPSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDS 2398
            TKPS+QNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDS
Sbjct: 2340 TKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDS 2399

Query: 2399 EQPLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVF 2458
            EQPL FSLTL+QTKASI+HIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSD+SVF
Sbjct: 2400 EQPLEFSLTLQQTKASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVF 2459

Query: 2459 FNVKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNMSTLSSNSNVDVGTEIPWCFTLIF 2518
            FNVKQLQNLYLFLDIWRFSSILHTRP Q   +KE++MS+L+S + VDVG EIPWCFTLIF
Sbjct: 2460 FNVKQLQNLYLFLDIWRFSSILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIF 2519

Query: 2519 TNLSGDVDLGPSLGVISLRSQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVAN 2578
            TN+SGDVDLGPSLGVISLR+QRTWLATDHY EKRQLLHAFTDG+SLTSEGRLSGLFEVAN
Sbjct: 2520 TNVSGDVDLGPSLGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVAN 2579

Query: 2579 ASWVSEVKWPLENSKNTHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSK 2638
            ASW+SEVKW LE SKN+HPLVSTSLNIDDVAVKAAFDYHMFLIGTINNI+F LHNEKD+K
Sbjct: 2580 ASWISEVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAK 2639

Query: 2639 GILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPSESKQ 2698
            GILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNP ESKQ
Sbjct: 2640 GILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQ 2699

Query: 2699 PILYKDILRSLKLLRTDLSVNISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLK 2758
            PILYKDILRSLKLLRTDLS+NISSLKVQISPISLFDVEVLVVRI  VSIRSETHSGKKLK
Sbjct: 2700 PILYKDILRSLKLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLK 2759

Query: 2759 TDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQ 2818
            TDLQLQVLDVSAALSTSKEELDEEIGASIAIDDY+HYASKIVGGTIIDIPKLAVHMTTLQ
Sbjct: 2760 TDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQ 2819

Query: 2819 EEKTNNLEYLFACSFSDKISVRWNLGPINFIKEMWTTHVKALAVRRSQTANISFGQTXXX 2878
            EEKTNN+EYLFACSFSDKISV+WNLGP+NFIKEMWTTHVKALAVR+SQ AN+SFGQT   
Sbjct: 2820 EEKTNNIEYLFACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQTEEE 2879

Query: 2879 XXXXXXXXXNASKFNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIP 2938
                       SKFNYIALEEPQI+VPQIRDLG+ATPPMEWFGVNRKR PKFTHQTAVIP
Sbjct: 2880 LEESIKTKETTSKFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIP 2939

Query: 2939 VQKLVYLAEKQYVKILDDTH 2958
            VQKLVYLAEKQYVKILD TH
Sbjct: 2940 VQKLVYLAEKQYVKILDGTH 2959

>Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 5362 bits (13910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2577/2959 (87%), Positives = 2748/2959 (92%), Gaps = 2/2959 (0%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60
            MEAVSQLRGVPLTHQKDFSWVFLVDWILT++ACLT +FYMGRIYAYLVSFILEWLLWKRA
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNS 120
            K+KINVETLR+SLLGGRI+FKHLSVIHKDYTISILEGS+TWKYWLLNCRKAELI+N K+ 
Sbjct: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAELIDNNKSP 120

Query: 121  SGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180
            S  N++LPCKF LECEGLE FIYNRT+AYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG
Sbjct: 121  SKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180

Query: 181  SSADKLDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELKLNRGSLLLGNK 240
            SSADKLDEDLSESAYTTNSD+SIINDRDYQET+IGK+P+ L F PIEL  +RGSLLLGNK
Sbjct: 181  SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFSRGSLLLGNK 240

Query: 241  FTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLKFKL 300
            FTPSVMILSYE+GEGI+DVLPPKER+DLYRNKT +E KNFEISIKQNIGYDDAIGLKFKL
Sbjct: 241  FTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL 300

Query: 301  DTGKVSKLWKTFVRVLRVVTKPVIPRRGKK-AGPSDDAFFQKWKGLSLYKASAGDAKTSD 359
            DTGKVSKLWK F+RVL++V+KPV+ +R KK    S+D+F+QKWKGLSLYKA++G+AK +D
Sbjct: 301  DTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLYKATSGEAKAND 360

Query: 360  LDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPP 419
            LDDIEFD T+HEYAKFTSILKCPKVT+SYDVDVPGVVPHGAHPTI DIDGPDVGNNGAPP
Sbjct: 361  LDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDIDGPDVGNNGAPP 420

Query: 420  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNIL 479
            DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNI 
Sbjct: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNIS 480

Query: 480  IMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGF 539
            I EDTTWRIPTRE+SKDAEFLQHYK+TSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGF
Sbjct: 481  ITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGF 540

Query: 540  KNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQLEAFLL 599
            +N+FHVHFVETEIRSSVNHDILLKSKVF++DGDIGYPLGWNS  IWIINMKSEQLEAFLL
Sbjct: 541  QNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQLEAFLL 600

Query: 600  REHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNPLDFNEN 659
            REHITLVADTLSDFSAGDPTPYELFRPFVYK+NWEM+GYSIYLNVNDHNIVNNPLDFNEN
Sbjct: 601  REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660

Query: 660  CYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 719
            CYLSLHGDKL ID+TVPRESILGTYTD+SYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR
Sbjct: 661  CYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720

Query: 720  SYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFGEFFNFV 779
            +YDFTIKG YLLYSELDIDNVD+L I CTSNSTVLHCYGFVMRYL NVKMNYFGEFFNFV
Sbjct: 721  AYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780

Query: 780  TSEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGSMKNDAEDNGPMKRSDLKRTTNE 839
            TSEEYTGVLGAR+VG+V TKSSVVDLAST+DS YQN S+KN++E  GPMKRSDLKRTTNE
Sbjct: 781  TSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSSVKNNSEAKGPMKRSDLKRTTNE 840

Query: 840  TDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHV 899
            TDIWFTFSVWNGALILPETIYSFDPCIALHF+ELVVDFRSCNYYMDIMAVL+GTSIKRHV
Sbjct: 841  TDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYYMDIMAVLDGTSIKRHV 900

Query: 900  SKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPTYFCQWDINLGELNINS 959
            SKQINEVFDFIRRNNGADEQEHG LSDLTIHGHRMYGLPPTEPTYFCQWDINLG+L+I+S
Sbjct: 901  SKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLSIDS 960

Query: 960  DIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAERINISLNDPVMKSQSI 1019
            D+EF+KGFF+SFYK+GFGYNDLENILLYDTETI+DMTSLTVHAERI ISL DPVMKSQS+
Sbjct: 961  DVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAERIRISLEDPVMKSQSV 1020

Query: 1020 VSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSFLNFETKLRFTNFGQY 1079
            +S ES+LFTLIDFENE YSQRID+KVPKL +SL+CVMGDG + SFL FETKLRFTNF QY
Sbjct: 1021 ISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMSFLKFETKLRFTNFEQY 1080

Query: 1080 KDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXX 1139
            KD DKKRSEQR+YI  +DSPYHRC FLLPLFYQDSDTYQKLYG                 
Sbjct: 1081 KDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLPTLP 1140

Query: 1140 XXXXYIIEDIVGEYATLLEATNPFKDLFAETPSTVEPLRASFTXXXXXXXXXPLEFKPVA 1199
                +IIEDIVGEYATLLEA NPFKD FAETPSTVEP +ASFT            FKP A
Sbjct: 1141 DTIDFIIEDIVGEYATLLEAANPFKDSFAETPSTVEPSKASFTEDDNDEEASSSGFKPGA 1200

Query: 1200 FTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMVQVLDDIEIGIVKRLSN 1259
            FTE+ + E+DNYV+DVSYILLDIDPLLFVFTKSLLEQ YSE+MVQVLDDIEIGIVKRLSN
Sbjct: 1201 FTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSLLEQLYSENMVQVLDDIEIGIVKRLSN 1260

Query: 1260 LQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDRINYQMSEKSLEKNRTSKSLEVAVL 1319
            LQEGI SISNIDIH+AYLNLIWQETGEEGFELYLDRI+YQM EKSLEKNRT+K LEVA L
Sbjct: 1261 LQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMREKSLEKNRTTKLLEVAAL 1320

Query: 1320 AKVKTVRATVNQKKNPELSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1379
            A+VKTVR TVNQKKNP+LSEDRPPALSLGLEGFE+WSSTE RQVNSLNLTSSDITIDESQ
Sbjct: 1321 ARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFEIWSSTEGRQVNSLNLTSSDITIDESQ 1380

Query: 1380 MEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTELISKLTAASEYYQISHDPYVITKPA 1439
            MEWLF+YCSDQ NL+QEV TS +SIQ+TR+S+KTELIS+LTAASEYYQISHDPYVITKPA
Sbjct: 1381 MEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTELISELTAASEYYQISHDPYVITKPA 1440

Query: 1440 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTNIDKVLKERKYSFAKDAKNIFMSVF 1499
            FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQ NIDKVLKERKY+ A DAKNIFMSVF
Sbjct: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQNNIDKVLKERKYTSANDAKNIFMSVF 1500

Query: 1500 STWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1559
            STWRNWEFSDVARSYIYGKLF  D+ KHK N IKKLLKCTMGSFYLTVYGEGYEVEHNFV
Sbjct: 1501 STWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560

Query: 1560 VADANLVVDLTPPVTSLSSNREETIEITGKVGSVKGKFSDKLLKLQDLIPLVVAVTEDDK 1619
            VADANLVVDLTPPVTSLS NREETIEITG++GSVKGKFSD+LLKLQDLIPLV AV EDDK
Sbjct: 1561 VADANLVVDLTPPVTSLSLNREETIEITGRIGSVKGKFSDRLLKLQDLIPLVAAVGEDDK 1620

Query: 1620 SDPKAELSKQFKMNTVLLVDKSEIQVVMDKTKVMSRTVGGRVSLLWENLKDSTSQAGSLV 1679
            SDPK ELSKQF+MNTVLLVDKSE+Q+VMD+TK+MSRTVGGRVSLLWENLKDSTSQAGS+V
Sbjct: 1621 SDPKTELSKQFRMNTVLLVDKSELQLVMDETKLMSRTVGGRVSLLWENLKDSTSQAGSVV 1680

Query: 1680 IFSQKSEVWLKHGSTILGEAQLCDFSILATTEAWSHKPTILVNNQCADLHFRAMSTTEQM 1739
            IFSQKSEVWLKH S ILGEAQL DFSILATTEAWSHKPTIL+NNQCADLHFRAMS+TEQ 
Sbjct: 1681 IFSQKSEVWLKHASIILGEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMSSTEQT 1740

Query: 1740 VNAITEIKESVLKVKEQIKFKPKSKNKSQFVGSRINTVLSCYFSNVSSEIMPLSPFYIRH 1799
            V AITEI+ES LK+KE+IKFKPKSK KSQFVG +INTVL+CYFSNVSSEIMPLSPFYIRH
Sbjct: 1741 VTAITEIRESALKIKERIKFKPKSKKKSQFVGQKINTVLTCYFSNVSSEIMPLSPFYIRH 1800

Query: 1800 EAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGFSKEAYSLIN 1859
            EAKQLDIYFNKFGSNEIL+SIWDTDFFMTSHQTKEQYLRFSFGDIEIKGG SKE YSLIN
Sbjct: 1801 EAKQLDIYFNKFGSNEILISIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLIN 1860

Query: 1860 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGIXXXXXXXXXXXTTDPMNAKKETPAKMI 1919
            VDISISMIKLTFSEPRRIVNSFLQDEKLASQGI           +++    +K+ PA MI
Sbjct: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLCSLKSLFFSSNIPKKEKQVPALMI 1920

Query: 1920 NWTLDTNISYFGILVPVASTYFVFELHMXXXXXXXXXXXXXPEQTRLTGQLSIENILFLI 1979
            NWTLDT+ISYFGIL+PVASTYFVFELHM             PE+T++TGQ SIENILFLI
Sbjct: 1921 NWTLDTSISYFGILIPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLI 1980

Query: 1980 KERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLD 2039
            KERSLPIGLSK+LDFSIKVSTLQRT DTEQSFQVESSHFRVCLSPDSLLRL+WGA+KLLD
Sbjct: 1981 KERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLD 2040

Query: 2040 MVQYYSKRHAPNIWNIRMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGDDPGLM 2099
            +  YY+K HAPNIWNI+MFTGKSDKPKEIP+NFRSIHILSYKFCIGWLFQYG G DPGLM
Sbjct: 2041 LGHYYTKHHAPNIWNIKMFTGKSDKPKEIPLNFRSIHILSYKFCIGWLFQYGTGSDPGLM 2100

Query: 2100 FGYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFK 2159
             GYNRLFSAYE+DFGKFT+VD+FFSV+NGNTSSTFFSEGNEK+KYNRSFLPNMQISYWFK
Sbjct: 2101 LGYNRLFSAYERDFGKFTVVDSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFK 2160

Query: 2160 RCGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAFQELKKNILDMPHESNMENSSP 2219
            RCGELKDWFFRFHGEALDVNF+PSFMDVIDSTLQS+RAFQELK+NILD+   S+ E+S+ 
Sbjct: 2161 RCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSMRAFQELKRNILDVSENSHSEDSNI 2220

Query: 2220 DAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTIN 2279
             AA + ENA +SLAPFL+NIRSVN NFKYDGGVFRVYTY+DIEAKSEPSFE+KSPVVTIN
Sbjct: 2221 YAASSVENAPSSLAPFLNNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTIN 2280

Query: 2280 CTYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEKKPNFT 2339
            CTYKHDE K +PH+IRTLITVDPTHNTLYAGCAPLLMEFSESLQ MIKKHST E KPNFT
Sbjct: 2281 CTYKHDEDKVRPHKIRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDE-KPNFT 2339

Query: 2340 KPSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSE 2399
            KPS QNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFS+TTNEFDSE
Sbjct: 2340 KPSPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSE 2399

Query: 2400 QPLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVFF 2459
             PL FSLTLE TKASIKHIFSREVSTSFEVGFMDLT+LFTHPDVISMYG  LVSD++VFF
Sbjct: 2400 HPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFF 2459

Query: 2460 NVKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNMSTLSSNSNVDVGTEIPWCFTLIFT 2519
            NVKQLQNLYLFLDIWRFSSILHTRP QR  NK ++M +L+S S+VD+GTEIPWCFTLIFT
Sbjct: 2460 NVKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGIDMHSLTSTSHVDLGTEIPWCFTLIFT 2519

Query: 2520 NLSGDVDLGPSLGVISLRSQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANA 2579
            N+SGDVDLGPSLGVISLR+QRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANA
Sbjct: 2520 NVSGDVDLGPSLGVISLRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANA 2579

Query: 2580 SWVSEVKWPLENSKNTHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSKG 2639
            SW+SEVKW  E  KNTHPLVSTSLNIDD+A+KAAFDYHMFLIGTINNI F LHNEKD+KG
Sbjct: 2580 SWLSEVKWSPEKGKNTHPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKG 2639

Query: 2640 ILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPSESKQP 2699
            +LPDLLQVSFSSDEI LSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNP ES+QP
Sbjct: 2640 VLPDLLQVSFSSDEIILSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQP 2699

Query: 2700 ILYKDILRSLKLLRTDLSVNISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKT 2759
            +LYKDILRSLKLLRTDLSV+ISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKT
Sbjct: 2700 VLYKDILRSLKLLRTDLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKT 2759

Query: 2760 DLQLQVLDVSAALSTSKEELDEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQE 2819
            DLQLQVLDVSAALSTSKEELDEE+GASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQE
Sbjct: 2760 DLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQE 2819

Query: 2820 EKTNNLEYLFACSFSDKISVRWNLGPINFIKEMWTTHVKALAVRRSQTANISFGQTXXXX 2879
            EKTNNLEYLFACSFSDKISVRWNLGP+NFIKEMWTTHVKALAVRRSQ ANISFGQT    
Sbjct: 2820 EKTNNLEYLFACSFSDKISVRWNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQTEEEL 2879

Query: 2880 XXXXXXXXNASKFNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPV 2939
                     ASKFNYIALEEPQIEVPQIRDLG+ATPPMEWFGVNRKR PKFTHQTAVIPV
Sbjct: 2880 EESINKEETASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPV 2939

Query: 2940 QKLVYLAEKQYVKILDDTH 2958
            QKLVYLAEKQYVKILDDTH
Sbjct: 2940 QKLVYLAEKQYVKILDDTH 2958

>YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}
            CSF1Protein required for fermentation at low temperature;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 2958

 Score = 5361 bits (13906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2588/2959 (87%), Positives = 2753/2959 (93%), Gaps = 2/2959 (0%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60
            MEA+SQLRGVPLTHQKDFSWVFLVDWILTV+ CLT IFYMGRIYAYLVSFILEWLLWKRA
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNS 120
            KIKINVETLR+SLLGGRI+FK+LSVIHKDYTIS+LEGSLTWKYWLLNCRKAELIEN K+S
Sbjct: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSS 120

Query: 121  SGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180
            SGK  +LPCK  +ECEGLE FIYNRT+AYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG
Sbjct: 121  SGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180

Query: 181  SSADKLDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELKLNRGSLLLGNK 240
            SSADKLDEDLSESAYTTNSD+SI+NDRDYQET+IGK+PK L F PIELK +RGSLLLGNK
Sbjct: 181  SSADKLDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFSRGSLLLGNK 240

Query: 241  FTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLKFKL 300
            FTPSVMILSYE+G+GIIDVLPPKERLDLYRNKT +E KNFEISIKQNIGYDDAIGLKFK+
Sbjct: 241  FTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKI 300

Query: 301  DTGKVSKLWKTFVRVLRVVTKPVIPRRGK-KAGPSDDAFFQKWKGLSLYKASAGDAKTSD 359
            D GKVSKLWKTFVRV ++VTKPV+P++ K  AG SDD F+ KWKGLSLYKASAGDAK SD
Sbjct: 301  DRGKVSKLWKTFVRVFQIVTKPVVPKKTKKSAGTSDDNFYHKWKGLSLYKASAGDAKASD 360

Query: 360  LDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPP 419
            LDD+EFD T+HEYAKFTSILKCPKVT++YDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPP
Sbjct: 361  LDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPP 420

Query: 420  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNIL 479
            DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRR+YTLFRMNI 
Sbjct: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIYTLFRMNIS 480

Query: 480  IMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGF 539
            IMEDTTWRIPTRESSKD EFL+HYK+T+EEYRPFGWMDLRFCKDTYANFNISVCPTV+GF
Sbjct: 481  IMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNISVCPTVQGF 540

Query: 540  KNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQLEAFLL 599
            +N+FHVHF+ETEIRSSVNHDILLKSKVFD+DGDIGYPLGWNS  IWIINMKSEQLEAFLL
Sbjct: 541  QNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMKSEQLEAFLL 600

Query: 600  REHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNPLDFNEN 659
            REHITLVADTLSDFSAGDPTPYELFRPFVYK+NWEM+GYSIYLNVNDHNIVNNPLDFNEN
Sbjct: 601  REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660

Query: 660  CYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 719
            CYLSLHGDKL+ID+TVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR
Sbjct: 661  CYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720

Query: 720  SYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFGEFFNFV 779
            +YDFTIKG YLLYSELDIDNVD+L I C S STVLHCYGFVMRYL NVKMNYFGEFFNFV
Sbjct: 721  AYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780

Query: 780  TSEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGSMKNDAEDNGPMKRSDLKRTTNE 839
            TSEEYTGVLGAREVG+V TKSSV DLAST+DS YQN S+KN++ED GPMKRSDLKRTTNE
Sbjct: 781  TSEEYTGVLGAREVGDVTTKSSVADLASTVDSGYQNSSLKNESEDKGPMKRSDLKRTTNE 840

Query: 840  TDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHV 899
            TDIWFTFSVW+GALILPETIYSFDPCIALHF ELVVDFRSCNYYMDIMAVLNGTSIKRHV
Sbjct: 841  TDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYMDIMAVLNGTSIKRHV 900

Query: 900  SKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPTYFCQWDINLGELNINS 959
            SKQINEVFDFIRRNNGADEQEHG+LSDLTIHGHRMYGLPPTEPTYFCQWDINLG+L I+S
Sbjct: 901  SKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLCIDS 960

Query: 960  DIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAERINISLNDPVMKSQSI 1019
            DIEF+KGFF SFYK+GFGYNDLENILLYDTETINDMTSLTVH E+I I L DPVMKSQS+
Sbjct: 961  DIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVEKIRIGLKDPVMKSQSV 1020

Query: 1020 VSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSFLNFETKLRFTNFGQY 1079
            +S ES+LFTLIDFENE+YSQRID+K+PKLT+SL+CVMGDG +TSFL FETKLRFTNF QY
Sbjct: 1021 ISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVDTSFLKFETKLRFTNFEQY 1080

Query: 1080 KDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXX 1139
            KD DKKRSEQRRYI ++DSPYHRCPFLLPLFYQDSDTYQ LYG                 
Sbjct: 1081 KDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLYGAIAPSSSIPTLPLPTLP 1140

Query: 1140 XXXXYIIEDIVGEYATLLEATNPFKDLFAETPSTVEPLRASFTXXXXXXXXXPLEFKPVA 1199
                YIIEDIVGEYATLLE TNPFK++FAETPST+EP RASF+         P  FKPVA
Sbjct: 1141 DTIDYIIEDIVGEYATLLETTNPFKNIFAETPSTMEPSRASFSEDDNDEEADPSSFKPVA 1200

Query: 1200 FTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMVQVLDDIEIGIVKRLSN 1259
            FTE+ NHERDNYV+DVSYILLD+DPLLF+F KSLLEQ YSE+MVQVLDDIEIGIVKRLSN
Sbjct: 1201 FTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQLYSENMVQVLDDIEIGIVKRLSN 1260

Query: 1260 LQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDRINYQMSEKSLEKNRTSKSLEVAVL 1319
            LQEGI SISNIDIH+AYLNLIWQETGEEGFELYLDRI+YQMSEKSLEKNRT+K LEVA L
Sbjct: 1261 LQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTNKLLEVAAL 1320

Query: 1320 AKVKTVRATVNQKKNPELSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1379
            AKVKTVR TVNQKKNP+LSEDRPPALSLG+EGFEVWSSTEDRQVNSLNLTSSDITIDESQ
Sbjct: 1321 AKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1380

Query: 1380 MEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTELISKLTAASEYYQISHDPYVITKPA 1439
            MEWLFEYCSDQGNLIQEV TS NSIQNTRS++KTELISKLTAASEYYQISHDPYVITKPA
Sbjct: 1381 MEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELISKLTAASEYYQISHDPYVITKPA 1440

Query: 1440 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTNIDKVLKERKYSFAKDAKNIFMSVF 1499
            FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQ+NID+VLKE+KY+ AKDAKNIFMSVF
Sbjct: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNIDEVLKEKKYTSAKDAKNIFMSVF 1500

Query: 1500 STWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1559
            STWRNWEFSDVARSYIYGKLF A++ KHK N IKKLLKCTMGSFYLTVYGEGYEVEHNFV
Sbjct: 1501 STWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560

Query: 1560 VADANLVVDLTPPVTSLSSNREETIEITGKVGSVKGKFSDKLLKLQDLIPLVVAVTEDDK 1619
            VADANLVVDLTPPVTSL SNREETIEITG+VGSVKGKFSD+LLKLQDLIPL+ AV EDDK
Sbjct: 1561 VADANLVVDLTPPVTSLPSNREETIEITGRVGSVKGKFSDRLLKLQDLIPLIAAVGEDDK 1620

Query: 1620 SDPKAELSKQFKMNTVLLVDKSEIQVVMDKTKVMSRTVGGRVSLLWENLKDSTSQAGSLV 1679
            SDPK ELSKQFKMNTVLLVDKSE+Q+VMD+TK+MSRTVGGRVSLLWENLKDSTSQAGSLV
Sbjct: 1621 SDPKKELSKQFKMNTVLLVDKSELQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLV 1680

Query: 1680 IFSQKSEVWLKHGSTILGEAQLCDFSILATTEAWSHKPTILVNNQCADLHFRAMSTTEQM 1739
            IFSQKSEVWLKH S ILGEAQL DFS+LATTEAWSHKPTIL+NNQCADLHFRAMS+TEQ+
Sbjct: 1681 IFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAWSHKPTILINNQCADLHFRAMSSTEQL 1740

Query: 1740 VNAITEIKESVLKVKEQIKFKPKSKNKSQFVGSRINTVLSCYFSNVSSEIMPLSPFYIRH 1799
            V AITEI+ES++ +KE+IKFKPKSK KSQFV  +INTVLSCYFSNVSSE+MPLSPFYIRH
Sbjct: 1741 VTAITEIRESLMMIKERIKFKPKSKKKSQFVDQKINTVLSCYFSNVSSEVMPLSPFYIRH 1800

Query: 1800 EAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGFSKEAYSLIN 1859
            EAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGG S+E YSLIN
Sbjct: 1801 EAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISREGYSLIN 1860

Query: 1860 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGIXXXXXXXXXXXTTDPMNAKKETPAKMI 1919
            VDISISMIKLTFSEPRRIVNSFLQDEKLASQGI           +++    +K+ P+ MI
Sbjct: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLYSLKPLFFSSNLPKKEKQAPSIMI 1920

Query: 1920 NWTLDTNISYFGILVPVASTYFVFELHMXXXXXXXXXXXXXPEQTRLTGQLSIENILFLI 1979
            NWTLDT+I+YFG+LVPVASTYFVFELHM             PE+T++TGQ SIENILFLI
Sbjct: 1921 NWTLDTSITYFGVLVPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLI 1980

Query: 1980 KERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLD 2039
            KERSLPIGLSKLLDFSIKVSTLQRT DTEQSFQVESSHFRVCLSPDSLLRL+WGA+KLLD
Sbjct: 1981 KERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLD 2040

Query: 2040 MVQYYSKRHAPNIWNIRMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGDDPGLM 2099
            +  YYS+RHAPNIWN +MFTGKSDK KE+PINFRSIHILSYKFCIGW+FQYGAG +PGLM
Sbjct: 2041 LSHYYSRRHAPNIWNTKMFTGKSDKSKEMPINFRSIHILSYKFCIGWIFQYGAGSNPGLM 2100

Query: 2100 FGYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFK 2159
             GYNRLFSAYEKDFGKFT+VDAFFSV+NGNTSSTFFSEGNEK+KYNRSFLPNMQISYWFK
Sbjct: 2101 LGYNRLFSAYEKDFGKFTVVDAFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFK 2160

Query: 2160 RCGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAFQELKKNILDMPHESNMENSSP 2219
            RCGELKDWFFRFHGEALDVNF+PSFMDVI+STLQS+RAFQELKKNILD+      EN + 
Sbjct: 2161 RCGELKDWFFRFHGEALDVNFVPSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDNS 2220

Query: 2220 DAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTIN 2279
             A+ + E+AS+SLAPFLDNIRSVN NFKYDGGVFRVYTY+DIE KSEPSFE+KSPVVTIN
Sbjct: 2221 YASTSVESASSSLAPFLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTIN 2280

Query: 2280 CTYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEKKPNFT 2339
            CTYKHDE K KPH+ RTLITVDPTHNTLYAGCAPLLMEFSESLQ MIKKHST E KPNFT
Sbjct: 2281 CTYKHDEDKVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDE-KPNFT 2339

Query: 2340 KPSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSE 2399
            KPS+QNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSM TNEFDSE
Sbjct: 2340 KPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSE 2399

Query: 2400 QPLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVFF 2459
            QPL FSLTLE TKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGT LVSD+SVFF
Sbjct: 2400 QPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFF 2459

Query: 2460 NVKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNMSTLSSNSNVDVGTEIPWCFTLIFT 2519
            NVKQLQNLYLFLDIWRFSSILHTRP QR  NKE+ MS+L+S +  D GTEIPWCFTLIFT
Sbjct: 2460 NVKQLQNLYLFLDIWRFSSILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFT 2519

Query: 2520 NLSGDVDLGPSLGVISLRSQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANA 2579
            N+SGDVDLGPSLG+ISLR+QRTWLATDHY+EKRQLLHAFTDGISLTSEGRLSGLFEVANA
Sbjct: 2520 NVSGDVDLGPSLGMISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANA 2579

Query: 2580 SWVSEVKWPLENSKNTHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSKG 2639
            SW+SEVKWP E SKNTHPLVSTSLNIDD+AVKAAFDYHMFLIGTI+NI FHLHNEKD+KG
Sbjct: 2580 SWLSEVKWPPEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKG 2639

Query: 2640 ILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPSESKQP 2699
            +LPDLLQVSFSSDEI LSSTALV ANILDIYNTIVRMRQDNKISYMETLRDSNP ES+QP
Sbjct: 2640 VLPDLLQVSFSSDEIILSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQP 2699

Query: 2700 ILYKDILRSLKLLRTDLSVNISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKT 2759
            ILYKDILRSLKLLRTDLSVNISS KVQISPISLFDVEVLV+RIDKVSIRSETHSGKKLKT
Sbjct: 2700 ILYKDILRSLKLLRTDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKT 2759

Query: 2760 DLQLQVLDVSAALSTSKEELDEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQE 2819
            DLQLQVLDVSAALSTSKEELDEE+GASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQE
Sbjct: 2760 DLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQE 2819

Query: 2820 EKTNNLEYLFACSFSDKISVRWNLGPINFIKEMWTTHVKALAVRRSQTANISFGQTXXXX 2879
            EKTNNLEYLFACSFSDKISVRWNLGP++FIKEMWTTHVKALAVRRSQ ANISFGQT    
Sbjct: 2820 EKTNNLEYLFACSFSDKISVRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQTEEEL 2879

Query: 2880 XXXXXXXXNASKFNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPV 2939
                     ASKFNYIALEEPQIEVPQIRDLG+ATPPMEWFGVNRK+ PKFTHQTAVIPV
Sbjct: 2880 EESIKKEEAASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPV 2939

Query: 2940 QKLVYLAEKQYVKILDDTH 2958
            QKLVYLAEKQYVKILDDTH
Sbjct: 2940 QKLVYLAEKQYVKILDDTH 2958

>NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2952

 Score = 3516 bits (9118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1666/2977 (55%), Positives = 2223/2977 (74%), Gaps = 51/2977 (1%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60
            M+AVSQ +GVPLT Q++FSW+FLV WILTVI  L+ IFY+GR  AY+++FILEWLLWK A
Sbjct: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60

Query: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIE----- 115
            K+K+N+++LRISLLGGRI+FK++++IHKD TISILEG++TW+YWL N RK E  E     
Sbjct: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120

Query: 116  -NEKNSSGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFP 174
               K +S KN +LPC+F++  EGLE F+YN+T+AYDN+I + SK+ER +FEK+LNE    
Sbjct: 121  TQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNE---- 176

Query: 175  EPFSDGSSADKLDE---DLSESAYTTNSDSSIINDRDYQE--TNIGKYPKGLSFFPIELK 229
            +  SD ++   +D+   D SES  T  S+SS  NDR +QE  T+   +   L F PI+  
Sbjct: 177  QILSDSATVKSMDDSQFDTSESTSTDKSESSATNDRVFQEEETDTSSF---LRFLPIQFL 233

Query: 230  LNRGSLLLGNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIG 289
            + RGSL+LGNKFTPS++I+S ++ + ++D   PKE+LDLY+ K   EL N E ++KQNIG
Sbjct: 234  VTRGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIG 293

Query: 290  YDDAIGLKFKLDTGKVSKLWKTFVRVLRVVTKPV-IPRRGKKAGPSDDAFFQKWKGLSLY 348
            +D+ + +KFKLD GKVS++W  F R+L ++ KP+      ++    +D F  KW+GL+LY
Sbjct: 294  FDEDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLALY 353

Query: 349  KASAGDAKTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDID 408
            K +    + +D+DDIEFDF +HEYAKF+SILK PKVT +   D+PG+VPHGAHPTI  +D
Sbjct: 354  KGTGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLD 413

Query: 409  GPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSR 468
            GPDVGN+GAPPD++LD+QI GGS+C+GPWAQRQ  HL ++LSPVVSRTAKP+K+L PG R
Sbjct: 414  GPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCR 473

Query: 469  RVYTLFRMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANF 528
            R+YT  ++ + IM+D TWRIPTRESSKD EFLQHY++T+ EYRPFGW+DL+F K+T  N 
Sbjct: 474  RIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNT 533

Query: 529  NISVCPTVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIIN 588
              ++CPTV+GFKN+  +H  E E RSSVNHDILLK K FD D D  +PLGWN    W IN
Sbjct: 534  TFALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTIN 593

Query: 589  MKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHN 648
            + S Q+EAF+LREHITL+ADTL+DFS+G+PTPYELFRPF+Y +NW++DGYS+YLNVNDHN
Sbjct: 594  LNSSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHN 653

Query: 649  IVNNPLDFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTL 708
            IVNNPLDFNENCYLS HGD+L++D  +P+ SI   +TD+SY I TPMFR++LNTPPWNTL
Sbjct: 654  IVNNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRLLLNTPPWNTL 713

Query: 709  NEFMKHKEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVK 768
            NEFMKHKEVGRSYDF + G YL+YS+LDIDNVD++ ++CTS  T L CYGFV+RYLINVK
Sbjct: 714  NEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVK 773

Query: 769  MNYFGEFFNFVTSEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGSMKNDAED---- 824
            MNYFG+FF+FVTSEEYTG + A E        S  D +S    +   G   NDA      
Sbjct: 774  MNYFGDFFHFVTSEEYTGAIRANEDDMQYASESDDDRSSISSFDTMQG---NDAPGRRRL 830

Query: 825  NGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYM 884
            +  ++RSDLKRTTNETD+WFTF+VW GAL+LPETIY+ DPC+ LHF ELV+D RSCNYYM
Sbjct: 831  HTELQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYM 890

Query: 885  DIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPTY 944
            D++A +N  SIKR+VSK  +E+F+ I +NNG +   HG LS LTIHGHRMYGLPP EPTY
Sbjct: 891  DLLANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTY 950

Query: 945  FCQWDINLGELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAER 1004
            FCQWD +LG L+I SDIEFL+GFF+SF ++GFGY DLENILLY+ ET +DMTS+TV+ E+
Sbjct: 951  FCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEK 1010

Query: 1005 INISLNDPVMKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSF 1064
            +++ L +P +   +   + +L FT IDFENE+YS R+D+ +P L  SL     DGT    
Sbjct: 1011 LSVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKKL 1070

Query: 1065 LNFETKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGXX 1124
               ETK++ TNF Q +D D+ R  QR YI ++D+PYHRC F+LP  YQD++ YQ+L+G  
Sbjct: 1071 FTLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAI 1130

Query: 1125 XXXXXXXXXXXXXXXXXXXYIIEDIVGEYATLLEATNPFKDLFAETPSTVEPLRASFTXX 1184
                               +IIED++GE+  LLE ++PF+  F++     +      +  
Sbjct: 1131 APSSSLPPLPVPLIPSTTDFIIEDLLGEFQDLLETSSPFRMPFSD-----QDYATDVSDD 1185

Query: 1185 XXXXXXXPLEFK-PVAFTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMV 1243
                   PLEF  P    +    ERD+++IDVS+I ++I P +     + L  F +E++V
Sbjct: 1186 ETEEDIDPLEFNTPSEAIQNDKCERDSFIIDVSFISIEICPDILDSIGTFLMLFSTENIV 1245

Query: 1244 QVLDDIEIGIVKRLSNLQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDRINYQMSEK 1303
            Q++DDIEI  V RLSNL+EG   ++N+ I++ YL+L W    + G  +YLDRI++ M EK
Sbjct: 1246 QIIDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDFAMCEK 1305

Query: 1304 SLEKNRTSKSLEVAVLAKVKTVRATVNQKKNPELSEDRPPALSLGLEGFEVWSSTEDRQV 1363
            ++E+N+  K +E+ VL K+++VR TVNQ      +E+RPPALSL +EG+E+WSST + QV
Sbjct: 1306 TVEENKEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSSTVEDQV 1365

Query: 1364 NSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTELISKLTAAS 1423
            NSLN+ S+DIT+DE+Q+EWLF Y  +QG  IQ++  + ++IQ  +  ++ ELIS LTAAS
Sbjct: 1366 NSLNILSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELISSLTAAS 1425

Query: 1424 EYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTNIDKVLKER 1483
            EYYQISHDPYVITKPAFI RLS+GHVRENRSWKIITRLRHILTYLP+DW + I++ L + 
Sbjct: 1426 EYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINRSLTQS 1485

Query: 1484 KYSF-AKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKLLKCTMGS 1542
            K +   +DAK IF+SVFS WRNWEFSD+ARSYIY KLFL  H+  + ++ KK +   + S
Sbjct: 1486 KTAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHTTKKSITIKIAS 1545

Query: 1543 FYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLSSNREETIEITGKVGSVKGKFSDKLL 1602
            F++TVY  GYEVEHNF++   NL+++   P +  S +RE    ITG +G+ KGK SDK++
Sbjct: 1546 FFVTVYSAGYEVEHNFIITRTNLLLETNSPTSDSSLSRETIFNITGTLGTAKGKLSDKII 1605

Query: 1603 KLQDLIPLVVAVTEDDKSDPKAELSKQFKMNTVLLVDKSEIQVVMDKTKVMSRTVGGRVS 1662
             +++L+P  + +T+  KS    +  K FK+NT++L ++ E+Q+ +  T+++SR  G R+S
Sbjct: 1606 MIKNLLP-SLKITDGGKSKETFDFVKSFKLNTLILCERGELQIDIGNTRLVSRVFGARLS 1664

Query: 1663 LLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDFSILATTEAWSHKPTILVN 1722
            +LWE+ KD TSQA SL +++Q++E+ LKH +  L E Q+ DFS++ TTE+WS+KPTILVN
Sbjct: 1665 MLWESPKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPTILVN 1724

Query: 1723 NQCADLHFRAMSTTEQMVNAITEIKESVLKVKEQI----KFKPKSKNKSQFVGSRINTVL 1778
            +QC+DLH  AM+ T+ +V +I EI E++ ++++ +    + +  +K +S     ++NT+L
Sbjct: 1725 SQCSDLHLMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEKITKVESHGPKPKVNTIL 1784

Query: 1779 SCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLR 1838
            +C+F+N+S E+MP+SPF+IRHEAKQLDIYFN+FGSNEILLS+WD D ++TSH TK+QY R
Sbjct: 1785 TCFFTNISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQYFR 1844

Query: 1839 FSFGDIEIKGGFSKEAYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGIXXXXXX 1898
            FSFGD+++KG    + Y  IN+ +S S++KLT S+ ++++ SFLQDEK+ ++ I      
Sbjct: 1845 FSFGDLQLKGNMVNDPYH-INLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDFITL 1903

Query: 1899 XXXXXTTDPMNAKKETPAKMINWTLDTNISYFGILVPVASTYFVFELHMXXXXXXXXXXX 1958
                 + +   +K E      +W++DTNI+YFG+L P+ S YF+FEL M           
Sbjct: 1904 DLFGLSKN-QKSKPEKDNNKFSWSIDTNINYFGLLAPIGSAYFLFELRM-LLASLTKMGS 1961

Query: 1959 XXPEQTRLTGQLSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHF 2018
              P Q+ ++GQ S+EN+LF IKER+LP+ LSKLLDFSIKVS LQ+  +T  ++Q+ESSHF
Sbjct: 1962 DIPNQSDISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHF 2021

Query: 2019 RVCLSPDSLLRLIWGAYKLLDMVQYYSKRHAPNIWNIRMFTGKSDKPKEIPINFRSIHIL 2078
            RVCLSP+SL+RL+W   ++   +QYY   H  N W++R       K  ++P+N  S HIL
Sbjct: 2022 RVCLSPESLVRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPKAPDLPLNVPSFHIL 2081

Query: 2079 SYKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEG 2138
            SY FC+GWLF   +  +PGL+ GYNRLFSAYEK+ GK T+VD FFS++NGN+S  FFSEG
Sbjct: 2082 SYNFCVGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEG 2141

Query: 2139 NEKEKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAF 2198
             EK+KYNRS+LPNMQISYWFK  G ++D F RFHGEALDV FL S++DVI+S L S++ F
Sbjct: 2142 KEKDKYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTF 2201

Query: 2199 QELKKNIL-DMPHESNMENSSPDAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYT 2257
            QELKK+++  +P +  + +             N+L+PFL NIRS++C FKYDGGVF++++
Sbjct: 2202 QELKKDLIPGLPKKQKVNDDKTLEL-------NTLSPFLANIRSISCQFKYDGGVFKIFS 2254

Query: 2258 YDDIEAKSEPSFELKSPVVTINCTYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLME 2317
             +D E +SEPSFE+ SP V I+  YKH E++ K H IR+LI ++ THN LYA CAPLL +
Sbjct: 2255 LEDAETQSEPSFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCAPLLSD 2314

Query: 2318 FSESLQNMIKKHSTGEKKPNFTKPSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAK 2377
            F E +Q M+KKHS+ E+    +KPS+QN+DYKRLLD FD+A+K+TSAKQQLSLSCEPKAK
Sbjct: 2315 FFERIQGMVKKHSSSEES-TLSKPSSQNLDYKRLLDSFDIALKITSAKQQLSLSCEPKAK 2373

Query: 2378 VQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLL 2437
            VQAD+GF+SF+F++TTN+ D+ +PL FSL++E+T+ASIKHIFSRE STS  V F+D+TL+
Sbjct: 2374 VQADIGFQSFIFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLM 2433

Query: 2438 FTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNMST 2497
            FTHPDVI+++GT+L+S++++FFNVKQLQNLYLFLDIWR S +L ++P       + + S+
Sbjct: 2434 FTHPDVINVHGTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTD-SS 2492

Query: 2498 LSSNSNVDVGTEIPWCFTLIFTNLSGDVDLGPSLGVISLRSQRTWLATDHYDEKRQLLHA 2557
            LS     D  + IPWCFTLIFTN+ GDVDLGPSLGVIS++ +RTW ATDHY   R++LHA
Sbjct: 2493 LSIAQLSDPESIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHA 2552

Query: 2558 FTDGISLTSEGRLSGLFEVANASWVSEVKWPLENSKNTHPLVSTSLNIDDVAVKAAFDYH 2617
            FTDG SL+S+GRLSG+FE+  ASW+SEV WP + + N HPLVS ++NID+++ KAAFDYH
Sbjct: 2553 FTDGTSLSSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYH 2612

Query: 2618 MFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMR 2677
            MFLIG INN R HLH+EKD  G++PDLL+V+F  + ITL STALVAANILDIYNT +RMR
Sbjct: 2613 MFLIGAINNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMR 2672

Query: 2678 QDNKISYMETLRDSNPSESKQPILYKDILRSLKLLRTDLSVNISSLKVQISPISLFDVEV 2737
            QDNKISY+ETLR+SN +ESK PI Y DILRSL LL+TD+SV+I +L +QISPI+LFDVEV
Sbjct: 2673 QDNKISYIETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEV 2732

Query: 2738 LVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYMHYAS 2797
            LV+ I+ +S RSETHSGKKL T+L++QV D S +LSTSKEE+DE   + I++ +Y+ YAS
Sbjct: 2733 LVITIESISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYAS 2792

Query: 2798 KIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPINFIKEMWTTHV 2857
            KIVGGTII+IPKL V MTT QEEK++ LEYL+ C F DK+SVRWNLGPINFIKEMWTTH+
Sbjct: 2793 KIVGGTIIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHI 2852

Query: 2858 KALAVRRSQTANISFGQTXXXXXXXXXXXXNASKFNYIALEEPQIEVPQIRDLGEATPPM 2917
            +A+AVRRSQ   +  GQ+            N S+F Y+ALE P+I++PQIRDLG+ATPPM
Sbjct: 2853 RAIAVRRSQVVGVLDGQSEEDVEKRIKEEENFSRFKYVALEPPRIDMPQIRDLGDATPPM 2912

Query: 2918 EWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954
            EWFGVNRKR P FTHQTAV  VQKLVY AE++Y  IL
Sbjct: 2913 EWFGVNRKRFPAFTHQTAVFLVQKLVYSAEREYANIL 2949

>NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2959

 Score = 3330 bits (8633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1601/2969 (53%), Positives = 2168/2969 (73%), Gaps = 34/2969 (1%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60
            M+A+SQ + +PLT QKDFSWVFLVDWIL +I  L  IFY+ R  AY +SFILEW LWKR+
Sbjct: 1    MDAISQFQRIPLTKQKDFSWVFLVDWILILIVTLFVIFYLSRTLAYGISFILEWFLWKRS 60

Query: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKA--ELIENEK 118
             +KIN+E++RIS LGGR++FK++ +IH+DYTIS LE ++TW+YWLLN RK+  +  E   
Sbjct: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPD 120

Query: 119  NSSGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEPFS 178
             +S  +++LPC+F LE EGLE F+YNR +AYDN+I   SK+ER++FEK+LNE  F +  +
Sbjct: 121  KASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTDSKA 180

Query: 179  DGSSAD-KLDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELKLNRGSLLL 237
            + S+++   +ED  ESA T  SDSS  NDR +QE  + + P+ L F PI+ K++ GSL++
Sbjct: 181  EVSNSESNSEEDTFESAGTFKSDSSTTNDRVFQE-ELSERPQFLDFLPIDFKVSHGSLII 239

Query: 238  GNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLK 297
            GNKFTPS+MI S  +  G+IDV  P E+LDLY+ +  L+ K F I IKQNIG+++   +K
Sbjct: 240  GNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEFSMK 299

Query: 298  FKLDTGKVSKLWKTFVRVLRVVTK--PVIPRRGKKAGPSDDAFFQKWKGLSLYKASAGDA 355
            FK+D  +VSK+W+ F +VL        +   R  K    +D F++KW+GLSLY+ +    
Sbjct: 300  FKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVS-EEDPFYEKWRGLSLYRGTIFGK 358

Query: 356  KTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVGNN 415
               D++DI+FDF +HEYAKF+SI++ P+   +++ D+PG+VPHGAHPT+   DGPDVGN+
Sbjct: 359  SNDDINDIDFDFANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTATDGPDVGNS 418

Query: 416  GAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFR 475
            GAPP+F+L++QI GGSIC+GPWAQRQ++ L R+LSP+ SR AKP K+L PG  R+YT F+
Sbjct: 419  GAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQFK 478

Query: 476  MNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVCPT 535
              I   E+TTWRIPTRESSKD EFLQHY++T+EEYRPFGW+DL+F KDTY    ++ CPT
Sbjct: 479  TTISTTEETTWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQCPT 538

Query: 536  VEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQLE 595
             EGFKN   +H  + EIRSSVNHDILLK K F+   DIG+PLGWN    W I+++S QLE
Sbjct: 539  KEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLESTQLE 598

Query: 596  AFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNPLD 655
            AF+LREHITL+ADTL+DFS+G+PTPYELFRPFVY++NW+++GYS+YLNVNDHNIVNNPLD
Sbjct: 599  AFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNNPLD 658

Query: 656  FNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHK 715
            FNENCYLS HGD L ID+ VP+  +   +T++SY I TPMFR++LNTPPWNTLNEFMK+K
Sbjct: 659  FNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMKNK 718

Query: 716  EVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFGEF 775
            EVGRS+DF I G YL+YSELDIDNVD++ I C+S STVL CYGFV+RYL NVKMNYFG+F
Sbjct: 719  EVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYFGDF 778

Query: 776  FNFVTSEEYTGVLGAREVGEVVTKSSVVDLASTLDS--EYQNGSMKNDAEDNGPMKRSDL 833
            F+FVTSEEYTG + A EV    T   + +  ++L S    +  S++ +   +  +KRSDL
Sbjct: 779  FHFVTSEEYTGEIRANEVQNQFTDRQLYEDKASLSSYESIETSSVRKEQTGDSKIKRSDL 838

Query: 834  KRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYMDIMAVLNGT 893
            KR TNETD+WFTF+VW GA++LPETIY+ DPCI LHF EL++DFRSCNYYMD++A +N  
Sbjct: 839  KRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYYMDLLASMNDI 898

Query: 894  SIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPTYFCQWDINLG 953
            S++R++ KQ NE+++ +R++NG   +++G LSD+ IH HRMYGLPP EPTYFCQWD +LG
Sbjct: 899  SLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPTYFCQWDFSLG 958

Query: 954  ELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAERINISLNDPV 1013
             L++N DI FL+GF TSF K+ FG  DLENILLY+ E I+DMTSLTV  ++I+I + +  
Sbjct: 959  TLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKKISIMIRESE 1018

Query: 1014 MKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSFLNFETKLRF 1073
            M +  + + E L F+ I+FENE+Y  R+D+++P   + +  + G         FETK+  
Sbjct: 1019 MDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMNG-AKKEKLFEFETKVNL 1077

Query: 1074 TNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGXXXXXXXXXXX 1133
            +NF +  D    +S+Q+ YI ++D+PYHRC F+LP   QDS+ YQ L+G           
Sbjct: 1078 SNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFGSIAPSSSLPPL 1137

Query: 1134 XXXXXXXXXXYIIEDIVGEYATLLEATNPFKDLF--AETPSTVEPLRASFTXXXXXXXXX 1191
                      YI++D++G +  +LE+ NPF+  F  A +P    P   S T         
Sbjct: 1138 PIPLLPATIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNPFEGSDTESDEELD-- 1195

Query: 1192 PLEFKPVAFTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMVQVLDDIEI 1251
            PLEFK     +      DN+VID+SY  L I+P L+ +  +  E F S+D+VQ+LDDIEI
Sbjct: 1196 PLEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCSQDIVQILDDIEI 1255

Query: 1252 GIVKRLSNLQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDRINYQMSEKSLEKNRTS 1311
            GIV  LS+LQEGI +  NI + + YL+L W +    G  LYLDRI+ +M +K LE+N  +
Sbjct: 1256 GIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLEMCQKMLEENNET 1315

Query: 1312 KSLEVAVLAKVKTVRATVNQKKNPELSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSS 1371
            K  EV  L K+++VRAT+N+  +   +++RPPALSL +EG E+WS   + QVNSLN+ S+
Sbjct: 1316 KITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWSCITNAQVNSLNILSA 1375

Query: 1372 DITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTELISKLTAASEYYQISHD 1431
            DITIDE+Q++WLF+Y   Q  L QE+ +++ SIQ +RS+T+ +L+SKL  ASEYYQISHD
Sbjct: 1376 DITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVSKLAVASEYYQISHD 1435

Query: 1432 PYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTNIDKVLKERKYSFAKDA 1491
            PYVITKPAFI RLS+GHVRENRSWKIITRLRHILTYLP DW   ID++  ++      D 
Sbjct: 1436 PYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRVIDEMRNQQDSHTLPDP 1495

Query: 1492 KNIFMSVFSTWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKLLKCTMGSFYLTVYGEG 1551
             N F+SVFS WRNWEFSD+ARSYIY  +F   H+K + NS++  +K  + S + TVY  G
Sbjct: 1496 GNAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIKLKLASLFFTVYSTG 1555

Query: 1552 YEVEHNFVVADANLVVDLTPPVTSLSSNREETIEITGKVGSVKGKFSDKLLKLQDLIPLV 1611
            YEVEHNF++   N+VV+  P ++  S  +E+ I +TG +G++KGK S KL+ L+ L+P  
Sbjct: 1556 YEVEHNFILTRTNVVVETLPAISDSSIIQEKIINVTGSLGTIKGKTSHKLINLKKLLP-- 1613

Query: 1612 VAVTEDDKSDPKAELSKQFKMNTVLLVDKSEIQVVMDKTKVMSRTVGGRVSLLWENLKDS 1671
              ++      P     + FK+N +LL ++SE+Q V+  +KVMSR  GG++S+LWE+ KD 
Sbjct: 1614 -ELSMKKNLKPSTPFLRCFKLNMLLLFERSELQFVLGASKVMSRVFGGKLSMLWESPKDL 1672

Query: 1672 TSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDFSILATTEAWSHKPTILVNNQCADLHFR 1731
             S+A S+ +++Q+SE+W+KH + IL E+Q+ +FSI+ T E+WS+KPT+LVN QC D+HFR
Sbjct: 1673 ASKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAESWSYKPTVLVNLQCTDIHFR 1732

Query: 1732 AMSTTEQMVNAITEIKESVLKVKEQIKFKPKS--KNKSQF--VGSRINTVLSCYFSNVSS 1787
            AM+ T+ +  ++ EI E++ ++++       S  +  SQ+  +  +IN VL+CYF+NV+ 
Sbjct: 1733 AMTATDVLAKSVGEIIENIKELEKLFYSDSDSGIQQISQYPVMEQKINMVLTCYFTNVNL 1792

Query: 1788 EIMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIK 1847
            EIMPLSPF  RH AKQLDIYFN+ GSN+++LS+WDTD F+ SH TKE+Y RFSFG+I++K
Sbjct: 1793 EIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKEEYFRFSFGNIQLK 1852

Query: 1848 GGFSKEAYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGIXXXXXXXXXXXTTDP 1907
            G   +     IN+D+S S++KLT  + RR++ SFLQDEK+  + +               
Sbjct: 1853 GNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQFSSLKLFQRKKPA 1912

Query: 1908 MNAKKETPAKMINWTLDTNISYFGILVPVASTYFVFELHMXXXXXXXXXXXXXPEQTRLT 1967
             + +K    + + W+L++NI+YFG+LVP++STYF+ ELHM              +   L+
Sbjct: 1913 PSTEKS--GRTVTWSLESNINYFGLLVPISSTYFILELHMLLMSLNKIQGISS-KYNGLS 1969

Query: 1968 GQLSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHFRVCLSPDSL 2027
            GQ SI+N+ FL+KE+SLP  LSK+LDFSIKVSTLQ+   T +SFQ+ES HFRVCLSP SL
Sbjct: 1970 GQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESPHFRVCLSPGSL 2029

Query: 2028 LRLIWGAYKLLDMVQYYSKRHAPNIWNIRMFTGKSDKPKEIPINFRSIHILSYKFCIGWL 2087
              ++W   + L  ++YY K H    W   +    ++   E+  +F S H+LSY FC+GWL
Sbjct: 2030 AHMLWRGNQALTNIRYY-KEHTSVAWEKVINFKNTNNSAEVQADFPSFHVLSYNFCVGWL 2088

Query: 2088 FQYGAGDDPGLMFGYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRS 2147
            F     ++PGL+ GY+RLFSAYEK+FGK T++DA+FSV+NG TS TFFS+G+EK++YNRS
Sbjct: 2089 FSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSKGHEKDRYNRS 2148

Query: 2148 FLPNMQISYWFKRCGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAFQELKKNILD 2207
            +LPNMQISYW K  G L+D + RFHGEALDVNFL SF+DVI+S+L+SI+ FQELK++++ 
Sbjct: 2149 YLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQKFQELKRDLV- 2207

Query: 2208 MPHESNMENSSPDAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEP 2267
                    N        T+     ++PF   IRS+NC F+YDGGVF+V++  +     +P
Sbjct: 2208 ----GTASNIKEQTQSTTQEPIGDISPFFTGIRSINCQFQYDGGVFKVFSSAEASNHLKP 2263

Query: 2268 SFELKSPVVTINCTYKHDESKAK-PHRIRTLITVDPTHNTLYAGCAPLLMEFSESLQNMI 2326
            SFE+KSP V I+  YK++E K + P  IRTLIT++ THNTL+A CAPL+ EFSE +Q M+
Sbjct: 2264 SFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTHNTLFAKCAPLIAEFSEGIQKMV 2323

Query: 2327 KKHSTGEKKPNFTKPSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFES 2386
            K+HS+ +++P+ T  S QN+DYKR+LD FDVAV++ SAKQ LSL CEP+AKVQAD+GF+S
Sbjct: 2324 KRHSS-DREPSGTNISKQNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADIGFQS 2382

Query: 2387 FLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISM 2446
            F F++TTN++D E+PL F+L++E+T+ASIKHIFSRE STSF V F+DLT++FTHP+ I++
Sbjct: 2383 FTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREASTSFGVDFIDLTVMFTHPNSINI 2442

Query: 2447 YGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNMSTLSSNSNVDV 2506
             GT L+SDV VFFNVKQLQNLYLFLDIW+ S++L+++P         ++ +LSS  + D 
Sbjct: 2443 LGTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNSKPMNEVVKSRTDLKSLSSVQSKDT 2502

Query: 2507 GTEIPWCFTLIFTNLSGDVDLGPSLGVISLRSQRTWLATDHYDEKRQLLHAFTDGISLTS 2566
             + IPWCFTLIF+N++GDVDLGP+LGV+SL  +RTW ATDHY   R++LHA+T GI+LTS
Sbjct: 2503 DSTIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGITLTS 2562

Query: 2567 EGRLSGLFEVANASWVSEVKWPLENSKNTHPLVSTSLNIDDVAVKAAFDYHMFLIGTINN 2626
            +GRLSG+ E+  ASW+SEV WP+  + N +PLVS SLNID V  K AFDYHMFL+G INN
Sbjct: 2563 KGRLSGILELDGASWISEVNWPIYENINDYPLVSISLNIDRVETKVAFDYHMFLVGAINN 2622

Query: 2627 IRFHLHNEKDSKGILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYME 2686
            I  H+H+EKD  GI PDLL+V+   + I L STALVAANILDIYNT++R+RQDNKISY+E
Sbjct: 2623 IDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTALVAANILDIYNTVMRLRQDNKISYIE 2682

Query: 2687 TLRDSNPSESKQPILYKDILRSLKLLRTDLSVNISSLKVQISPISLFDVEVLVVRIDKVS 2746
            TL++SN SE +Q + YKDILRSL L++TD+SV+I +L +QISPISLFD E+LVV I+ +S
Sbjct: 2683 TLKESNTSEPRQALDYKDILRSLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNIENIS 2742

Query: 2747 IRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYMHYASKIVGGTIID 2806
             RSETH+G KLKT+L++QV D S ALSTSKEELDE+I A+I+++DYMHYA +I GG II+
Sbjct: 2743 ARSETHAGNKLKTELEMQVYDASVALSTSKEELDEDIIATISVEDYMHYAGRISGGVIIE 2802

Query: 2807 IPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPINFIKEMWTTHVKALAVRRSQ 2866
             P+L + MTT Q+EK++ LEYL+ CSF DKISVRWNLGP+NFIKEMW THV+A+AVRRSQ
Sbjct: 2803 APRLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAVRRSQ 2862

Query: 2867 TANISFGQTXXXXXXXXXXXXNA-SKFNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRK 2925
              +++FG                 S+F Y+ LEEP+I++PQIRDLG+ATPP+EWFG+NRK
Sbjct: 2863 I-DVTFGPVSEEDVGKRIKKEEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRK 2921

Query: 2926 RLPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954
            R P FTHQTAVI VQKLV+ AEK+Y  IL
Sbjct: 2922 RFPAFTHQTAVILVQKLVHTAEKEYGSIL 2950

>KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2982

 Score = 3278 bits (8500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1577/3007 (52%), Positives = 2149/3007 (71%), Gaps = 76/3007 (2%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60
            M + S+ + VP++  K+FSWVFL+DWIL V+ CL+ IFY+GR  AY+ S ILEWLLWKRA
Sbjct: 1    MASSSEFQSVPISGGKNFSWVFLLDWILLVVLCLSVIFYVGRAIAYITSLILEWLLWKRA 60

Query: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNS 120
             IK+N+E+LRISLLGGRI+FK++++IHKDYTIS+L+G+LTW+YWLL  RK       K+S
Sbjct: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120

Query: 121  SG----KNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEP 176
            +G    KN +LPC+F+L CEG E F+YNRT +YDN+INL SK+ER KF+K+L+E  F + 
Sbjct: 121  NGVTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDH 180

Query: 177  FS--------------DGSSADKL-DEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGL 221
             S              + +S  KL DED  ES Y++ S  +  NDR + +    K    L
Sbjct: 181  SSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFL 240

Query: 222  SFFPIELKLNRGSLLLGNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFE 281
              FP+E++++R SL  GNKFTPS++I+S E+G GIID   PKE+LDLY+ K  +E  NF 
Sbjct: 241  QTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFA 300

Query: 282  ISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRVVTKPV-IPRRGKKAGPSDDAFFQ 340
            +++K NIGY + + LKFK+D GK+S+LWK F  +  ++T+P+ + +R KK     D F Q
Sbjct: 301  VTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLFIQ 360

Query: 341  KWKGLSLYKASAGDAKTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGA 400
            KW+GLSLYK +  +  T DLDDI+FDF +HEYAKF+S++KCPK   +Y+ D+PG VPHGA
Sbjct: 361  KWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPHGA 420

Query: 401  HPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPI 460
            HPT  +IDGPDVGNNGAPP  +LD+QI GGSICYGPW QRQ++ +  +L+P VSRT  P+
Sbjct: 421  HPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTESPV 480

Query: 461  KKLPPGSRRVYTLFRMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRF 520
            K+  PGS R+YT  +++I IM+DTTWRI TRE SKD  FL+HYK+T+++YRPFGW+DLRF
Sbjct: 481  KRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDLRF 540

Query: 521  CKDTYANFNISVCPTVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWN 580
             K++YA F  ++ PT EGFKND ++H  + EIRSSVNHDIL+K K FD D D+ YPL WN
Sbjct: 541  SKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLVWN 600

Query: 581  SNTIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSI 640
                W I+M S QLE FLLREHITL+ADTL+DF++G+PTPYELFRP    +NW+MD Y I
Sbjct: 601  DRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAYFI 660

Query: 641  YLNVNDHNIVNNPLDFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMML 700
            YLNVNDHNIVNNPLDFNENCYLSLHGD L I++T+P E I   + +++Y I+TPMFR++L
Sbjct: 661  YLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRLLL 720

Query: 701  NTPPWNTLNEFMKHKEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFV 760
            NTPPWNTLNEFMK+KEVGRSYDF+ KG YLLYSELD+DNVD+++I C S  T L CYGFV
Sbjct: 721  NTPPWNTLNEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYGFV 780

Query: 761  MRYLINVKMNYFGEFFNFVTSEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGSMKN 820
            +RYL NVKMNYFG+FFNF+TSEEYTG+   R+      +     ++S L     NG + +
Sbjct: 781  IRYLANVKMNYFGDFFNFITSEEYTGI--TRD-----EELEEELISSNLSDNEDNGDVYS 833

Query: 821  DAE------------DNGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIAL 868
            D E            +   +KRSDL+RT NETD++ TFSVW+GA+ILPETIY+ D C AL
Sbjct: 834  DGESGMDDAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTAL 893

Query: 869  HFTELVVDFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLT 928
             F EL++D RS NYYMD++A L  T ++R+  K   ++F  +  +N    +  G LSDL+
Sbjct: 894  KFGELIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDLS 953

Query: 929  IHGHRMYGLPPTEPTYFCQWDINLGELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYD 988
            IHGHRM+GLPP EPTYFC+WD ++G LN+NS+ +FLKGF TSF ++GFG+ DLENILLY 
Sbjct: 954  IHGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYS 1013

Query: 989  TETINDMTSLTVHAERINISLNDPVMKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKL 1048
             E INDMTSLTV+A+ I+++L + V      +  + + FT IDFE+  YS R+D+ +P L
Sbjct: 1014 KEVINDMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPSL 1073

Query: 1049 TVSLSCVMGDGTNTSFLNFETKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLP 1108
             +S+  +  DG      NF TK+  T+F Q K+  + RS QR YI +ND+ +HR  FLLP
Sbjct: 1074 KMSMYGLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLLP 1133

Query: 1109 LFYQDSDTYQKLYGXXXXXXXXXXXXXXXXXXXXXYIIEDIVGEYATLLEATNPFKDLFA 1168
              +Q  + Y +LYG                     +I+ED +GEY +LL+    F+  F 
Sbjct: 1134 QSFQKKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRMPFG 1193

Query: 1169 ETPSTVEPLRASFTXXXXXXXXXPLEFKPVAFTEEINHERDNYVIDVSYILLDIDPLLFV 1228
               ST  P +AS           PLEF     + E N++ DN VID+ YI ++I+P +  
Sbjct: 1194 ---STNTPNQAS---THHEEDMDPLEFSNSTVSTEKNYQCDNLVIDIEYISVEINPSIST 1247

Query: 1229 FTKSLLEQFYSEDMVQVLDDIEIGIVKRLSNLQEGIVSISNIDIHVAYLNLIWQETGEEG 1288
            + +SL    Y E++VQV+DDIEI  +K LS  QEG  SI+NI + V Y ++ W E    G
Sbjct: 1248 YIESLSSTVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWGERDRYG 1307

Query: 1289 FELYLDRINYQMSEKSLEKNRTSKSLEVAVLAKVKTVRATVNQKKNPELSEDRPPALSLG 1348
             ELYLD+++++MS++++EK+R    LE+ +LAK +++RA+++++ + +  ++RPPALSL 
Sbjct: 1308 IELYLDKLDFEMSQRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEKERPPALSLV 1367

Query: 1349 LEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTR 1408
            +EG E+WS+T ++QVNS++  S+DITIDESQ+EWLF + ++Q   +Q + T++NS+Q   
Sbjct: 1368 VEGCELWSATAEKQVNSIDTISTDITIDESQLEWLFLFVNEQNQNLQNIITTLNSVQAEH 1427

Query: 1409 SSTKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYL 1468
            + ++ +LISKLTAA+++YQISHDPYVITKPAFI RLSKGHVRENRSWKIITRLRHILTY+
Sbjct: 1428 TVSRRKLISKLTAANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLRHILTYI 1487

Query: 1469 PDDWQTNIDKVLKERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFLADHAKHK 1528
            P DW++ ++  LKE+  +   +AK +FMSVFS WRNWEFSDVARSYIYG+LFL + A+  
Sbjct: 1488 PSDWESGVENYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQAEKH 1547

Query: 1529 GNSIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLSSNREETIEITG 1588
              S+++++K  + SF+LT Y  GY+++ NFV+ +AN+V + TPP T    +RE+ I +TG
Sbjct: 1548 KQSMRRIIKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEAGVSREKLINLTG 1607

Query: 1589 KVGSVKGKFSDKLLKLQDLIPLVVAVTEDDKSDPKAE---LSKQFKMNTVLLVDKSEIQV 1645
             +GSVKG FSD+LL+L++LIPL+    E  +  P  +   + K FK+N +LL +K+E+Q+
Sbjct: 1608 SIGSVKGNFSDELLRLKELIPLLNKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTEVQL 1667

Query: 1646 VMDKTKVMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDFS 1705
            V+ ++K+ +R + G+VSLL ++ K++ S AGS+++++++SE  + H +T L E Q+ DFS
Sbjct: 1668 VIGESKLTNRILNGKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFS 1727

Query: 1706 ILATTEAWSHKPTILVNNQCADLHFRAMSTTEQMVNAITEIKESVLKVKEQIKFKPK--- 1762
            + AT E+WS KPT+LV+ QCA  H ++M+ T  +VN++ E+ ++V  + +Q+    +   
Sbjct: 1728 LSATVESWSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAE 1787

Query: 1763 SKNKS---QFVGSRINTVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILLS 1819
             +NKS   +     I  V  C  SNVS EIMP+SPFYIRHE K+ D+ F +FGS  +++ 
Sbjct: 1788 GENKSPKKKLKDVEIEVV--CQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMID 1845

Query: 1820 IWDTDFFMTSHQTKEQYLRFSFGDIEIKGGFSKEAYSLINVDISISMIKLTFSEPRRIVN 1879
            +WDTDFF+ S  TK+QY R SFGD +I     +  + +++ ++S SMIKLTFSEP RI++
Sbjct: 1846 VWDTDFFLRSDLTKQQYFRISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPNRILS 1905

Query: 1880 SFLQDEKLASQGIXXXXXXXXXXXTTDPMNAKKETPA--KMINWTLDTNISYFGILVPVA 1937
            SFLQDE+ AS+                P    +  PA  K + W LDT+I YFGILVP++
Sbjct: 1906 SFLQDERTASESFKLLKALKPFLL---PQTEGRLQPATTKEMRWLLDTDIKYFGILVPIS 1962

Query: 1938 STYFVFELHMXXXXXXXXXXXXXPEQTRLTGQLSIENILFLIKERSLPIGLSKLLDFSIK 1997
            +TYFVFE H               E+     Q+SIEN++FLIK+R +P  LS++LDFSI 
Sbjct: 1963 TTYFVFETHALVLSMSDIDTEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSIS 2022

Query: 1998 VSTLQRTADTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLDMVQYYSKRHAPNIWNIRM 2057
             ST+Q+  + + SFQVES+HFR+ LSP SL+RL+WG  + L +  YY ++   ++W+I+ 
Sbjct: 2023 FSTIQKMMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIKA 2082

Query: 2058 FTGKSDK--PKEIPINFRSIHILSYKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDFGK 2115
               K +K     I +N  S H+LSY FCIGW+F       PG+M G++RLFSAYE  +GK
Sbjct: 2083 SKLKKEKKGSSSIGMNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGK 2142

Query: 2116 FTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEA 2175
             T+VDAFFSV+ G TS+TF+   +E E  NRS+LPNMQI+YW K+ G +KD F RFHGEA
Sbjct: 2143 LTLVDAFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEA 2202

Query: 2176 LDVNFLPSFMDVIDSTLQSIRAFQELKKNILDMPHESNMENSSPDAAPNTENASNSLAPF 2235
            LDV+FL +F+ VI+S LQS + FQELK +++  P+ S  EN       NTE    SLAPF
Sbjct: 2203 LDVSFLTTFITVIESMLQSFQVFQELKTSLI-QPNTSTTEN-------NTEPKIKSLAPF 2254

Query: 2236 LDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTINCTYKHDESKAKPHRIR 2295
            L NI+SVNC FKYDGGVF+V++++DIE+  EPSFELK+P V I+  YKH+    KPH IR
Sbjct: 2255 LSNIKSVNCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIR 2314

Query: 2296 TLITVDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEK----KPNFTKPSTQNVDYKRL 2351
             L+ +  THNTL+A CAPL+ EF E +  M+KKHS+  K      N +K  +QN+DYKRL
Sbjct: 2315 ALVAIGSTHNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRL 2374

Query: 2352 LDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQT 2411
            LD FD+A KLTS++Q+LSLSCEPKAKVQADVGF+SF+  + TN  D  +PL FSL++++T
Sbjct: 2375 LDGFDIAFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKT 2434

Query: 2412 KASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFL 2471
            KASIKHIFS+E STSF +  +DL  +FTHPD+I+MYGT L+S+V ++FNVKQLQNLYLF+
Sbjct: 2435 KASIKHIFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFI 2494

Query: 2472 DIWRFSSILHTRPTQRPNNKEVNMSTLSSNSNVDVGTEIPWCFTLIFTNLSGDVDLGPSL 2531
            DIW+ SS +   P  + NN +     L+     ++  EIPW FTLIFTN++G  DLGPSL
Sbjct: 2495 DIWKLSSFIRPGPKGKSNNGKRENKHLTLPQPSNLYGEIPWSFTLIFTNINGSADLGPSL 2554

Query: 2532 GVISLRSQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWVSEVKWPLEN 2591
            GV+SL+ +RTW+A+DHY +KRQ++ AFTD +S  S+GRLSG+FE+  ASW+SEV WP E 
Sbjct: 2555 GVLSLKLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEK 2614

Query: 2592 SKNTHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSS 2651
              + +PLV+ S+NID++++KAAFDYHMFLIGTI+  +F LH+EKD  G +PDLL+V+F+ 
Sbjct: 2615 RTHNYPLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTC 2674

Query: 2652 DEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPSESK-QPILYKDILRSLK 2710
            + I + STALVAANILD+YNT++RMRQDNKI Y+ETLR+S+  E++  P  Y+DILRSL 
Sbjct: 2675 EMINICSTALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLN 2734

Query: 2711 LLRTDLSVNISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSA 2770
            LL+TD+S NI  LK+Q+SPI+LFD+EVLV+ I+ +S R+ T +G+KLKT L+L+V D   
Sbjct: 2735 LLQTDVSTNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGYV 2794

Query: 2771 ALSTSKEELDEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFA 2830
            ALSTSK E+DE+  ++I++ DYM YASKI GGTII++PKL + MT+ QEE ++ LEYL+ 
Sbjct: 2795 ALSTSKREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYK 2854

Query: 2831 CSFSDKISVRWNLGPINFIKEMWTTHVKALAVRRSQTANISFGQTXXXXXXXXXXXXNAS 2890
            C+F DKI+V+WNLGP+NFIKEMWTTHVKALAVRRSQ    +  QT            N S
Sbjct: 2855 CTFEDKIAVKWNLGPVNFIKEMWTTHVKALAVRRSQNVLDTDMQTDEEVQKRIKEEENIS 2914

Query: 2891 KFNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQY 2950
            K  Y+ +EEP+I++PQIRDLG+ATPP+EWFGVNRKRLP FTHQT V+PVQKLV+ AEKQY
Sbjct: 2915 KLKYVPIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQY 2974

Query: 2951 VKILDDT 2957
              +LD++
Sbjct: 2975 ASLLDNS 2981

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087c
          Length = 2981

 Score = 3232 bits (8380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1582/3000 (52%), Positives = 2135/3000 (71%), Gaps = 74/3000 (2%)

Query: 2    EAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRAK 61
            ++ +  RG  L  +++FSWVFLVDWILTVI  L T+FY+ R +AY V+FILEWLLWK+AK
Sbjct: 5    QSSAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAK 64

Query: 62   IKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRK-----AELIEN 116
            +K+++  LRISLL GR++FK+L++I KD TI+ILEGS+TW+YWL+  RK     A++   
Sbjct: 65   VKVSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHA 124

Query: 117  EKNSSG---------------KNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDER 161
               SSG               K ++LPC+FL ECEG E FIYNRT AYDN++N+LSK ER
Sbjct: 125  SAGSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVER 184

Query: 162  DKFEKYLNEHSFPEPFSDGSSADKLDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGL 221
            +KFEK++ E+ F +P SDGSS DK++E  + SA  +  + +I NDR +Q       P+ L
Sbjct: 185  EKFEKFMAENDFLDPSSDGSSDDKIEE--TSSATNSTDEETIANDRTFQNDTRKTLPRYL 242

Query: 222  SFFPIELKLNRGSLLLGNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFE 281
               PIE  LN+GS+L+GNKFTP V+ILS+E+   + DV     +LDLYR K  + LKN E
Sbjct: 243  EALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKNLE 302

Query: 282  ISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAGPSDDAFFQK 341
            I +KQNI YD+     F+ D GK+S+LW  F R+ ++V  P    R +K  P D+ F QK
Sbjct: 303  IMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKSNR-RKEQPHDN-FMQK 360

Query: 342  WKGLSLYKASAGDAKTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAH 401
            WKGLS+Y+      +  + DDIEFD +SHEYAKFTS+LK P+VT+ +D D+PG VPHGAH
Sbjct: 361  WKGLSMYRNDMF-GEFDEFDDIEFDISSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGAH 419

Query: 402  PTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIK 461
            P     DGPDVGNN APP +  ++ I GG++CYGPWAQRQ +HLQ +LSP VSRTAKPIK
Sbjct: 420  PPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPIK 479

Query: 462  KLPPGSRRVYTLFRMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFC 521
            KL PGS+R+YT+ ++ I  MED TWRIPTRESSKD EFL HYK+T+++YRPFGW+D++  
Sbjct: 480  KLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWIDIKVS 539

Query: 522  KDTYANFNISVCPTVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNS 581
            +D+   F++++CPT +GFKN   V  V+TEIRSSVNHDI LKSK F  + DIGYPLGWN+
Sbjct: 540  RDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWNA 599

Query: 582  NTIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIY 641
               W I M S QLE FLLREH+TL+ADTL+DFS+G+P PYELFRPFVY + W M GYS Y
Sbjct: 600  EANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKGYSFY 659

Query: 642  LNVNDHNIVNNPLDFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLN 701
            LNVNDHNIVNNPLDFNENCYLS+HGD LT+++ VP+++I   +T+M+Y+I TPMFR++LN
Sbjct: 660  LNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFRLLLN 719

Query: 702  TPPWNTLNEFMKHKEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVM 761
            TPPWNTLNEFM++KEVGRS+DF +KG YL+YSELDIDNVD+LT+ C+S  T LH YGFV+
Sbjct: 720  TPPWNTLNEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIYGFVI 779

Query: 762  RYLINVKMNYFGEFFNFVTSEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGSMKND 821
            RYLINVKMNYFGEFF+FVTSEEYTG     ++  ++++    D  S+ +S  +  S  +D
Sbjct: 780  RYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYESVSRISSNSSD 839

Query: 822  AE----DNGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDF 877
                      +K+SDLKRT+NETDIWFTFSVW+GALILPETIY+ DPCIALHF EL+VD 
Sbjct: 840  KNPKAKKKHSLKKSDLKRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAELIVDL 899

Query: 878  RSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGL 937
            RSCNYYMDI+A     ++KR+V K+ +E+++++  NNG D + HG LSD+ IHGHRMYGL
Sbjct: 900  RSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHRMYGL 959

Query: 938  PPTEPTYFCQWDINLGELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTS 997
            PPTEPTYFCQWD++ G LNI+S++ FL+G F +FYK+GFGY DLENILLY+TE I+DMTS
Sbjct: 960  PPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDDMTS 1019

Query: 998  LTVHAERINISLNDPVMKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMG 1057
            LT+    I+I LND    + + + +E   FTLIDFENERYS+R+DIK+P L  ++     
Sbjct: 1020 LTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSLEFNI--FSN 1077

Query: 1058 DGTNTSFLNFETKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTY 1117
            +  + S LNF+  + FTNF Q +D +K R  QR YI++ND+PYHRC FLLP  YQ S  Y
Sbjct: 1078 EDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQKSRIY 1137

Query: 1118 QKLYGXXXXXXXXXXXXXXXXXXXXXYIIEDIVGEYATLLEATNPFKDLFAET--PSTVE 1175
             +L+G                     Y++ED++ +Y  L E     K+   E    S +E
Sbjct: 1138 NELFGAIAPSSSLPPLPIPLTADTIEYVLEDLLEDYMGLFEGNYDIKESSVENLELSAIE 1197

Query: 1176 PLRASFTXXXXXXXXXPLEFKPVAFTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLE 1235
              RA            P+     A       E DNYV+ V  I++DI+P L+   + LL+
Sbjct: 1198 ATRAITGIGAERTHSNPITLSDYAV------ESDNYVVKVESIVIDINPALYTTIEKLLK 1251

Query: 1236 QFYSEDMVQVLDDIEIGIVKRLSNLQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDR 1295
              Y +D VQ++D IEIGIVKRLS++ +G+ +++N+ + + + NL W E   +   ++ D+
Sbjct: 1252 HIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDNVSMFFDK 1311

Query: 1296 INYQMSEKSLEKNRTSKSLEVAVLAKVKTVRATVNQKKNPELSEDRPPALSLGLEGFEVW 1355
            +++ ++EK+LE+N     LE+ VLAK+K VR TV Q+     +++RPPA+++G+EGFE W
Sbjct: 1312 MDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPAITVGVEGFEFW 1371

Query: 1356 SSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTEL 1415
            S+  ++QVNS++++S+DIT+D++Q+EW F+Y   Q     ++  S N IQN R  ++ EL
Sbjct: 1372 STAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNRIESQKEL 1431

Query: 1416 ISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTN 1475
            IS+LTAASEYYQISHDPYVITKPAFIMRLS+GHVREN+SWKIITRLRHILTYLP DW  N
Sbjct: 1432 ISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKDWYLN 1491

Query: 1476 IDKVLKERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKL 1535
            + + L++RK+  ++DA++IFMS+FS WR+WEFSDVARSYIYGKLFL DHA+ K  S++KL
Sbjct: 1492 VGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDHAEKKKQSLQKL 1551

Query: 1536 LKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLSSN---REETIEITGKVGS 1592
             K  +G+F++TVY   Y+V+H+ VV++A L+++LTP  T    N   REE I+I+G V  
Sbjct: 1552 FKLNIGNFFMTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPKENSLQREELIDISGTVDV 1611

Query: 1593 VKGKFSDKLLKLQDLIPLVVAVTEDDKSDPKAE-LSKQFKMNTVLLVDKSEIQVVMDKTK 1651
            +KGK S KLLKLQ LIP++   +E     P  + + K FKMN   +V+  +IQ+VMD TK
Sbjct: 1612 IKGKLSTKLLKLQKLIPILTEGSEKQPVKPPQDTIPKPFKMNAAFMVNSCDIQLVMDATK 1671

Query: 1652 VMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDFSILATTE 1711
            +      GR+S+LWENL+DST+QAGS+V+FS+ +E+ LKH +++L E ++ +F    TT+
Sbjct: 1672 LNMNVNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFYATFTTD 1731

Query: 1712 AWSHKPTILVNNQCADLHFRAMSTTEQMVNAITEIKESVLKVKEQIKFKPK-SKNKSQFV 1770
             W+ +PT L++++ + +HFR M+ TE++V AI +IK  + ++ EQ++ + + +++ + + 
Sbjct: 1732 TWAQRPTYLIHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLELERRLTQHPTVYD 1791

Query: 1771 GSRINTVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSH 1830
             ++ N + SC FSNVS +IMP+SPF +++ AKQ+D ++NKF S+  L+ + DTDFF+TS 
Sbjct: 1792 PNKSNVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKDTDFFLTSD 1851

Query: 1831 QTKEQYLRFSFGDIEIKGGFSKEAYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQ 1890
            QTKEQY+R S   ++I+   S     L+++++S +++KLTFSEP+ IV SFL+DE++AS+
Sbjct: 1852 QTKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIVYSFLKDERVASE 1911

Query: 1891 GIXXXXXXXXXXXTTDPMNAKKETPAKMIN-----WTLDTNISYFGILVPVASTYFVFEL 1945
             +            +D    K+ TP          W+LD++I YFGIL+P+ STY+V E 
Sbjct: 1912 SVHLLQTLKPLFSISDD---KESTPQSYQEKTEYLWSLDSSIDYFGILIPMTSTYYVMEF 1968

Query: 1946 HMXXXXXXXXXXXXXPEQTRLTGQLSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTA 2005
            H                   +TG +S+ENILFLIKE SLP GLSK++D ++ VSTLQR  
Sbjct: 1969 H-SYVSSISNANGAPSGNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVNVSTLQRVD 2027

Query: 2006 DTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLDMVQYYSKRHAPNIWNIRMFTGKSDKP 2065
            D  +S QVESSH R+CLSPDSLLRL+WG  +   + ++Y K H+ ++W  + F    DK 
Sbjct: 2028 DNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLW--QSFAKSDDKQ 2085

Query: 2066 KE---IPIN-------FRSIHILSYKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDFGK 2115
            ++   I  N         SIH LSY  C+GWLF+Y  G   GL+ GY+RLFSAYE   GK
Sbjct: 2086 QDTNSIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCMGK 2145

Query: 2116 FTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEA 2175
             T++D++F+ + GNTSSTF+ E N KE +NR +LPNMQI +W+K    +KD + RF GE 
Sbjct: 2146 LTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGET 2205

Query: 2176 LDVNFLPSFMDVIDSTLQSIRAFQELKKNILDMPHESNMENSSPDAAPNTENASNSLAPF 2235
            LDV +L  FM  I+STL SI+ FQ+LKK ++    +  + +   D   N+ N        
Sbjct: 2206 LDVKYLSDFMLTIESTLHSIKMFQKLKKELIVETPKREVVHIKEDKPVNSSNN------I 2259

Query: 2236 LDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTINCTYKHDESKAKPHRIR 2295
            L NI+SVNC+FKYDGG + V+   D      P+ E+KSPV++++  YKH++   K H IR
Sbjct: 2260 LKNIKSVNCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKHHSIR 2319

Query: 2296 TLITVDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEKKPNFTKPSTQNVDYKRLLDQF 2355
             L+ +DPTHN LYA CAPL+  F E ++++  ++ +  K    T  S QN+DY++LL+ +
Sbjct: 2320 CLVNIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPTSVQNIDYEKLLEDY 2379

Query: 2356 DVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTKASI 2415
            D+A+ +TSAKQQLSLSCEPKAKVQADVGFE+   SMTTN FD ++PL FS +++ TKASI
Sbjct: 2380 DLAITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKASI 2439

Query: 2416 KHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLDIWR 2475
            KH+FSRE STSF VG++DLTLLFTH + I+ YGTSL+SD+ ++FNVKQLQNLYLFLDIW+
Sbjct: 2440 KHLFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDIWQ 2499

Query: 2476 FSSILHTRPTQRPNNKEVNMSTLSS-NSNVDVGTEIPWCFTLIFTNLSGDVDLGPSLGVI 2534
             S +L+  P      + +      S +  +   +++PWCFTLIFTN+ GD+DLGPSLG+I
Sbjct: 2500 LSELLN--PVTSSQEQVIRKDKKKSVDKPIHNESQLPWCFTLIFTNVKGDIDLGPSLGLI 2557

Query: 2535 SLRSQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWVSEVKWPLENSKN 2594
            SLR  RTWLATDH+  KRQ+LHAF D + L SEGRLSG+  +  ASWVSEV W  ++ ++
Sbjct: 2558 SLRLSRTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKRD 2617

Query: 2595 THPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSDEI 2654
              PLV+ SLN D + +KAAFDYHMFLIGT+NNI F LH+E+D  G+ PDLL+VSFS +EI
Sbjct: 2618 NIPLVALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEEI 2677

Query: 2655 TLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPSESKQPILYKDILRSLKLLRT 2714
             L STALVAANILDIYNTI+RMRQD KISY+ETL+DSN   +KQ + Y+DIL+SL+LLRT
Sbjct: 2678 KLCSTALVAANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSLQLLRT 2737

Query: 2715 DLSVNISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALST 2774
            DL+V+I SL++QISPISLFDVEV+V+ +  VS RSETHS  KL T L ++V D + +LST
Sbjct: 2738 DLTVSICSLQLQISPISLFDVEVVVINVVSVSARSETHSEAKLTTSLNMEVYDATLSLST 2797

Query: 2775 SKEELDEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFS 2834
            +K+ELDE+  + I + DYM YASKI GGTII+IP++ V MTT QEEK++ LEYL++C F 
Sbjct: 2798 AKQELDEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFH 2857

Query: 2835 DKISVRWNLGPINFIKEMWTTHVKALAVRRSQTANISFGQTXXXXXXXXXXXXNASKFNY 2894
            DK++VRWNLGP+NF+KEMWTTHVKA+AVRRSQ    SF  +            N +K NY
Sbjct: 2858 DKVAVRWNLGPVNFMKEMWTTHVKAIAVRRSQVLTGSFNVSEKDVEKRIKEEENITKLNY 2917

Query: 2895 IALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954
            + +EEPQI++PQI+DLG+ATPP+EWFGVNRKR P FTHQTAV+PVQ LVYLA+KQY K L
Sbjct: 2918 VPVEEPQIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTL 2977

>KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2998

 Score = 3131 bits (8117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1533/3020 (50%), Positives = 2105/3020 (69%), Gaps = 95/3020 (3%)

Query: 2    EAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRAK 61
            + VSQ   + L   KDFSWVFLVDWILT+I  +T +FY+GR  A+ +SFI EWLLWKR +
Sbjct: 3    DTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYR 62

Query: 62   IKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELI------E 115
            +K+N+E+LR+SLLGGRI+FK+L++I KDYTIS L G ++W+YWL   R  + +      +
Sbjct: 63   LKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAED 122

Query: 116  NEKNSSGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPE 175
            ++  S  +N +L C+ LLECEG+E F+YNRT+AYDN I + SK+ER KFE++LNEH F +
Sbjct: 123  DDGASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTD 182

Query: 176  ----------PFSDGSSADKLD-EDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFF 224
                         +  + D+++ +  +ES++  +++S + NDR + +   GK    L++ 
Sbjct: 183  RASTESSNGSSSEESKAQDEVEIKSYTESSFDESNESQMANDRIFHDEETGK-NLFLNYL 241

Query: 225  PIELKLNRGSLLLGNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISI 284
            P+++K++  S ++GNKFTPS++I+S ++ EG++D   PKE+LD+Y+ K  ++ KN  +S+
Sbjct: 242  PLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVSL 301

Query: 285  KQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAGPSDDA-FFQKWK 343
            KQNIGY++ + LKFKL TGK+SKLW  FV+    V KP+   R KK  PS  A F QKW+
Sbjct: 302  KQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVTANFHQKWR 361

Query: 344  GLSLYKASAGDAKTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPT 403
            GLSLYK    +   +DLDDIEFD   HEYAKFTSI+KCP+  L+Y+ D+PG VPHGAHPT
Sbjct: 362  GLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHGAHPT 421

Query: 404  IPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKL 463
            +  IDGPD+GNNGAPP F L++Q+ GGS+CYGPWAQRQV+ +Q +L+P +SR  KP+K L
Sbjct: 422  LSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKPVKPL 481

Query: 464  PPGSRRVYTLFRMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKD 523
             PG RR+YTLF++ I++ ED TWRIPTRESSKDAEFL+HYK T+E+YRPFGW+DL+F KD
Sbjct: 482  QPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKFSKD 541

Query: 524  TYANFNISVCPTVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNT 583
            +YA+FN ++C T +G +N   +H  ++EIRSSVNHDI +KSK  D D ++G+PLGWN   
Sbjct: 542  SYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWNEKA 601

Query: 584  IWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLN 643
             W IN+ S QLE FLLREHITL+ADT+SDFS G+PTPYELFRPF+Y +NW++DGYSIYLN
Sbjct: 602  KWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSIYLN 661

Query: 644  VNDHNIVNNPLDFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTP 703
            VNDHNIVNNPLDFNENCYLS HGD L +DITVP++ I    TD+SY I TPMFR+MLN P
Sbjct: 662  VNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLMLNAP 721

Query: 704  PWNTLNEFMKHKEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRY 763
            PWNTLNEFMKHKEVGR+YDF   G YL+Y+ELD+DNVD +TI C+S STVLHCYGFV+RY
Sbjct: 722  PWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFVIRY 781

Query: 764  LINVKMNYFGEFFNFVTSEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGSMKNDAE 823
            L+N+KMNYFG+FF+FVTSEEYT  + ++  GE        D AST  S++     KN+ E
Sbjct: 782  LMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVSDFD----KNNEE 837

Query: 824  DNG---PMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSC 880
            D+    P   +D++R TNETD+W TF++W GAL+LPETIY+ DPCIALHF EL +D RS 
Sbjct: 838  DDKVKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGELAIDVRST 897

Query: 881  NYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPT 940
            NYYMD++A L+   ++++ + Q NE+F+ +R+ NG D + H  +S++ IHGHRMYGLPPT
Sbjct: 898  NYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIHGHRMYGLPPT 957

Query: 941  EPTYFCQWDINLGELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTV 1000
            EPTYFC+WD +LG + + S+++F+KG  TSF K+GFG++DLEN+LLY+ E ++DMT++TV
Sbjct: 958  EPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVVDDMTAVTV 1017

Query: 1001 HAERINISLNDPVMKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGT 1060
            + +   I +++P + S++ + + ++ F  IDFENE+YS R+DI++P L +SL     + +
Sbjct: 1018 NVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKLSLYGYNYEAS 1077

Query: 1061 NT-SFLNFETKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQK 1119
               SF NFETK+ FTNF  YK+  + R+ QR YI MND+P+HRC F+LP  YQ+S  YQK
Sbjct: 1078 KELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPASYQNSVIYQK 1137

Query: 1120 LYGXXXXXXXXXXXXXXXXXXXXXYIIEDIVGEYAT----------LLEATNPFKDLFAE 1169
            LYG                     +II+D + EY T            ++TN   D F  
Sbjct: 1138 LYGSIVPSSSLPPLPLPLLEETFEFIIQDFLHEYNTTSDCIILNLPYPDSTNLNSDSFNS 1197

Query: 1170 TPSTVEPLRASFTXXXXXXXXXPLEFKPVAFTEEINHERDNYVIDVSYILLDIDPLLFVF 1229
             P T     A  T         PL             ERDNYVID  YI + IDP LF +
Sbjct: 1198 YPDT-----APHTLSDTIIRKSPLP----------EDERDNYVIDFRYISISIDPELFFY 1242

Query: 1230 TKSLLEQFYSEDMVQVLDDIEIGIVKRLSNLQEGIVSISNIDIHVAYLNLIWQETGEEGF 1289
             + LL  FY +D  QV+D IEIG+VKRLSN QEGI SI+N  I + + ++ W +    G 
Sbjct: 1243 IEKLLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGI 1302

Query: 1290 ELYLDRINYQMSEKSLEKNRTSKSLEVAVLAKVKTVRATVNQKKNPELSEDRPPALSLGL 1349
            ELYLD ++++M+EKS+EKNR     EV  L K+ ++RA+VN K +   +E +PPALSL +
Sbjct: 1303 ELYLDTLDFEMNEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPALSLMV 1362

Query: 1350 EGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTRS 1409
            EG + WS+T  + +NS+ LTS D TIDE+Q+ WLF +  DQ  LI  V  +   +Q  R+
Sbjct: 1363 EGVKFWSTTAKKVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLRT 1422

Query: 1410 STKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLP 1469
             ++ ELIS+LT ASEYYQISHDPYVITKPAFI RLS+GHVRENRSWKIITRLRHI+TYLP
Sbjct: 1423 QSRKELISRLTVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLP 1482

Query: 1470 DDWQTNIDKVLKERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFLADHAKHKG 1529
            DDW   + K LKERKY+ +KDAK+IFMSVFS+WRNWEFSDVARSYIY K+FLA+ A+ + 
Sbjct: 1483 DDWNETVAKQLKERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQQ 1542

Query: 1530 NSIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLSSNREETIEITGK 1589
             ++ K  K    S Y+TVY  G  V+H+F+V  +NLV + TP  T    N+E+ I +TG 
Sbjct: 1543 KTVNKGWKAAFVSVYITVYTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQEKVINVTGN 1602

Query: 1590 VGSVKGKFSDKLLKLQDLIPLVVAVTEDDKSDPKAELSKQFKMNTVLLVDKSEIQVVMDK 1649
            +GS+KGK SDK+ KL +L+ L V   ED      +  S+ FK+N  LL D S++  V  +
Sbjct: 1603 LGSIKGKISDKMFKLHNLMNL-VQQQEDPALKSISSFSRSFKLNIALLFDSSDLLFVFGE 1661

Query: 1650 TKVMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDFSILAT 1709
            T + +    G+ S LWEN K  T +  SLV+++++ E  +KH +++L E Q+   ++ A 
Sbjct: 1662 TSLTNTIHSGKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQITGIALSAA 1721

Query: 1710 TEAWSHKPTILVNNQCADLHFRAMSTTEQMVNAITEIKESVLKVKEQIKF----KPKSKN 1765
             ++    P+I+ N QC D++ R M  TE +V  + E       VKE  +     KP   N
Sbjct: 1722 ADSIISHPSIVANFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKESFETDDLPKPTPTN 1781

Query: 1766 KS-QFVGSRINTVL------SCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILL 1818
             S +   ++IN  L      +C+FSNVS +IMP+ PF  R E K+++  F+   +     
Sbjct: 1782 DSPKPTPTKINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQF 1841

Query: 1819 SIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGFSKEAYSLINVDISISMIKLTFSEPRRIV 1878
            +IWD+D ++ SH TK+QY R S G+I +     +   ++ N+D+S S++KLTFSEP R++
Sbjct: 1842 NIWDSDLYLGSHLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSASIVKLTFSEPHRML 1901

Query: 1879 NSFLQDEKLASQGIXXXXXXXXXXXTTDPMNAKKETPAKM-INWTLDTNISYFGILVPVA 1937
             SFLQDE+  S+ +           +   +N     PA   I+W L+ +I Y GIL+PV+
Sbjct: 1902 FSFLQDEREVSRSVKKLQVLGNLFSSEPEINT---IPAGAKIDWRLNADIKYLGILIPVS 1958

Query: 1938 STYFVFELH-MXXXXXXXXXXXXXPEQTRLTGQLSIENILFLIKERSLPIGLSKLLDFSI 1996
            +T+FVFE+H +              E    +GQ+S++NILFLIK+R++P  LS+++D S 
Sbjct: 1959 TTFFVFEMHTLLASLADVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSF 2018

Query: 1997 KVSTLQRTADTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLDMVQYYSKRHAPNIWNIR 2056
            K+S +Q+  ++  S+Q+ES H R C SP SL+R++WG ++LL +  +Y + H+ N+W+  
Sbjct: 2019 KISAIQKIMESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFL 2078

Query: 2057 MFTGKSDKPKEI-----PINFRSIHILSYKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEK 2111
                K  +  +       + F S HILSY FC+GWLFQ     D GL+ GYNRLFSAYEK
Sbjct: 2079 PKKEKKVEEDKTTSFFSTLTFGSCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEK 2138

Query: 2112 DFGKFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFKRCGELKDWFFRF 2171
              GK T+VDAFFSVSNG TS TF+S+GNE++KYNRSFLPN+QI YW K   E+KD F R 
Sbjct: 2139 GCGKLTLVDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRL 2198

Query: 2172 HGEALDVNFLPSFMDVIDSTLQSIRAFQELKKNILD--------------MPHESNMENS 2217
            HGE LDVNFL SF+ +I++TLQSI+ FQELKK +++                 E N   +
Sbjct: 2199 HGETLDVNFLSSFVKIIEATLQSIQVFQELKKVLVNPLTQSEARSEEEEEESEEHNRRET 2258

Query: 2218 SPDAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVT 2277
             P      +     +APFL +IR VNC FKYDGG+F+VY+++DIE+  +PSFE++SP VT
Sbjct: 2259 VPGKEKKEDAPRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVT 2318

Query: 2278 INCTYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEK--- 2334
            I+  YK++    KPH IRTLITV+ THN L+A CAPLLM  S+ +Q+M+KKHS+ +K   
Sbjct: 2319 IDLDYKNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVKKHSSKKKPEP 2378

Query: 2335 KPNFTKPSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTN 2394
            K   ++PS QN+DYKRLL+ FD+  K+ S++Q+LSLSCEPKAKVQA+VGF+SF+F++ TN
Sbjct: 2379 KQRVSRPS-QNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTN 2437

Query: 2395 EFDSEQPLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSD 2454
            + D+ +PL F+L ++ T+++I+HIFSRE S SF +  +D+T +FTHP++I+M+G  L+SD
Sbjct: 2438 DLDTSEPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISD 2497

Query: 2455 VSVFFNVKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNMSTLSSNSNVDVGTEIPWCF 2514
            V V+FNVKQLQNLYLFLDIW+ S++L  +P ++P +  V +    S S +DVG  IPWCF
Sbjct: 2498 VEVYFNVKQLQNLYLFLDIWKLSNLLRPKPMKKPEDHHVAIDAPPS-SPMDVGNIIPWCF 2556

Query: 2515 TLIFTNLSGDVDLGPSLGVISLRSQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLF 2574
            TLIF N++G VDLGPSLG++SL  ++ W A+DHY+ KRQLLHA+ D I LT++GRLSG+ 
Sbjct: 2557 TLIFANINGKVDLGPSLGLLSLSMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIV 2616

Query: 2575 EVANASWVSEVKWPLENSKNTHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNE 2634
            E+  A W +EV WP     + +PLV+ S  I ++++K AFDYHMFLIGT+ N  FHLH+E
Sbjct: 2617 ELDGALWAAEVNWP--KYDDPYPLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSE 2674

Query: 2635 KDSKGILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPS 2694
            +D+ G +PDLL+V  + ++I + STALVAAN+LD+YNTI+RMRQD  +SY+ETLR+SN +
Sbjct: 2675 RDTSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNTT 2734

Query: 2695 ESKQPILYKDILRSLKLLRTDLSVNISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSG 2754
            ++K+ + YKDIL+ L L++TD+ V+I++L VQISPISLFDVEVLVV I  V    +TH+G
Sbjct: 2735 DTKETVDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHAG 2794

Query: 2755 KKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHM 2814
            +KL+T L LQ+ +   +LS+SK E+DE++ + I+++DYM YASKIVGGTI DIPKL + M
Sbjct: 2795 EKLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISM 2854

Query: 2815 TTLQEEKTNNLEYLFACSFSDKISVRWNLGPINFIKEMWTTHVKALAVRRSQTANISFGQ 2874
             T Q+  ++ LEY +  +F DKI+VRWNLGP+NFIKEMWTTH+KALAVRRSQ+   + G 
Sbjct: 2855 HTFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTGD 2914

Query: 2875 TXXXXXXXXXXXXNASKFNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQT 2934
                           SK  YIA+EEPQI+ PQI+DLG+ATP +EWFG+NRK+ P FTHQT
Sbjct: 2915 EEGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQT 2974

Query: 2935 AVIPVQKLVYLAEKQYVKIL 2954
             ++PVQKL++ AEK+Y  I+
Sbjct: 2975 VIVPVQKLIHSAEKEYANIV 2994

>TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2942

 Score = 3045 bits (7894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1489/2988 (49%), Positives = 2063/2988 (69%), Gaps = 86/2988 (2%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60
            ME  SQ   V L+++++FSWVFLVDW+L  +  LT IFY+GR++AY ++ +LEW LWK  
Sbjct: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60

Query: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNS 120
            K+KI+VE+LRI+ L G I F++L +I KD TISIL+GSL W+Y LL  R+++  E     
Sbjct: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120

Query: 121  SG-----------KNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLN 169
             G           KNI LPC+F+L CEG E FIYNRT+AY+N+I + S++ER +FEK+++
Sbjct: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180

Query: 170  EHSFPEPFSDGSSADKLDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELK 229
            +    E F   S              ++ SD   INDR + E +  K    + F P+EL+
Sbjct: 181  KQEMSELFHCHSERSDDKGSTDSVLSSSVSDVPNINDRVFDEVHNQKKSIFMRFLPMELQ 240

Query: 230  LNRGSLLLGNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIG 289
            L+RGS++LGNKFTPS++I S  +G G++D+  PKE+LDLY+    ++  + +ISI+QNI 
Sbjct: 241  LSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNIE 300

Query: 290  YDDAIGLKFKLDTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAGPSDDAFFQKWKGLSLYK 349
            Y+     K     GK+S++W TFV+VL +   P   +     G   + F  KWKGL LYK
Sbjct: 301  YNRK---KATFKNGKLSRMWATFVKVLHI---PFYNKSHNNKGTESEPFMTKWKGLGLYK 354

Query: 350  ASAGDAKTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDG 409
                D    D D++ FDF +HEYAK ++I+K P+  L+Y  D+PGVVPHGAHPT+   +G
Sbjct: 355  GLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHPTL---EG 411

Query: 410  PDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRR 469
            P+VGNNGAPP+F +D+Q +G +ICYGPWAQR++ HL R++SP V+R++ PIK L PGSRR
Sbjct: 412  PEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKTLSPGSRR 471

Query: 470  VYTLFRMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFN 529
            +YT+F+    +++ ++WRIPTRE SKD EFL+ +K TSEEYRPFGW+DL+F  D+Y +  
Sbjct: 472  IYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAMDSYGSVT 531

Query: 530  ISVCPTVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINM 589
              +CP  EGF N  ++HF E E  SSVNHD++LK   FD+ GD+GYPLGWNS+  W IN+
Sbjct: 532  TVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSSATWTINL 591

Query: 590  KSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNI 649
             S QLE FLLREH+TLVAD  +DFS+G+PTPYELFRPF+Y++NW +DGYSIYLNVNDHNI
Sbjct: 592  HSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYLNVNDHNI 651

Query: 650  VNNPLDFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLN 709
            VNNPLDFNENCYLSLHG++L ID+T P +SI G Y D+ Y+ISTPMFR++LNTPPWNTLN
Sbjct: 652  VNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRLLLNTPPWNTLN 711

Query: 710  EFMKHKEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKM 769
            EFMK+KEVGRSY F + G Y +YSELDIDNVD+L++ CTS  T LHCYGFVMRYL+NVKM
Sbjct: 712  EFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMRYLMNVKM 771

Query: 770  NYFGEFFNFVTSEEYTGVLGAREVGEV--VTKSSVVDLASTLDSEYQNGSMKN---DAED 824
            NYFG+FF+F+TSEEYTGV+ A+E   V    + S+ D ++ L ++  +G + +       
Sbjct: 772  NYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTD--SGGLSDPYVRLRA 829

Query: 825  NGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYM 884
            + P+ RSD+KRTTNETDIWFTFSVW GAL+LPETIY+ DPC+ALHF EL+VD RSCNYYM
Sbjct: 830  DPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIVDLRSCNYYM 889

Query: 885  DIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPTY 944
            D++A ++ TSIKR+VS+Q +E+F+ IRR+NG  E+EHG L+ LTIHGHRMYGLPP EPTY
Sbjct: 890  DLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMYGLPPIEPTY 949

Query: 945  FCQWDINLGELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAER 1004
            FCQW I+L  L INSD EF KGFFT F  +GFGY +LEN LLYD ET +DMTS+TV    
Sbjct: 950  FCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDMTSVTVRVRD 1009

Query: 1005 INISLNDPVMKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSF 1064
            +N+ + +    S+++V V +L FT IDFENERYSQRID+KVP L++ L     D      
Sbjct: 1010 MNVVVEND--SSRAVVDVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTSEDDSEPIRL 1067

Query: 1065 LNFETKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGXX 1124
            ++  TK+  T+F Q +D  K RS+QR YI +NDSP++RC FLLP + Q+S  Y+ L G  
Sbjct: 1068 MDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESPLYKSLLGSI 1127

Query: 1125 XXXXXXXXXXXXXXXXXXXYIIEDIVGEYATLLEATNPFKDLFAETPSTV-EPLRASFTX 1183
                               +IIED++GE+A  L+          +T  TV +P   S + 
Sbjct: 1128 SPSSSLPPLPMPLLAETIDFIIEDLLGEFAAGLKCD-------YDTQRTVDDPDSPSESF 1180

Query: 1184 XXXXXXXXPLEFK-------PVAFTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQ 1236
                    P + +       P   +     + DN +IDV ++ +D+DPL+  +   LL +
Sbjct: 1181 DTSQEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVDGLLGE 1240

Query: 1237 FYSEDMVQVLDDIEIGIVKRLSNLQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDRI 1296
            F+  + V ++D+IE+ IVKRL  L      + N+ ++V  +N  W +   +  +LY D++
Sbjct: 1241 FWKVNTVDIIDEIEMSIVKRLGQLWNN-TCVLNLKLYVVDINFFWGDKNAKVVDLYFDKL 1299

Query: 1297 NYQMSEKSLEKNRTSKSLEVAVLAKVKTVRATVNQKKNPELSEDRPPALSLGLEGFEVWS 1356
            ++ + +++ + +  +   E   L+K+++VRATV  +   E  E+RPPALSL +EG+E +S
Sbjct: 1300 DFDLGQRTRDLDGETIVSEKITLSKLRSVRATVFDRSITEGVEERPPALSLAVEGWEAYS 1359

Query: 1357 STEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTELI 1416
               ++ V S++L S+DIT+DESQ+EWL  Y ++Q +LI+ + TS   +      T+ +L+
Sbjct: 1360 WMREKIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGTRRDLL 1419

Query: 1417 SKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTNI 1476
              +T ASE+YQISH+PYVITKPAFIMRLS GHVREN SW+IITRLRHILTYLP++W+ N 
Sbjct: 1420 RDITTASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLRHILTYLPNEWRNN- 1478

Query: 1477 DKVLKERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKLL 1536
               ++      + DA     SV S WR WE SD+ RSYIY  +FL+D +K +  S+KK+L
Sbjct: 1479 -SAIQVSPTVDSTDA-----SVASHWRRWEISDITRSYIYRTIFLSDQSKTQCQSLKKML 1532

Query: 1537 KCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPV----TSLSSNREETIEITGKVGS 1592
            K    SF+ T+Y EGY V HNFV+  AN+V +  P         + + +  + +T  +G+
Sbjct: 1533 KVDFHSFFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQALDYDNVMNLTVSLGA 1592

Query: 1593 VKGKFSDKLLKLQDLIPLVVAVTEDDKSDPKAELSKQFKMNTVLLVDKSEIQVVMDKTKV 1652
            +KG+ +D+LLKL+++           +S     +SK +K+N +L  D+SE+Q V+ +T++
Sbjct: 1593 IKGELNDQLLKLRNIFS-KAQTPALKRSKTSINISKSYKVNVLLAFDRSELQFVLGQTRL 1651

Query: 1653 MSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDFSILATTEA 1712
             +R + G+ +LL E LK+S + A S V F+++SE WLKH   +L EA   + S+  T E 
Sbjct: 1652 TNRILNGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLVLAEALSRELSLTMTAEL 1711

Query: 1713 WSHKPTILVNNQCADLHFRAMSTTEQMVNAITEIKESVLKVKEQIKFKPKSKNKSQFVGS 1772
            WS+ P++ +N QC++ H RAM++TE +VN+I +I ES+ ++K     +  + N  Q   +
Sbjct: 1712 WSYMPSLSINIQCSNSHIRAMTSTELLVNSIKQIMESISELKRHFAMEKTTPN-VQGTST 1770

Query: 1773 RI-----NTVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFM 1827
             +     NT L+  FS+V++E+MPL+PF +RHE KQL +Y N+  SNEIL+SIWD +  +
Sbjct: 1771 NLSIPLQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIIL 1830

Query: 1828 TSHQTKEQYLRFSFGDIEIKGGFSKEAYSLINVDISISMIKLTFSEPRRIVNSFLQDEKL 1887
             SHQT EQY  F+ GD+++K     E+ +++NV +S S++KLT SEPRRI++SFLQDEKL
Sbjct: 1831 KSHQTTEQYFNFALGDLQVKCNLPTESSAILNVGLSTSLMKLTLSEPRRILSSFLQDEKL 1890

Query: 1888 ASQGIXXXXXXXXXXXTTDPMNAKKETPAKMINWTLDTNISYFGILVPVASTYFVFELHM 1947
              + +              P+ A+ +T +  + W+LD N++YFGILVP+AST+FVFE+HM
Sbjct: 1891 IGESLGYIKGLLQLF---SPL-ARNKTQSSALRWSLDANLNYFGILVPMASTFFVFEIHM 1946

Query: 1948 XXXXXXXXXXXXXPEQTRLTGQLSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTADT 2007
                              +TGQ+SIEN L LIKE SLP  LSKLLDFSI+V + Q+  ++
Sbjct: 1947 LLAAMNNASDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIRVMSSQKVPNS 2006

Query: 2008 EQSFQVESSHFRVCLSPDSLLRLIWGAYKLLDMVQYYSKRHAPN--IWNIRMFTGKSDKP 2065
             QS+Q+ESSHFRVCLSP SL++++WG ++L  +++Y+ K    +  I    +F G +   
Sbjct: 2007 PQSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRKQDKAISPFSLFDGSASAD 2066

Query: 2066 KEIPINFRSIHILSYKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDFGKFTIVDAFFSV 2125
            ++  I+FRSIHILSY  CIGW+FQ G     GL+ G++RLFSAYEK +GK T++D +FSV
Sbjct: 2067 RQ--IDFRSIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSV 2124

Query: 2126 SNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFLPSFM 2185
            +NG ++ TF+S+G+EK++YNRSFL N+QI+YW K    +KD F R +GEAL+V+ L +  
Sbjct: 2125 ANGQSTDTFYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSF 2184

Query: 2186 DVIDSTLQSIRAFQELKKNILDMPHESNMENSSPDAAPNTENASNSLAPFLDNIRSVNCN 2245
            D+I+STL SI+ FQ LKK  +      +  +S P    N EN SN+++PFL +IR+++C 
Sbjct: 2185 DIIESTLASIQKFQTLKKERM------HKRDSGPRNKLNLENTSNNISPFLSHIRTIDCQ 2238

Query: 2246 FKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTINCTYKHDESKAKPHRIRTLITVDPTHN 2305
            FKY GGV ++Y+ DD+     PS E+KSP V I   Y H+E++ +PHRIR L+++DPTHN
Sbjct: 2239 FKYVGGVLKIYSLDDLNRAEGPSLEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHN 2298

Query: 2306 TLYAGCAPLLMEFSESLQNMIKKHSTGEKKPNFTKPSTQNVDYKRLLDQFDVAVKLTSAK 2365
             LY+ C P+L +  E+ Q M++KHS  E        S+Q++DYK LLD FD+A K+TS +
Sbjct: 2299 ILYSQCVPILNDIVEASQRMVQKHSPDETPLE----SSQSIDYKSLLDSFDIAFKVTSGR 2354

Query: 2366 QQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIFSREVST 2425
            QQLSLSCEP+AKVQADVGF+SF F +TTN+     P G SL++E+ ++S++HIFSRE S 
Sbjct: 2355 QQLSLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSA 2414

Query: 2426 SFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSILHTRPT 2485
            SF V F+D T +FTHPDV   +G +LVSD++VFFN+KQLQNL LFLDIW+ +  L+ +  
Sbjct: 2415 SFSVDFVDFTSIFTHPDV---FGVALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGR 2471

Query: 2486 QRPNNKEVNMSTLSSNSNVDVGTEIPWCFTLIFTNLSGDVDLGPSLGVISLRSQRTWLAT 2545
             + ++++    +++ +      T I W FTLIFTN+ GDVDLGPSLGV+SLR  RTW AT
Sbjct: 2472 AKDDDRKKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFAT 2531

Query: 2546 DHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWVSEVKWPLENSKNTHPLVSTSLNI 2605
            DHY  +R++LHAF D +S+ SEGRLSG+F++ NA+W+SEV +P   S      +S SL++
Sbjct: 2532 DHYGAQRRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSV 2591

Query: 2606 DDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSDEITLSSTALVAAN 2665
              VA+K AFDYHMFLIGTI+ ++FHL +E D  GILPDLL V+ S  E+   +TAL AAN
Sbjct: 2592 GRVAIKTAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAAN 2651

Query: 2666 ILDIYNTIVRMRQDNKISYMETLRDSNPSESKQPILYKDILRSLKLLRTDLSVNISSLKV 2725
            ILDIYNTI RMRQDN+ISY+ETLR+SN +E++  +LY DIL+SL LLRTDLS +I++ K 
Sbjct: 2652 ILDIYNTITRMRQDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKA 2711

Query: 2726 QISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGA 2785
            QISPISLFDVEVLV+ ID VS RSET SG+KLKT+L LQV +   +LSTSKEELDEE  A
Sbjct: 2712 QISPISLFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVA 2771

Query: 2786 SIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGP 2845
             I+I+DYM YASKI GGTI+ +P+L V MTT Q+ K++ +EYLF C F D+++V+WNLGP
Sbjct: 2772 KISIEDYMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGP 2831

Query: 2846 INFIKEMWTTHVKALAVRRSQTANISFGQTXXXXXXXXXXXXNASKFNYIALEEPQIEVP 2905
            INFIKEMW+TH+K+LAVR++Q +N +  +              A K  Y+ L+EP IE+P
Sbjct: 2832 INFIKEMWSTHIKSLAVRQTQ-SNKTMSEKDKQADLDPEEEIKA-KLQYVPLDEPYIEMP 2889

Query: 2906 QIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQYVKI 2953
            QI+DLG+ATPPMEWFGV+RKRLP  THQ A++ +QKLV+ AEK+Y K+
Sbjct: 2890 QIKDLGDATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKV 2937

>ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} similar to
            uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 3006

 Score = 2755 bits (7142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1396/3045 (45%), Positives = 1997/3045 (65%), Gaps = 135/3045 (4%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60
            M+  S  + V L   ++FSWVFLVDW+LT I  LT IFY+GRI+ +L++FILEW++WKR 
Sbjct: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60

Query: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIEN---- 116
            K+KIN+E+LRI+ LGG I F++L +IH+DYTIS LEG++ W+YWL N RK++  EN    
Sbjct: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQENLDNE 120

Query: 117  ---------EKNSSGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKY 167
                      K++SG+  + PC+FLL CEGLE F+YN+T +Y+N+I++ SK+ER +FEK+
Sbjct: 121  EERLENGQEPKSNSGR--KHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKF 178

Query: 168  LNEHSFPEPFSDGSSADKLDEDLSESAYTTNSDSSIINDRDY-----------QETNIGK 216
            +++ +  E F++    +K+  + + S+ T  +  S  NDR+            +  N G+
Sbjct: 179  VDDQTMTELFNESEQENKVLSESTPSSVTMETVGS--NDRNNNEDSNEEEDAGRNQNDGQ 236

Query: 217  YPKGLS------------------FFPIELKLNRGSLLLGNKFTPSVMILSYENGEGIID 258
             P  L                   F PI++   R SL+LGN+FTPS++++S +N +GIID
Sbjct: 237  APNNLENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIID 296

Query: 259  VLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRV 318
            + PPKE+LDL++ K   EL + + S+KQNIG+DD I   FK   G++SKLW+ F R+   
Sbjct: 297  LCPPKEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIF-- 354

Query: 319  VTKPVIPRRGKK--AGPSDDAFFQKWKGLSLYKASAGDAKTSDLDDIEFDFTSHEYAKFT 376
                ++P  G K      D  F + WKGLSLY+    + +  +L++++FDF +HEYA+  
Sbjct: 355  ----LLPTLGPKHLQTQEDITFRENWKGLSLYRQ---NMEEDELENVDFDFANHEYARVI 407

Query: 377  SILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGP 436
            SILK  K+  +Y+ D+PG+VP     T+    GP+VGN+GAPP+F +D+Q++G +ICYGP
Sbjct: 408  SILKSAKIVFTYEYDIPGLVPKEPEETL---QGPEVGNSGAPPEFGVDIQLYGANICYGP 464

Query: 437  WAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNILIMEDTTWRIPTRESSKD 496
            WA+RQ+S+L+ +LSPVVSRT KPIK L PGS+R+YT+F+ +I IME++TWRIPTRE SKD
Sbjct: 465  WAERQLSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKD 524

Query: 497  AEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGFKNDFHVHFVETEIRSSV 556
             EFL+HY +T EE+RPFGW+DL+F KD+Y   +  +CPT EG  N+ + HF   EIR+SV
Sbjct: 525  QEFLRHYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSV 584

Query: 557  NHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQLEAFLLREHITLVADTLSDFSAG 616
            NH++LL++K FD + D+GYPLGWN    W IN+ S QLE F+LREHITL++D  +DFS+G
Sbjct: 585  NHELLLRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSG 644

Query: 617  DPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDKLTIDITVP 676
            DPTPYELFRPF+Y++NW +DGYSIYLNVNDHNIVNNPLDFNENCYLSLHGD L  D+ +P
Sbjct: 645  DPTPYELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIP 704

Query: 677  RESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGRSYDFTIKGCYLLYSELD 736
            R+++    T+++Y ISTPMFR++LNTPPWNTLNEFMK+KEVGRSY+F + G Y ++SELD
Sbjct: 705  RQTVANRCTEITYHISTPMFRLLLNTPPWNTLNEFMKNKEVGRSYNFQVNGLYTVFSELD 764

Query: 737  IDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFGEFFNFVTSEEYTGVLGAREVGE- 795
            IDNVD++++ C+S  T LHCYGFV+RYL+NVKMNYFG+F +FVT+EEYT      E    
Sbjct: 765  IDNVDTISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNE 824

Query: 796  -VVTKSSVVDLASTLDSEYQNGSMKNDAEDNG-PM-KRSDLKRTTNETDIWFTFSVWNGA 852
             +  + S  +++ST D E    + +    + G PM KRS+LKRT NE DIWF FSVW GA
Sbjct: 825  NLGDEHSGFNISSTEDVETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGA 884

Query: 853  LILPETIYSFDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRR 912
            LILPETIY+ DPCIALHF EL VD RS NYYMD++A +N T +KR+VS+  +++F+ +R+
Sbjct: 885  LILPETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRK 944

Query: 913  NNGADEQEHGVLSDLTIHGHRMYGLPPTEPTYFCQWDINLGELNINSDIEFLKGFFTSFY 972
            +NG  E+ HG LS LTIHGHRMYGLPPTEPTYFCQW +++  L INSD+EF KGF T F 
Sbjct: 945  DNGRQEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFS 1004

Query: 973  KVGFGYNDLENILLYDTETINDMTSLTVHAERINISLNDPVMKSQSIVSVESLLFTLIDF 1032
            K+GFG+ +LENILLY+T T+ DMTS+TV  + +   +ND    S+S++  + + FT IDF
Sbjct: 1005 KIGFGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDF 1064

Query: 1033 ENERYSQRIDIKVPKLTVSLSCVMGDGTNTSFL-NFETKLRFTNFGQYKDSDKKRSEQRR 1091
            ENE YSQR+D K P +   +  +  +     FL + +T+L FT+F Q +     R  QR 
Sbjct: 1065 ENEAYSQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQRE 1124

Query: 1092 YIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXXXXXXYIIEDIVG 1151
            YI ++DS Y+RC FLLP F+Q+S  Y++L G                     YIIED +G
Sbjct: 1125 YITLHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATLPPLPLPVLAETIDYIIEDCLG 1184

Query: 1152 EYATLLEATNPFKDLFAETPSTVEPLRASFTXXXXXXXXXPLEFKP-VAFTEEINHER-D 1209
            EYA  +      K   + +  T E  R   T            F P +      N +R +
Sbjct: 1185 EYAPTV------KPDDSSSSDTSEGQRTPLTNEDTRFQANSGFFSPHMPHNPPNNRDRYN 1238

Query: 1210 NYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMVQVLDDIEIGIVKRLSNLQEGIVSISN 1269
            NYV+DV Y+ L++ P +     + L++FY+ED   ++D  EI IVK+L NLQ G   ++ 
Sbjct: 1239 NYVLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVTT 1298

Query: 1270 IDIHVAYLNLIWQETGEEGFELYLDRINYQMSEKSLEKNRTSKSLEVAVLAKVKTVRATV 1329
              +HV  L+ ++      G EL L+  ++ +  K++E       LE  + + + T+R ++
Sbjct: 1299 SRLHVKDLHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISL 1358

Query: 1330 NQKKNPELSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSD 1389
              + +P     +P AL L +E  E+WSST D  VNS+N+TS   T+DESQ+E +  Y   
Sbjct: 1359 -LEAHPSSISMKPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFG 1417

Query: 1390 QGNLIQEVFTSVNSIQNTRSSTKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHV 1449
            Q  ++++  TS   ++N R  T+ +LI  LT+ASEYYQISHDPYVITKPAFIMRLS+GHV
Sbjct: 1418 QIKVLRDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHV 1477

Query: 1450 RENRSWKIITRLRHILTYLPDDWQT--NIDKVLKERKYSFAKDAKNIFMSVFSTWRNWEF 1507
            RENRSW+IITRLRHILTYLP+DW+T  ++  V      +  +  ++IF+SVFS WRNW+ 
Sbjct: 1478 RENRSWRIITRLRHILTYLPNDWRTADHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDL 1537

Query: 1508 SDVARSYIYGKLFLADHAKHKGNSIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVV 1567
            SD+ RSYIY K+FL  +       ++ +LK    SF+ TV   GYEV  + +    N++V
Sbjct: 1538 SDITRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNIIV 1597

Query: 1568 DLTPPVTSLSS----NREETIEITGKVGSVKGKFSDKLLKLQDLIPLVVAVTEDDKSD-- 1621
            D+ PP  + SS     +E+ I +T  +G++KG++ +++ KL++L         DD S+  
Sbjct: 1598 DVLPPSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLG 1657

Query: 1622 ---PKAELS---------------------KQFKMNTVLLVDKSEIQVVMDKTKVMSRTV 1657
                 A +S                     +  K+   ++ ++ ++  V+  T++ +R +
Sbjct: 1658 SISRSASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRII 1717

Query: 1658 GGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDFSILATTEAWSHKP 1717
             G+ S+L EN K++T  A S V F+Q+ E+WLKH + +L E  L    + AT +     P
Sbjct: 1718 NGKNSMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQL-GVIP 1776

Query: 1718 TILVNNQCADLHFRAMSTTEQMVNAITEIKESVLKVKEQIKFKPKSKNKSQFVGSRINTV 1777
             + +N Q  +   RAM +T  + N++ +IK  V  +  Q  FK      S  V  +   +
Sbjct: 1777 FVSLNCQATNSFIRAMPSTVVLRNSVEKIKRQVEVLIPQ--FKSHEVKNSSAVTKKTPRI 1834

Query: 1778 -----LSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQT 1832
                 +   F+++SSEIM LSPFY+  + KQL IY +   + E++L   + D ++ S  +
Sbjct: 1835 PIKFDIRFNFTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLS 1894

Query: 1833 KEQYLRFSFGDIEIKGGFSKEAYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGI 1892
             EQ+ +FS  D++ K   + E   ++ V IS S++KLT  EPRR +++ LQDE+   + +
Sbjct: 1895 SEQFFKFSSTDLQFKCEVADEVVPVVEVQISTSLMKLTLCEPRRALHNLLQDEQTLVESV 1954

Query: 1893 XXXXXXXXXXXTTDPMNAKKETPAKMINWTLDTNISYFGILVPVASTYFVFELHMXXXXX 1952
                       +    N +  +P++   W LD N+ YFG+LVPV+S  ++FELH      
Sbjct: 1955 DHIQKLWNFLRSASGGNDR--SPSRNTRWALDANLKYFGLLVPVSSICYIFELHSLFASL 2012

Query: 1953 XXXXXXXXPEQTRLTGQLSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQ 2012
                          +GQ+ +E+   L+KE SLP  LSK+LDFSI+  T Q+  ++ QS+Q
Sbjct: 2013 TNANEQYEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQ 2072

Query: 2013 VESSHFRVCLSPDSLLRLIWGAYKLLDMVQYYSKRHAPNIWNIRMFTGKSDKPKEIPINF 2072
            +ESS+FR+CL P+ L+ ++W  + L  ++ ++ K H P  W +   + K+ K  E  ++F
Sbjct: 2073 IESSYFRLCLFPELLVDILWSVHYLQSLLNHFKKHHTP--W-LPYSSNKTAKSGESTLDF 2129

Query: 2073 RSIHILSYKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSS 2132
            RSIHILSY FC+GWLF+ G   +PGL+ GY+RLFSAYEK FGK T++D + SV+NGNTS 
Sbjct: 2130 RSIHILSYNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSD 2189

Query: 2133 TFFSEGNEKEKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFLPSFMDVIDSTL 2192
            TF+S+ +EK+ Y R++L NMQI YW K    LKD F RFHGE +DV FL +   +++ TL
Sbjct: 2190 TFYSQKSEKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTL 2249

Query: 2193 QSIRAFQELKKNILDMPHESNMENSSPDAAPNTENASNSLAPFLDNIRSVNCNFKYDGGV 2252
             SI+ F E+KK  +          SS  +  N E ASN+LAPFL +IR++N    + GGV
Sbjct: 2250 HSIKRFNEMKKAKI------KQTGSSTKSKLNMEAASNTLAPFLAHIRTINSQLNFAGGV 2303

Query: 2253 FRVYTYDDIEAKSEPSFELKSPVVTINCTYKHDESKAKPHRIRTLITVDPTHNTLYAGCA 2312
            F+VY+  ++++K+EP  E+KSP V +   Y+ +E++ K H IR   T++PTHN L+A CA
Sbjct: 2304 FKVYSPTELDSKAEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCA 2363

Query: 2313 PLLMEFSESLQNMIKKHSTGEKKPNFTKPSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSC 2372
            PLL +F+ +++NMI+  S+ E K + +KP T ++DYK LL+ +D+A ++ S KQ+LS SC
Sbjct: 2364 PLLSDFNHNIKNMIRNLSS-EDKSHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSC 2422

Query: 2373 EPKAKVQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIFSREVSTSFEVGFM 2432
            EPKAKVQ D GF SFLF +TT++ DS +P   S ++++ ++S++HIFSR+ S +F + ++
Sbjct: 2423 EPKAKVQLDAGFNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYI 2482

Query: 2433 DLTLLFTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSILHTRPTQRPNNKE 2492
            D+ ++FT+P+V   YG +LVSD++++ N+KQ QNL +FLDIWR S+   T+P++     +
Sbjct: 2483 DIVMMFTYPNV---YGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDK 2539

Query: 2493 VNMSTLSSNSNVDVGTE----IPWCFTLIFTNLSGDVDLGPSLGVISLRSQRTWLATDHY 2548
             +     S        +     PW FT+IFTN+ G VDLGPSLGV++L  ++ W+ T H 
Sbjct: 2540 SDAKKSLSPPFSPSSNDSRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQ 2599

Query: 2549 DEKRQLLHAFTDGISLTSEGRLSGLFEVANASWVSEVKWPLENSKNTHPLVSTSLNIDDV 2608
             ++++  H F  GI++ SEGRLSG+FE+  AS VSE+ WP E+     PL+S S+ I+ +
Sbjct: 2600 GDQKRTWHTFAHGITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRM 2659

Query: 2609 AVKAAFDYHMFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSDEITLSSTALVAANILD 2668
            ++K+AFDYHMFLIG++ +++ HLHNE D+  ILPDLLQVS   + I L +TAL AAN LD
Sbjct: 2660 SIKSAFDYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCATALTAANALD 2719

Query: 2669 IYNTIVRMRQDNKISYMETLRDSNPSESKQPILYKDILRSLKLLRTDLSVNISSLKVQIS 2728
            IYNTI+RM+QDN+ISY+ETL++SN S S   + Y+++L SL LLRTD+SV +  LKV IS
Sbjct: 2720 IYNTIMRMQQDNRISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHIS 2779

Query: 2729 PISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIA 2788
            P+SLFD EVLVV +  V+ RSET SG+KLKT+LQLQ+ DV+A+LS+SKEELDEE  + IA
Sbjct: 2780 PMSLFDAEVLVVSVRDVNARSETQSGEKLKTELQLQISDVNASLSSSKEELDEETVSKIA 2839

Query: 2789 IDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPINF 2848
            +DDYM YASK  GGTII +P+L V MTT Q++ +  LEYLF C F DKIS++WNLGP+NF
Sbjct: 2840 VDDYMLYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNF 2899

Query: 2849 IKEMWTTHVKALAVRRSQTANISFGQTXXXXXXXXXXXXNASKFNYIALEEPQIEVPQIR 2908
            IKEMW THV++LAVRR+Q  N S                  SKF Y+ L+EP IE+PQI+
Sbjct: 2900 IKEMWATHVRSLAVRRTQLGNSS--PELEVANESDKEDTVKSKFIYVPLDEPYIEMPQIK 2957

Query: 2909 DLGEATPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQYVKI 2953
            DLG+ATPP+EWFGV+RK LP  THQTAV+ +QKLV+ AEK+Y K+
Sbjct: 2958 DLGDATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKL 3002

>Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..19356)
            [8988 nt, 2996 aa]
          Length = 2995

 Score = 2664 bits (6906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1366/3028 (45%), Positives = 1961/3028 (64%), Gaps = 104/3028 (3%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60
            ME  SQ   + L  +K FSWVFL  W+LT IA LT IFY+ R++  + +FIL W +WK+ 
Sbjct: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60

Query: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAEL-----IE 115
            K+KIN+E++R+S LGG ++ K++S+I++D+T+S LE  + W+YWLLN R+ E      + 
Sbjct: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120

Query: 116  NEKNSSG---------KNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEK 166
            +E++            KN +LPC  L+EC+G E F+YNR  AY+NV+ L +K+ER+KF  
Sbjct: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180

Query: 167  YLNEHSFPEPFSDGSSADKLDEDLSESAYTTNS-DSSIINDRDYQETNIGKYPKGLSFFP 225
            +LNEH   +  S+ ++ + +D+D  ES  T NS +S++INDR Y++    +     +F P
Sbjct: 181  FLNEHDLGDIVSEDTNVNSMDKDYFESVTTENSSESTVINDRTYKKNKDERKSILFNFLP 240

Query: 226  IELKLNRGSLLLGNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIK 285
            I+L+L  G++ LGN+FTPS+++ SYEN  G++DV    E++DLY++K  ++ ++  IS+K
Sbjct: 241  IQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNISVK 300

Query: 286  QNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRVVTKPVIP----RRGKKAGPSDDAFFQK 341
             N+ YD     +  +D GK+S++W TF+ ++ ++  P          KK    +  F  K
Sbjct: 301  PNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMFVNK 360

Query: 342  WKGLSLYKASAGDAKTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAH 401
            W+GLSLYK +  DA    LD+  +DF + EYAKF+SILKCP  TLSY +D PG+VPHGAH
Sbjct: 361  WRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPHGAH 420

Query: 402  PTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIK 461
             T    DGPD+GN+G+PP+F +D+Q+   SI YGPW  RQVS+L R+LSPVVS+   PIK
Sbjct: 421  QTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQIPIK 480

Query: 462  KLPPGSRRVYTLFRMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFC 521
            KL PGSRR++T+F+M++ I+++++WRIPTRE SKD EF++ + KT++++RPFGW+D    
Sbjct: 481  KLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDFNLN 540

Query: 522  KDTYANFNISVCPTVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNS 581
            K T A FN S+ PT++G  N+F +HF++ E+ +SVNHDILLKSK FD+  DIGYPLGWNS
Sbjct: 541  KGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLGWNS 600

Query: 582  NTIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIY 641
               W  ++ ++QLE FLL+EHI+L +D  SDF++ DPTPYELFRPF Y +NW+++GYSIY
Sbjct: 601  QADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGYSIY 660

Query: 642  LNVNDHNIVNNPLDFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLN 701
            LNVND NIVNNPLDFNENCYLSLHGD+L ID  +P   I   YT++++ I TPMFR++LN
Sbjct: 661  LNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRLLLN 720

Query: 702  TPPWNTLNEFMKHKEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVM 761
            TPPWNTL+EFMK KEVGR++DF I+G YL+YS+LDIDNVD++T+ CTS ST L CYG V+
Sbjct: 721  TPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYGVVI 780

Query: 762  RYLINVKMNYFGEFFNFVTSEEYTGVLGAR------EVGEVV--TKSSVVDLASTLDSEY 813
            RYL+NV+ NYFG+F +F+TSEEY+ +L         E G     T SSV + +S     Y
Sbjct: 781  RYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSFTYSTTSSVQNSSSDDTVLY 840

Query: 814  QNGSMKNDAEDNGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTEL 873
                 K        ++R+D+ RT NE DIWFTF VW+GALILPE +Y+ + C +L F+EL
Sbjct: 841  ----TKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFSEL 896

Query: 874  VVDFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHR 933
            ++ FR  NYYMD +  L    I R ++   +E+F ++R  +      HG LSD+TIH HR
Sbjct: 897  MISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTIHAHR 956

Query: 934  MYGLPPTEPTYFCQWDINLGELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETIN 993
            M+GLPP + TYFCQW I+ G L I+S+IEFL  FF  F K+GFGY++LEN L+Y  E+ +
Sbjct: 957  MFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVESSD 1016

Query: 994  DMTSLTVHAERINISLNDPVMKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLS 1053
            DMT LT++ E++ I ++D V + Q+ + +  L    IDF+NERYS+RI++K+P+ ++S+ 
Sbjct: 1017 DMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFSISIF 1076

Query: 1054 CVMGDGTNTSFLNFETKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQD 1113
             V         L F+TK+ FTNF   +D     + QR YI ++DSPYHRC F+LP  YQ+
Sbjct: 1077 DVRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPTMYQE 1136

Query: 1114 SDTYQKLYGXXXXXXXXXXXXXXXXXXXXXYIIEDIVGEYATLLEATNPFKDLFA----E 1169
            S  Y +LYG                     +++ED + EY+ LLE  NPF ++ +    +
Sbjct: 1137 SFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLE--NPFLNIRSINNLD 1194

Query: 1170 TPSTVEPLRASFTXXXXXXXXXPLEFKPVAFTEEINHERDNYVIDVSYILLDIDPLLFVF 1229
            T S     R   T           E   V +  +  +E DNY+++V YI +DI+PL   F
Sbjct: 1195 TSSLFNEYRVD-TYISEKAIFKAEEKNTVNYDPK--YEYDNYILNVEYIRVDINPLFSDF 1251

Query: 1230 TKSLLEQFYSEDMVQVLDDIEIGIVKRLSNLQEGIVSISNIDIHVAYLNLIWQETGEEGF 1289
              S+  + YSE+MV ++D+IE+ IV+RL + ++ ++  +N+ + ++Y+++ W     EG 
Sbjct: 1252 IDSMSTKLYSENMVDIIDEIEMIIVRRLGSPKKVLLRETNLKLKISYVDIFWGSRNSEGI 1311

Query: 1290 ELYLDRINYQMSEKSLEKNRTSKSLEVAVLAKVKTVRATVNQKKNPELSEDRPPALSLGL 1349
            E+YLD+++++M ++  +        E  +L+K+K++R + ++ +  E+  +RPPALSL +
Sbjct: 1312 EIYLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYERPPALSLTV 1371

Query: 1350 EGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTRS 1409
            EG EVWS T   Q NS+N+ S+DIT+D SQ  WL +Y + Q      +  SV+ +Q    
Sbjct: 1372 EGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLLQKRDV 1431

Query: 1410 STKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLP 1469
            + +  LISKLT ASEYYQI HDPYVITKPA IMRLS  HVRENRSW+I+TRLRHIL YLP
Sbjct: 1432 TLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHILNYLP 1491

Query: 1470 DDWQTNIDKVLKERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFLADHAKHKG 1529
            + W+ +    ++ R      D KN+F+SVFS WRNWE SDVARSYIY ++FL D  K   
Sbjct: 1492 EGWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFLPDIEK--- 1548

Query: 1530 NSIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLT----PPVTSLSSNREETIE 1585
            N I    K  M SFY T+Y + Y V+HN VV   N+++D       P  + ++  ++  +
Sbjct: 1549 NLINNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKAATANKNDKIYD 1608

Query: 1586 ITGKVGSVKGKFSDKLLKLQDLIPLVVAVTEDDKSDPKAELSKQFKMNTVLLVDKSEIQV 1645
            ITG VG+ KG+  D+L++L+ L     A    +KS     + K FK+N VL+V+K E+ +
Sbjct: 1609 ITGTVGTFKGELGDQLIRLKKLYSEDKAKIRSEKS-TDFSIPKFFKINIVLIVEKGELTL 1667

Query: 1646 VMDKTKVMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDFS 1705
                TK++SR   G++S  +EN +D  + +GS+V ++ ++E+WLKH   IL +A L D  
Sbjct: 1668 AAANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHLDDLF 1727

Query: 1706 ILATTEAWSHKPTILVNNQCADLHFRAMSTTEQMVNAITEIKESVLKVKEQIKFKPKSKN 1765
            I    E    KPTILVN + + L F+A+  T+ +V  + E +  + K+  ++  K   K 
Sbjct: 1728 ISVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDKDNKKR 1787

Query: 1766 KSQ----FVGSRINTVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIW 1821
             +     F   +I+        ++SSEI+ LSPF ++H  K+L I FN+ G N+ + SI 
Sbjct: 1788 HTSTSPIFSTKKIDISFDINIFDISSEIVILSPFTVKHSMKELKIVFNREGDNDTIFSIL 1847

Query: 1822 DTDFFMTSHQTKEQYLRFSFGDIEIKGGFSKEAYSLINVDISISMIKLTFSEPRRIVNSF 1881
            D D ++TS+Q   QY R S+ DI ++   +     LI ++I  S+IKLT ++P++I NS 
Sbjct: 1848 DADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLTLADPKKITNSL 1907

Query: 1882 LQDEKLASQGIXXXXXXXXXXXTTDPMNAKK-ETPAK-MINWTLDTNISYFGILVPVAST 1939
            LQDEK   Q +           +   +     + P K M+N+ L    +YFG+L PV ++
Sbjct: 1908 LQDEKTFEQSLESIKTLNTLFSSNREVRTSAVDNPYKFMVNFDL----TYFGLLFPVDTS 1963

Query: 1940 YFVFELHMXXXXXXXXXXXXXPEQTRLTGQLSIENILFLIKERSLPIGLSKLLDFSIKVS 1999
            YF+ ELH                + ++T  L+++N LF+IK   +   +SK+LDFS+ +S
Sbjct: 1964 YFILELHSLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSKVLDFSVNLS 2023

Query: 2000 TLQRTADTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLDMVQYYSKRHAPNIWNIRMFT 2059
            T  +  ++++SF+VESSHFRVCL+P+SLL+++ G ++     +YY K H      +++F 
Sbjct: 2024 TETKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYY-KEHT----RLQIFK 2078

Query: 2060 GK------SDKPKEIPINFRSIHILSYKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDF 2113
             K      S+     P+   SIH LSY FCIGW+F+      PGL+ GY+RLFSAYE  +
Sbjct: 2079 TKKKASVVSENLIGAPLIEYSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSY 2138

Query: 2114 GKFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFKRCGELKDWFFRFHG 2173
            GK T+VD FFS++NG +S TF+S+GNEKEKYNRS+LPN+QI YW K    +K  F RF+G
Sbjct: 2139 GKLTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYG 2198

Query: 2174 EALDVNFLPSFMDVIDSTLQSIRAFQELKKNILDMPHESNMENSSPDAAPNTENASNSLA 2233
            E +DV FL +F  +I+ T++S++ FQ +KK  +    E N+E    +     ++ S   +
Sbjct: 2199 ETIDVRFLSNFATIINLTIESVQHFQMIKKETV---REMNVE---AEKKVGEDDISTKFS 2252

Query: 2234 PFLDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTINCTYKHDESKAKPHR 2293
             F   ++ +NC   YDGGVF VY        +E + E+ +P V I+  YK+     KPH 
Sbjct: 2253 LFFSKVQRINCQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKKPHW 2312

Query: 2294 IRTLITVDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEKKPNFTKPSTQNVDYKRLLD 2353
            IR+ I ++PT+NTL +  A  L EF ES+  M+ K S  E+ P   K  +  +DYKR+L+
Sbjct: 2313 IRSFINIEPTYNTLLSQFASFLTEFGESVHEMVAKFSPKEQPPA-PKTVSPPIDYKRILE 2371

Query: 2354 QFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTKA 2413
             FDV+  +++ KQ++SLSCEP AKV A+VGFESF+FS+ TN+ D  +PL  SLT+   K 
Sbjct: 2372 DFDVSFSISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKT 2431

Query: 2414 SIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLDI 2473
            SI H FS E + SF V F+D+T LFTHPD+   YGT+L+SDVS++FN+KQLQNL +FLDI
Sbjct: 2432 SINHEFSTEPTASFSVDFVDITTLFTHPDI---YGTTLISDVSLYFNIKQLQNLMVFLDI 2488

Query: 2474 WRFSSILHTRPTQRPNNKEVNMSTLSSNSNVDVGTEIPWCFTLIFTNLSGDVDLGPSLGV 2533
            W    ++  RP +    K+      SS  +    T IPW FT+I T+++GD+ LGPSLG 
Sbjct: 2489 WNLKRLIKLRPQKSVPVKKPESRVSSSTKSSSNTTIIPWSFTVIITDINGDIHLGPSLGN 2548

Query: 2534 ISLRSQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWVSEVKWPLENSK 2593
            +SL+ ++ W++T+H+ ++R+ L  FTD +SLTS GRL GL +VAN SW+  V++ +EN K
Sbjct: 2549 LSLKLKKNWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRY-VENEK 2607

Query: 2594 -NTHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSD 2652
             +  PLV  +LN+++VAVKAAFDYHMFLIG ++NI F+L +EKD  G LPDLL++    D
Sbjct: 2608 LDQSPLVDITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCD 2667

Query: 2653 EITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPSESKQPILYKDILRSLKLL 2712
            EI + STALVA+NILDI NTI R RQD++ SY+ETL +SNP   K  I Y DIL+SL LL
Sbjct: 2668 EIDICSTALVASNILDISNTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSLNLL 2727

Query: 2713 RTDLSVNISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAAL 2772
            RTD+ + I  ++VQISPISLFDVEV+V  ++ VS RS T SG+KL TDLQ+++   + +L
Sbjct: 2728 RTDVGIEIHKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSL 2787

Query: 2773 STSKEELDEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACS 2832
            S S EELDEE  + I++DDYM YA K+ GG I+ IPKL V MTT Q E +  +EYLFAC 
Sbjct: 2788 SKSNEELDEEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACK 2847

Query: 2833 FSDKISVRWNLGPINFIKEMWTTHVKALAVRRSQTANISFGQ-------------TXXXX 2879
            F DKISVRWNLGP+NFIKE+W THVK+LAVRR+Q       Q             +    
Sbjct: 2848 FHDKISVRWNLGPVNFIKEVWATHVKSLAVRRAQLKGDKEPQLVPGIIGEPSPLVSSEEL 2907

Query: 2880 XXXXXXXXNA----------SKFNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPK 2929
                    NA           KF Y+ L+EPQIE+P+I+DL +ATPP+EWFGVNRK+ P+
Sbjct: 2908 EMLRSESSNADNDNNEYSEEDKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPR 2967

Query: 2930 FTHQTAVIPVQKLVYLAEKQYVKILDDT 2957
             THQTA+I +QK+V++A+K+Y K+L D+
Sbjct: 2968 VTHQTAIILIQKIVHVAQKEYAKVLGDS 2995

>TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3148

 Score = 2388 bits (6188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1191/2577 (46%), Positives = 1695/2577 (65%), Gaps = 59/2577 (2%)

Query: 414  NNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTL 473
            N  APP+  ++ Q+   SI YGPWA R + ++QR+ SP+VSRT +      PG  R YT+
Sbjct: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649

Query: 474  FRMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVC 533
             ++++ IMED++WR+PTRE SKD +FL+ Y KT++  R FGW DL F +++ A F IS  
Sbjct: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709

Query: 534  PTVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQ 593
            P V G+ N  ++ F + E+RSSVNHDI  +SK + +D DIGYPLGWN    W     S Q
Sbjct: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769

Query: 594  LEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNP 653
            LE F LREH+ L+ADT SDFS+G+PTPYE FRP +YK++W   GYS YLNVNDHNI+NNP
Sbjct: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829

Query: 654  LDFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMK 713
            LDFNENCY+S+HGD   I + +PR  I  TYTD+ ++ISTPMFR++LNTPPWNTLNEFM+
Sbjct: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRLLLNTPPWNTLNEFMR 889

Query: 714  HKEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFG 773
            +KE+GR YDFT +G Y++YS+LDIDNVDSLTI C++    L  YGFV+ YL+NV+MNYFG
Sbjct: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949

Query: 774  EFFNFVTSEEYTGVLGAREVG--------EVVTKSSVVDLASTLDSEYQNGSMKN--DAE 823
            EF +F+T+EEYT ++   +           V+++++ V   S       N S  N  D  
Sbjct: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFSVMSETNSVSNVSNSQHNPDNSSKSNIIDPL 1009

Query: 824  DNGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYY 883
             N P+++ D+KR  NETDIWFTFSVW GAL+LPE +Y+ DPCIAL F EL++DFR+C+YY
Sbjct: 1010 YNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDYY 1069

Query: 884  MDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPT 943
            +D++A LNGTS KR + K  N++F+ +  N   + +EHG +S+++IHGHRMYG PPT P+
Sbjct: 1070 LDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSPS 1129

Query: 944  YFCQWDINLGELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAE 1003
            YF  W +++  L+INSDI F++GF +   KVGF +++L+NILLYD   +++MTS+TVH  
Sbjct: 1130 YFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHGT 1189

Query: 1004 RINISLNDPVMKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTS 1063
             I+I + D    +Q +++++ + F  I+F N+RYS RID++VP L  +          T 
Sbjct: 1190 GIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFDNGSSMDKTC 1249

Query: 1064 FLNFETKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGX 1123
               F+TK+ FTNF Q KD +    +Q+ +I +NDS +HRC FLL    Q+S  Y +LYG 
Sbjct: 1250 LFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELYGG 1309

Query: 1124 XXXXXXXXXXXXXXXXXXXXYIIEDIVGEYATLLEATNPFKDLFAETP--STVEPLRASF 1181
                                +II+D +G +   + +T     +   TP  S+ +PL+   
Sbjct: 1310 ITPSSSVPPLPIPVQAETIAFIIDDFLGPFG--INSTELLGSISTSTPIHSSNKPLKPPS 1367

Query: 1182 TXXXXXXXXXPLEFKPVAFTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSED 1241
            +              P   ++ + H   NY+ID+SYI LDI+PL F +  + L++FYSE+
Sbjct: 1368 SSVIHPIESMQSHLVP---SQSVTH--GNYIIDISYITLDINPLFFTYASNFLDEFYSEN 1422

Query: 1242 MVQVLDDIEIGIVKRLSNLQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDRINYQMS 1301
            +++ +D IE+ IV RL    E + S++NI + + YL+  + +   EG ELY+D+I+ ++S
Sbjct: 1423 IIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELYVDQIDLEVS 1482

Query: 1302 EKSLEKNRTSKSLEVAVLAKVKTVRATVNQKKNPELSEDRPPALSLGLEGFEVWSSTEDR 1361
            +K+ +K  T    E+A+L++  ++RA++N+KK  E  ++RPPALSL LEG+E WSST   
Sbjct: 1483 QKTFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSSTASS 1542

Query: 1362 QVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTELISKLTA 1421
            QVNSLN++S+DIT+DESQ+EWL +Y +     + E+  S++SIQ   +  + +L+S LT 
Sbjct: 1543 QVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQKKLVSDLTL 1602

Query: 1422 ASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTNIDKVLK 1481
            ASEYYQISHDPYVITKPA++MR+SKGHVR+NRSW+I+TRLRHI TYLPDDW+ ++ + ++
Sbjct: 1603 ASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWEIHVQEEMR 1662

Query: 1482 ERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKLLKCTMG 1541
             +  +   D+ +IF++VFS WRNWE SDVARSYIY K+FL++        ++  +K  + 
Sbjct: 1663 GKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQTTVKLNLN 1722

Query: 1542 SFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLSSNREETI-EITGKVGSVKGKFSDK 1600
            S + T+Y  GY ++HN ++  A ++++LT   T++S   E++I  +TG +GS+KG+FSDK
Sbjct: 1723 SIFFTIYSTGYAIDHNIILTKAVILLELTTE-TAVSPPIEKSILNMTGSLGSIKGEFSDK 1781

Query: 1601 LLKLQDLIP------LVVAVTEDDKSDPKAELSKQFKMNTVLLVDKSEIQVVMDKTKVMS 1654
             L+L +LIP       + ++TE+  S   +E S  F ++  LL +   +Q+ M  T + +
Sbjct: 1782 FLRLLELIPDFSKEEDIKSLTEN--SSIVSEKSPYFTIHLFLLFENGGLQLTMGDTTLSN 1839

Query: 1655 RTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDFSILATTEAWS 1714
                G++S L E    S   + S   + +KSE+ LKH   I+ E QL    +++T     
Sbjct: 1840 NVTDGKISALLEKSSYSKEFSYSGAYYMKKSEMCLKHNKDIIAEFQLHHLGLISTGIYTP 1899

Query: 1715 HKPTILVNNQCADLHFRAMSTTEQMVNAITEIKESVLKVKEQIKFKPKSKNKSQFVGSRI 1774
              P IL+N + ADLHF+++++TE++V  I +I E  + + +    + K   K   V  + 
Sbjct: 1900 ICPVILINLRSADLHFKSLASTEKIVKTIEDITEYSVHLYKHYDLR-KYTTKPTKVDQKP 1958

Query: 1775 NTV-----LSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTS 1829
              +     ++C  S VS+E+  +SPFY+R+E KQLD+YFN+ G  EILLS+WDTD F+TS
Sbjct: 1959 EKINFDVRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGDGEILLSLWDTDIFVTS 2018

Query: 1830 HQTKEQYLRFSFGDIEIKGGFSKEAYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLAS 1889
            H TKEQY RFS+ DI+I      E   ++ V +S S++KLTFSEPRRI  SFLQDE++  
Sbjct: 2019 HHTKEQYFRFSYDDIQINCNPMSEKNKVLVVSLSASLVKLTFSEPRRIFASFLQDERITI 2078

Query: 1890 QGIXXXXXXXXXXXTTDPMNAKK--------ETPAKMINWTLDTNISYFGILVPVASTYF 1941
            +              ++  N KK        +TP K   W L+ NI+YFGIL+P+AST+F
Sbjct: 2079 ESFQELKKLKKIFF-SNAKNVKKLNNDVPKEDTPTK---WALELNINYFGILLPIASTFF 2134

Query: 1942 VFELHMXXXXXXXXXXXXXPEQTRLTGQLSIENILFLIKERSLPIGLSKLLDFSIKVSTL 2001
            V ELHM                 +++GQ+S+ENILFLI +RSLP+ LSKL+DFSI++STL
Sbjct: 2135 VLELHMLLGSLTNTTEEIQEVNNQISGQISLENILFLINDRSLPLRLSKLVDFSIRISTL 2194

Query: 2002 QRTADTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLDMVQYYSKRHAPNIWNIRMF-TG 2060
            Q+T  + +S Q+ESSHFR+C SP+SL+ ++WG  +L + ++YY        WN+    TG
Sbjct: 2195 QKTTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTKRQWNLSSHKTG 2254

Query: 2061 KSDKPKEIPIN-FRSIHILSYKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDFGKFTIV 2119
                  E P+N FRSIHILSY FCIGW+      D PG MFGY+RLFSAYEK++GK T++
Sbjct: 2255 TKSSTSESPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTLI 2314

Query: 2120 DAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVN 2179
            + + SV+N N+S+ FFS+G EK ++NRSFLP+MQI YW K     KD F R HG+ALDV+
Sbjct: 2315 EGYMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDVD 2374

Query: 2180 FLPSFMDVIDSTLQSIRAFQELKKNILDMPHESNMENSSPDAAPNTENASNSLAPFLDNI 2239
             L +F+++I+   +S + F++ +K+ +      N+E         +ENA+  +  FL +I
Sbjct: 2375 ILSNFVNIIELIFKSYQIFEDFRKSKI----VQNIEKQKHHEHIKSENATEFVPTFLSDI 2430

Query: 2240 RSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTINCTYKHDESKAKPHRIRTLIT 2299
             S+NC FKY+GG  RV++ DD+E  S PS EL +P V+I   YKH +   KPH +R +I 
Sbjct: 2431 NSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHFDDSPKPHWLRCVID 2490

Query: 2300 VDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEKKPNFTKPSTQNVDYKRLLDQFDVAV 2359
            +  +HN LY+ CAP ++EF ES+Q +++     E K + +K +T N  YKR+L  FD+A 
Sbjct: 2491 IHSSHNILYSKCAPFVIEFVESIQEILENRPV-EPKQSVSKIATPNRTYKRILAPFDIAF 2549

Query: 2360 KLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIF 2419
            ++ +AKQ LS SCEP AKVQA+VG +SFLF ++T     E PL  +L + +   S++HIF
Sbjct: 2550 RIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTLCINKISTSVQHIF 2609

Query: 2420 SREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSI 2479
            S+E S SF + F+DLT +FT P   ++Y   L+SD+ +FFN+KQ QNL LFLDIW  S  
Sbjct: 2610 SKEASASFSLNFIDLTFIFTQP---TLYCVGLISDIDIFFNMKQQQNLLLFLDIWHLSES 2666

Query: 2480 LHTRPTQRPNNKEVNMSTLSSNSNVDVGTEIPWCFTLIFTNLSGDVDLGPSLGVISLRSQ 2539
            +  RP ++    + +            G  IPW F +IFTN++ D+ LGP+LG++S + +
Sbjct: 2667 IGIRPNRKKRKHKKHKGHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGPALGIVSAKLE 2726

Query: 2540 RTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWVSEVKWPLENSKNTHPLV 2599
            +TW  +D Y +KRQ+L  FTDG+ L S GRLSG+ +++NA W  EV +         P+V
Sbjct: 2727 KTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYADNELNYNSPIV 2786

Query: 2600 STSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSDEITLSST 2659
            +  ++I  VA+K AFDYHMF+I  +NNI F LH+E+D +G LPDLL  +   +EI++ ST
Sbjct: 2787 AIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDLLLTTLLCEEISICST 2846

Query: 2660 ALVAANILDIYNTIVRMRQDNKISYMETLRDSNPSESKQPILYKDILRSLKLLRTDLSVN 2719
             LVA+NILDIYNTI+R RQD K SY ETL +SN  +++  I Y DIL+SL LLRTD+ ++
Sbjct: 2847 TLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSLNLLRTDVQID 2906

Query: 2720 ISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEEL 2779
            +S L++QISPISLFD EVLV+ ID +S RSET S  KLKT L+LQV + S ALST+KEEL
Sbjct: 2907 VSKLQLQISPISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNASVALSTAKEEL 2966

Query: 2780 DEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISV 2839
            DEE    I++ DYM YASKI GGTI+ IPKL V MTT Q+  +N +EY F C F  K+SV
Sbjct: 2967 DEESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKVSV 3026

Query: 2840 RWNLGPINFIKEMWTTHVKALAVRRSQTANISFGQTXXXXXXXXXXXXNAS--KFNYIAL 2897
            RWNLGP+NFIKEMW THVK+LAVR+++        +              +  KF Y+AL
Sbjct: 3027 RWNLGPVNFIKEMWATHVKSLAVRQARIEEPVEYSSEELESSPESIYLEPAQPKFTYVAL 3086

Query: 2898 EEPQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954
             EP IE+PQI+DL +ATPPMEWFG+NRK+ P FTHQTAVI VQKLV+  EK+Y KI+
Sbjct: 3087 VEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKII 3143

 Score =  189 bits (479), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 125/172 (72%), Gaps = 9/172 (5%)

Query: 9   GVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRAKIKINVET 68
            V L+ +K FSWVFLV WILT I CL   FY+ R++AY ++FIL+WLLW+  K+KI+ E+
Sbjct: 9   SVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIHCES 68

Query: 69  LRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKA--ELIENEK-------N 119
           +R+SLL  RI FK+L +I ++ TISILEG + W+YWLLN R +  EL + +K        
Sbjct: 69  IRLSLLSARISFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYITPG 128

Query: 120 SSGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEH 171
           S  KNI+LPCKFL +CEG E F+YN+T AY+N+I+  S DE+ K++++L++H
Sbjct: 129 SGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKH 180

 Score =  149 bits (377), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 119/190 (62%), Gaps = 13/190 (6%)

Query: 221 LSFFPIELKLNRGSLLLGNKFTPSVMILSYENGEGIIDVLPPKE-RLDLYRNKTHLELKN 279
           L+F+P  LKL +GS++ GNKFTPS++I+SY++ EGI+DVLP    R+DLY+ K  L+ +N
Sbjct: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357

Query: 280 FEISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRVVTKPV-----IPRRGKKAGPS 334
           FEI +K NI Y+D    K       +S+LW  F  +  ++  P+       R  K +   
Sbjct: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417

Query: 335 DDAFFQ------KWKGLSLYKASAGDAKTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSY 388
           +D  F+      KWKGLSLYK +A +    + + IEFDF +HEYA++ SI+K P++  + 
Sbjct: 418 EDNIFEDEDFEKKWKGLSLYKDAALNRGNPE-EHIEFDFLNHEYARYCSIVKAPRLIFTN 476

Query: 389 DVDVPGVVPH 398
           + D+PG+VP+
Sbjct: 477 EYDIPGIVPY 486

>TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3046

 Score = 2226 bits (5767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1171/2905 (40%), Positives = 1769/2905 (60%), Gaps = 114/2905 (3%)

Query: 122  GKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEPFSD-- 179
             KN +L   F + C G E F+YNR  AY+ +I   SK+E+ +F  +L +H   + F +  
Sbjct: 179  NKNKKLDSLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVS 238

Query: 180  ---------------------GSSADKLDED-----LSESAYTTNSDSSIINDRDYQETN 213
                                 GSS     E      +S  +   +SD S I++R+    +
Sbjct: 239  SEIKNCNEYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQENDSDRSNIDNRNKISAH 298

Query: 214  IGKYPKGLSFFPIELKLNRGSLLLGNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKT 273
            I +    L   P+++ +N+G++ +GNKFT S++++++    G++D   P  +LD+++NK 
Sbjct: 299  IMR-KLHLDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKV 357

Query: 274  HLELKNFEISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAGP 333
              E+ + ++SIK+NIGY+  +  +F    G ++++W     VL ++    +    +    
Sbjct: 358  TFEINDIDMSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRY 417

Query: 334  SDDA-FFQKWKGLSLYKASAGDAKTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDV 392
             +D  F +KW GL LYK S   +     DD++FDF +HEYAK ++  K P++  S + D+
Sbjct: 418  KEDTTFVKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDI 477

Query: 393  PGVVPHGAHPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPV 452
            PG+VPHG+HP +    GPD+GN+ +PP F +D+Q+   SI +G W  R +  L+ ++ PV
Sbjct: 478  PGIVPHGSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPV 537

Query: 453  VSRTAKPIKKLPPGSRRVYTLFRMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRP 512
            +S+  KP+ KL PG  RV+++F  ++ +++D++ R+PTRE SKD++FL+ Y +T +++R 
Sbjct: 538  ISKDQKPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRA 597

Query: 513  FGWMDLRFCKDTYANFNISVCPTVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGD 572
            FGW+DL F K +    NI + PT  GF+N     F E E+ +SVNH++L KS   ++  +
Sbjct: 598  FGWIDLSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAAN 657

Query: 573  IGYPLGWNSNTIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMN 632
            IGYPLGWN    WI N+ S+QL+ FLLREHITL++D + DFS  +PTPYELFR F Y +N
Sbjct: 658  IGYPLGWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLN 717

Query: 633  WEMDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEIS 692
             ++ GYS Y NVND NI+NNPLDFNENCYLS HGD  T +IT+P  S+   Y  +SYEI 
Sbjct: 718  LKIGGYSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIF 777

Query: 693  TPMFRMMLNTPPWNTLNEFMKHKEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNST 752
            TPMFR+ LNTP WNTL+EFM++KE+GRS+DF + G YL+YSELDIDNVDSLTI+  SNST
Sbjct: 778  TPMFRLFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNST 837

Query: 753  VLHCYGFVMRYLINVKMNYFGEFFNFVTSEEYTGVLGAREVGEVVTKSSVVDLASTLDSE 812
            VL+C+GFV++Y++N + NYFG F  F+T+EEY+ ++    V + +   +  DL S ++  
Sbjct: 838  VLYCFGFVIKYMMNFQANYFGSFIKFITTEEYSELI-RNNVNDNLGSINTNDLTS-IEGL 895

Query: 813  YQNGSMKNDAED--NGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHF 870
             +  S+ ND ED     +KRSDL RT NETDIW  F V +GALILPE +Y+ D C++L F
Sbjct: 896  QKMDSITNDVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSF 955

Query: 871  TELVVDFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIH 930
             EL ++ R+CNYYMD+   L   ++ R      +E+F++I+  N +   E G +SD+TIH
Sbjct: 956  GELFINMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRSSSVE-GNISDITIH 1014

Query: 931  GHRMYGLPPTEPTYFCQWDINLGELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTE 990
            GHRMYGLPP E TYFCQW IN+G   I+SD+ FL  F  S  K+GF  ++ EN LLY+++
Sbjct: 1015 GHRMYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESD 1074

Query: 991  TINDMTSLTVHAERINISLNDPVMKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTV 1050
            T+NDMT L+V  E + + L+DP++++++ +   S++   IDFENE+Y++R+D+   +   
Sbjct: 1075 TVNDMTLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYF 1134

Query: 1051 SLSCVMGDGTNTSFLNFETKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLF 1110
            SL  +  D    + L+  TKL  TNF +  +       QR++I ++DSPYHRC FLLP  
Sbjct: 1135 SLDSLKIDSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEK 1194

Query: 1111 YQDSDTYQKLYGXXXXXXXXXXXXXXXXXXXXXYIIEDIVGEYAT-LLEATNPFKDLFAE 1169
            +Q+S +Y++LYG                     +I+E I+ +Y+  LL   +    + AE
Sbjct: 1195 FQESSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSINAE 1254

Query: 1170 TPST-VEPLRASFTXXXXXXXXXPLEFKPVAFTEEINHERDNYVIDVSYILLDIDPLLFV 1228
              S    PL+ SF             F+ +  TE+  +E DN+V++V Y+ + ++P + V
Sbjct: 1255 LNSVDTTPLKDSFDMQIT-------NFQNILTTED-PYETDNFVVNVKYLTVTVNPDI-V 1305

Query: 1229 FTKSLLEQFYSE-----DMVQVLDDIEIGIVKRLSNLQEGIVSISNIDIHVAYLNLIWQE 1283
            FT   +E+F +E      M   +D IE+ IV RLS+L+E I S  N++++V  ++  W  
Sbjct: 1306 FT---IEKFSTEFNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGH 1362

Query: 1284 TGEEGFELYLDRINYQMSEKSLEKNRTSKSLEVAVLAKVKTVRATVNQKKNPELSEDRPP 1343
                    Y++ + +++S++S   N      ++ +L K ++VR  +        S+DRPP
Sbjct: 1363 RDVCFIGTYINMLKFELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPP 1422

Query: 1344 ALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNS 1403
             LSL LEGFE WSST  +Q+ +LNLTS DIT+DE Q+ WL  Y   Q  L  ++  SV  
Sbjct: 1423 GLSLMLEGFEAWSSTTTKQLTTLNLTSFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKL 1482

Query: 1404 IQNTRSSTKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRH 1463
            I + ++S +   I+ L  A E YQI HDPYVITKPA ++RLS  H+RENRSW+I+T+LRH
Sbjct: 1483 IYDEQASYQKTFITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRH 1542

Query: 1464 ILTYLPDDWQTNIDKVLKERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFLAD 1523
            ILTYLP+DW+  +D+    ++    K+A + F++VFS WRNWE SD+ +SYIY  +F+ +
Sbjct: 1543 ILTYLPEDWEDRLDEEDLIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFVEE 1602

Query: 1524 HAKH-KGNSIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTS---LSSN 1579
             +K    NSIK  L+    +FY T+Y   Y  + NF++  AN++++      +   L   
Sbjct: 1603 VSKRILQNSIKVFLE----TFYFTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRK 1658

Query: 1580 REETIEITGKVGSVKGKFSDKLLKLQDLIPLVVAVTEDDKSD-PKAELSKQFKMNTVLLV 1638
            +EE +++  K+GS+K +F++ +LKL+  I  ++  + D KS+  K  ++K FK+N   + 
Sbjct: 1659 QEEIVDVVTKIGSIKFEFTEAILKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIF 1718

Query: 1639 DKSEIQVVMDKTKVMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILGE 1698
            D  +       + + SR     +   +EN  +S++ +GS V ++ ++ + LKH + IL +
Sbjct: 1719 DHIDFNGQFYNSSLKSRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILID 1778

Query: 1699 AQLCDFSILATTEAWSHKPTILVNNQCADLHFRAMSTTEQMVNAITEIKESVLKVKEQI- 1757
             Q+ +     T E  S   ++++N +C++LHF+++  TE  VNAI  I+  V  +  +I 
Sbjct: 1779 CQVRNLFASTTAELHSAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEIS 1838

Query: 1758 -----------KFKPK--SKNKSQFV--GSRINTVLSCYFSNVSSEIMPLSPFYIRHEAK 1802
                       +  P    KNK Q     S+ N  LS  F+NVSSEI  L P Y++HE  
Sbjct: 1839 KAQGTTDNINTEHTPSVHEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETN 1898

Query: 1803 QLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGFSKEAYSLINVDI 1862
             ++I +N    +E+L+ + DTD ++ S  TKEQY R S+  +E+          LI+++I
Sbjct: 1899 SVNISYNTINIDELLVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEI 1958

Query: 1863 SISMIKLTFSEPRRIVNSFLQDEKLASQGIXXXXXXXXXXXTTDPMNAKKETPAKMINWT 1922
            S S++KLT S+PRR++ SFLQDEK     +             +  ++  ET      W 
Sbjct: 1959 SSSILKLTTSDPRRMLFSFLQDEKELKNSLTFLRSLESLNRKANSEDS--ETLFSSYEWI 2016

Query: 1923 LDTNISYFGILVPVASTYFVFELHMXXXXXXXXXXXXXPEQTRLTGQLSIENILFLIKER 1982
            ++    Y G+L+P+ +TY+VFELH                  +  G LS ++I+FLIK++
Sbjct: 2017 VNFKSKYMGVLLPIQATYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQ 2076

Query: 1983 SLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLDMVQ 2042
            S+P   SK+LDFSIK+ST +   + ++SF++ESS FRVCL+P SL++ +WG Y+LL ++ 
Sbjct: 2077 SIPHKFSKILDFSIKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGYYQLLYLLN 2136

Query: 2043 YYSKRHAPN--IWNIRMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGDDPGLMF 2100
             Y  +   N  ++N     G ++  KE   + RS HILSY F IGWL+Q      PGL+ 
Sbjct: 2137 SYYDQSTVNFFVFNDNNIDGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLIL 2196

Query: 2101 GYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFKR 2160
            GYNRLFS YE + GK T+VD FFS++NG++  TF+S G+E  K+NRS+LPN+QI YW K 
Sbjct: 2197 GYNRLFSTYEDNHGKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKE 2256

Query: 2161 CGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAFQELKKNILDMPHESNMENSSPD 2220
              ++K  F +FHGE LDVNF  +F+++I+ST++SI  FQ LK+  +         N    
Sbjct: 2257 IEKMKHLFIKFHGETLDVNFFENFVNIIESTVRSIDLFQTLKREKI---------NPLVK 2307

Query: 2221 AAPNTENASNSL-----APFLDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPV 2275
            A P  +  SNS       P    ++ VNC F YDGG+FR+++   +  K EP+  +KSP 
Sbjct: 2308 AKPERDEKSNSALTNIKGPIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPK 2367

Query: 2276 VTINCTYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEKK 2335
            V I  +Y + E + K H I  LI ++PT N L +GC P L +F   ++++++      ++
Sbjct: 2368 VKIMLSYDYFEKELKKHWINCLIDIEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNMEE 2427

Query: 2336 PNFTKPSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNE 2395
             N        ++   LL+ FD+  KL S  Q ++L CEPKAK+  DVGF SF FS+ T  
Sbjct: 2428 -NMDNNVKDPINITSLLENFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPH 2486

Query: 2396 FDSEQPLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDV 2455
             +   PL  SL +   K S+KH FS E S SFEV  +D+ L+FTHP+V   +GT LV DV
Sbjct: 2487 LNPIDPLDISLKINDIKTSVKHQFSNEASASFEVSKLDVILIFTHPEV---FGTGLVDDV 2543

Query: 2456 SVFFNVKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNMSTLSSNSNVDVGTEIPWCFT 2515
             + FN+KQ QN+ +FLDIW  S     +  ++ +N  V+  +      +   + +PW F 
Sbjct: 2544 KLHFNLKQFQNISIFLDIWDVSKSTEKKLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFV 2603

Query: 2516 LIFTNLSGDVDLGPSLGVISLRSQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFE 2575
             I TN++GD+++G +LG ++L  QRTW++TDH+  KRQLLH FTD + ++SEGRL G  E
Sbjct: 2604 FIATNINGDINMGSTLGNLALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVE 2663

Query: 2576 VANASWVSEVKWPLENSKNTHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEK 2635
            + + +W  +V +  +      PLV    ++  V++K AFDYHMFLI T+ +++FH+ +EK
Sbjct: 2664 IDDITWKLDVNYVDKYKFVVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEK 2723

Query: 2636 DSKGILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPSE 2695
            D   ILPDLL V+ + DEI + +TALVA+NILDIYNTI+R RQDNK SY+ETL +SN + 
Sbjct: 2724 DIDDILPDLLTVNLTCDEIKVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNV 2783

Query: 2696 SKQPILYKDILRSLKLLRTDLSVNISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGK 2755
             K+  LY+DIL+SL LL+T LS NI  L +QISP SL+D EV+++R+  V   +ET +G+
Sbjct: 2784 LKRKPLYEDILKSLNLLQTSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGE 2843

Query: 2756 KLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMT 2815
            K+KTDL+++V + + +L++  +EL EE  A ++ + Y+ YAS +  G I +IP+L ++MT
Sbjct: 2844 KIKTDLEMRVYNATLSLTSFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMT 2903

Query: 2816 TLQEEKTNNLEYLFACSFSDKISVRWNLGPINFIKEMWTTHVKALAVRRSQ---TANISF 2872
            T Q      L+Y ++CSF  K+ V WNLGPINFIKE+W THV++L VR  Q     +IS 
Sbjct: 2904 TFQNADNMILQYTYSCSFDGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFMGNHDISL 2963

Query: 2873 ---GQTXXXXXXXXXXXXNASKFNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPK 2929
               G T              S   YIALEEP IE+PQI+DL +ATPP+EWFG+NRK  P 
Sbjct: 2964 ENEGDTDESVKV-------LSNIEYIALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPS 3016

Query: 2930 FTHQTAVIPVQKLVYLAEKQYVKIL 2954
             THQ+ ++P+QKLV +A+K+Y K+L
Sbjct: 3017 ATHQSVIVPIQKLVNVAQKEYAKVL 3041

 Score =  127 bits (320), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 84/119 (70%)

Query: 5   SQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRAKIKI 64
           ++   V L+ ++ FSWVFLV WIL V+A  T +FY+ +++ + ++F  EWLLWK   IK+
Sbjct: 6   TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65

Query: 65  NVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNSSGK 123
            +E++R+S L G I+FK++ +I +D TISILE S+TW+YWLLN RK+E   N K  + K
Sbjct: 66  TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTSK 124

>SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2997

 Score = 2222 bits (5758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1220/3044 (40%), Positives = 1804/3044 (59%), Gaps = 136/3044 (4%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60
            M+A SQ + +P++ + +FSWVFLVDW+L V+  L+ +FY GR  AY ++ +++W+LW+R 
Sbjct: 1    MDAGSQFKAIPISKENNFSWVFLVDWVLVVVLSLSVVFYFGRALAYCITILMKWVLWRRY 60

Query: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNS 120
            K+KIN+++L+IS LGGR++FK+L+VI KD TIS L+GS TW+YWLLN RK  L E EK+ 
Sbjct: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRKTLLEELEKSG 120

Query: 121  SGKNIE---LPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYL--NEHSFPE 175
              K+ +   L C+F LE +G E FIYNRT+AYD ++  ++KD+++ F+K+    E S   
Sbjct: 121  EEKDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAKDDKESFKKFFEGGEDSL-- 178

Query: 176  PFSDGSSADKLDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELKLNRGSL 235
                 SS +KL ED + ++ ++ S+    NDR++QE +       L F PI LK+NRG++
Sbjct: 179  ----HSSEEKL-EDETLASDSSVSNVDSTNDRNFQEQD--SRSMLLQFLPIHLKVNRGAV 231

Query: 236  LLGNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIG 295
            LLGN  TPSVMI+ YE+ EG++DV    E+LDLY+ +  L+  N ++ IK NI + D   
Sbjct: 232  LLGNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENP 291

Query: 296  LKFKLDTGKVSKLWKTFVRVL--RVVTKPVIPRRGKKAGPSDDAFFQKWKGLSLYKA--- 350
            +K  +   ++S++WK F ++   R+          K        FF+KW+GL+LY     
Sbjct: 292  IKSYIVHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLALYSEYNV 351

Query: 351  -----SAGDAKTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIP 405
                 S GD +  + +++  D  +HEYAK+T ILK  KV ++Y  D+PG+VPHGA  T+ 
Sbjct: 352  TTSDHSVGDEEEEEDENMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTME 411

Query: 406  DIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPP 465
              DGPDVGN+GAPP+F+LD +++G +ICYGPWA RQ+ +LQR+L P+VSR A P+KKL P
Sbjct: 412  QRDGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTP 471

Query: 466  GSRRVYTLFRMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTY 525
            GSRR+YT F +++L+MED  WRIPTRESSKD +FL+ Y+++  + RPFGW+D++  K+T 
Sbjct: 472  GSRRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETD 531

Query: 526  ANFNISVCPTVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIW 585
                + +CPT+ GF+N    H V+ EIRSSVNHDI  K+    +  D+GYPLGWNS   W
Sbjct: 532  LFMTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQW 591

Query: 586  IINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVN 645
            +    S+Q+  F LR+HI L++D   DF +G PTPYELFRPFVY+  W +D YSIYLNVN
Sbjct: 592  VFQFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVN 651

Query: 646  DHNIVNNPLDFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPW 705
            D NI+NNPLDFNENCYLSLHGD L ID +V  ++I G  T ++Y I TP F + L+TP W
Sbjct: 652  DANIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSW 711

Query: 706  NTLNEFMKHKEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLI 765
            +TL+EFMK+KEVGRSYDF + G Y  +S++D+ N+D++ I C S  T L C GFV+RYL+
Sbjct: 712  STLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLM 771

Query: 766  NVKMNYFGEFFNFVTSEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGS-MKNDAE- 823
            N+ MNYFG+F +F T+EEYT  L  +E  E      + D  S   S+  + S + ND E 
Sbjct: 772  NINMNYFGDFIHFKTTEEYTREL--QEKLETREAEVIADNVSDESSQMSSTSFVTNDKET 829

Query: 824  ---------DNGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELV 874
                     ++  +KR+DLKR  NE D+WFTF V +G L+ PE IY    CI LHF  L 
Sbjct: 830  TEYDLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLD 889

Query: 875  VDFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRM 934
            VD R  NYYMD+ A L+ T IKRH       +FD +R   G  +   G LS+L IH HRM
Sbjct: 890  VDLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGFLSELNIHAHRM 949

Query: 935  YGLPPTEPTYFCQWDINLGELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETIND 994
            +GLP  E TYFC+WD  +G L+I+SDI+F KG   +F K+GFGY D EN+L+Y+     D
Sbjct: 950  FGLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPID 1009

Query: 995  MTSLTVHAERINISLNDPVMKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSC 1054
            MTSLT+  + I+  + D        + ++ +  ++IDFENERYS ++  K+P + + +S 
Sbjct: 1010 MTSLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLVS- 1068

Query: 1055 VMGDGTNTSFLNFETKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDS 1114
                  N     FET L    FGQ +D D  R+ QR +I ++DSPYHRC FLLP+ YQ +
Sbjct: 1069 -EKSSKNEVQGLFETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQYQKT 1127

Query: 1115 DTYQKLYGXXXXXXXXXXXXXXXXXXXXXYIIEDIVGEYATLLEATNPFKDLFAETPSTV 1174
              Y KL+G                      I E ++G++    E  +   +   ET  T 
Sbjct: 1128 VLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSD-ANYSKETAITE 1186

Query: 1175 EP---LRASFTXXXXXXXXXPLEFKPVAFTEEINHERDNYVIDVSYILLDIDPLLFVFTK 1231
            E    ++ S +           +  P ++  E   E D+++I++   ++ I+P       
Sbjct: 1187 ENSSFIQGSGSTSALKELSSYSQNCP-SYKLEPKFEYDSFIINLGKTIIAINPSSEKCLL 1245

Query: 1232 SLLEQFYSEDMVQVLDDIEIGIVKRLSNLQEGIVSISNIDI----------------HVA 1275
            S+  QF    +  ++D  EI IV++ S       +++N+ +                 V+
Sbjct: 1246 SIYLQFCVGSIDDIIDANEIDIVEKFSKYFVEKSAVTNLRVLAPKICFTFGSPKGKFEVS 1305

Query: 1276 YLNLIWQETGEEGFELYLDRINYQMSEKSLEKNRTSKSLEVAVLAKVKTVRATVNQKK-N 1334
              + ++ E      +L   +I  Q +   LE        EV    K  ++   +NQ++  
Sbjct: 1306 DYDHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTE-----EVTSSLKASSINFFINQQQLK 1360

Query: 1335 PELSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLI 1394
            P+      P  S+  E  E WS + +   NSLN  + D  ++ SQ+EWL +Y        
Sbjct: 1361 PKTLLKARPVFSIVFEELEFWSDSSESSKNSLNARAVDFFVNHSQLEWLSDYLRAVILCA 1420

Query: 1395 QEVFTSVNSIQNTRSSTKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRS 1454
             ++F S +  +    + + ELI +   AS  Y I HD  VITKPA+I RLSK H+RENRS
Sbjct: 1421 TKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVITKPAYITRLSKNHIRENRS 1480

Query: 1455 WKIITRLRHILTYLPDDWQTNIDKVLKERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSY 1514
            W+IITRLRHIL YLP  W    ++ LK+ ++    DA++ F+ +FS WR+WEFSDV + Y
Sbjct: 1481 WRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWRSWEFSDVQKCY 1540

Query: 1515 IYGKLFLADHAKHKGNSIKKLLKCTMGSFYLTVYGEGYEVEHNFVVAD-----ANLVVDL 1569
            IY ++FL+   K K        K  +     ++    +E E   VV +     +N +++ 
Sbjct: 1541 IYKRVFLSRSMK-KNRITGADFKVNLERISFSLSSSTHEDEDFMVVKNLKSVISNELIES 1599

Query: 1570 TPPVTSLSSNREETIE---ITGKVGSVKGKFSDKLLKLQDLIPLVVAVTEDD------KS 1620
            + P ++ ++    + E   I+  + S++G   D ++KL  +   +  +++ +      K 
Sbjct: 1600 SLPPSAKNTEDSASTEKMIISCNIKSIRGDLGDNIVKLVRMYDGLSNLSDTNLKTTSVKH 1659

Query: 1621 DPKAELSKQFKMNTVLLVDKSEIQVVMDKTKVMSRTVGGRVSLLWENLKDSTSQAGSLVI 1680
            D K +L     +  VLLVD+++  + +D  +++ R+   R S   E +   +    SL  
Sbjct: 1660 DVKPKL-----IQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSETKVSLAA 1714

Query: 1681 FSQKSEVWLKHGSTILGEAQLCDFSILATTEAWSHKPTILVNNQCADLHFRAMSTTEQMV 1740
                SE W++HGS +L E+ L D ++  +   +       V  +   L   AM++TEQ +
Sbjct: 1715 TCASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRSGGLSVSAMASTEQYI 1774

Query: 1741 NAITEIKESVLKVKEQIKFKPKSKNKSQF------VGSRINTV-LSCYFSNVSSEIMPLS 1793
            + I  IK SV  +++++      KN +          SR+NTV L    S  S  I PL+
Sbjct: 1775 HFIWSIKASVDGIRKELASAIPKKNNTTISTTKPETSSRLNTVTLDATLSGFSLNIQPLT 1834

Query: 1794 PFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGFSKE 1853
            PF I      ++++  K       ++I D D  + S ++K++YL+FS   + +    + E
Sbjct: 1835 PFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQSTVNLVISNTPE 1894

Query: 1854 AYSL-INVDISISMIKLTFSEPRRIVNSFLQDEKLASQGIXXXXXXXXXXXTTDPMNAKK 1912
              ++ +NV ++  + KLT S+PR  + S ++DE LA +             + +   +K+
Sbjct: 1895 QNAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAEKFPSKNQEKSKQ 1954

Query: 1913 ETPAKMINWTLDTNISYFGILVPVASTYFVFELH-MXXXXXXXXXXXXXPEQT--RLTGQ 1969
                 +I W L  N+ Y GI+V + S  +V EL+ +              EQ    + G 
Sbjct: 1955 RKQTNII-WLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLEQGLHGIVGD 2013

Query: 1970 LSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHFRVCLSPDSLLR 2029
             SIEN+L LI    L   LSKL+D ++ +   Q   D  Q+ Q+ESSHFRV L P SL +
Sbjct: 2014 FSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVALCPMSLTK 2073

Query: 2030 LIWGAYKLLDMVQYYSKRHAPNIWNIRMFTGKSDKP---KEIPINFRSIHILSYKFCIGW 2086
            ++W   +   + + Y  R +       +   K   P    E+   FRSI ILSY FCIGW
Sbjct: 2074 VLWAINEFTRVSEAYKTRSS-------LLQHKKTAPTDISELSNKFRSIQILSYNFCIGW 2126

Query: 2087 LFQYGAGDDPGLMFGYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNR 2146
            +F  G+  DPGL++GY RLF+AY+K +GK T++DA+FS+++G +S TFFS G EK+++NR
Sbjct: 2127 IFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFFSNGKEKDQFNR 2186

Query: 2147 SFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAFQELKKNIL 2206
            S+LP+MQI YWF + G+  + F R  GE LDVNFL S + + +  ++SI+ FQELKK ++
Sbjct: 2187 SYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTFQELKKTMV 2246

Query: 2207 DMPHESNMENSSP---DAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTYDDIEA 2263
            D P  +N     P   +AAP        L P L  IR+ NC  KY GGVF++++ +DI+ 
Sbjct: 2247 D-PFATNKTTEKPVNSEAAP--------LDPILSKIRAFNCIVKYAGGVFKLFSEEDIQN 2297

Query: 2264 KSEPSFELKSPVVTINCTYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLMEFSESLQ 2323
             S+PSFE++SP V +   YKH     K H IR L+TVDP++NTL+  C P+L   ++ ++
Sbjct: 2298 NSKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMTKDVR 2357

Query: 2324 NMIKKHSTGEKKPNFTKPSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVG 2383
            NM+K  ++  K    +  S+  ++YK+LL  FD+A  +   KQ +SLSCEPKAKVQADVG
Sbjct: 2358 NMLKSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQADVG 2417

Query: 2384 FESFLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDV 2443
            FE     M TN  D+ +PL  S+ +E  +A+ +HIFSREVSTSF++  +D   + THP++
Sbjct: 2418 FEKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLTHPEI 2477

Query: 2444 ISMYGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNMSTLSSNSN 2503
            I  YGT+LVSDV ++FN+KQLQ+L LFLDIW+  S +     + P        +LSS+  
Sbjct: 2478 IQTYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQI----LEMPKGGNTRTRSLSSHDK 2533

Query: 2504 VDV-------GTE-IPWCFTLIFTNLSGDVDLGPSLGVISLRSQRTWLATDHYDEKRQLL 2555
            + V       GT   PW +TLIF+N+ GD+DLGPSLGV+S+R+ R+W  +DH+ + RQ L
Sbjct: 2534 LPVSKFQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRL 2593

Query: 2556 HAFTDGISLTSEGRLSGLFEVANASWVSEVKWPLENSKNTHPLVSTSLNIDDVAVKAAFD 2615
              F + I L+S+GRL G   +    W SE+ WP++      PL+S SL +  +A+K +FD
Sbjct: 2594 SVFLENILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSFD 2653

Query: 2616 YHMFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVR 2675
            YHMFLI  + ++   L+NE+D  GIL DLL VS +  +I L  TAL +AN +DIYNTI+R
Sbjct: 2654 YHMFLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTIIR 2713

Query: 2676 MRQDNKISYMETLRDSNPSESKQPILYKDILRSLKLLRTDLSVNISSLKVQISPISLFDV 2735
            MRQDNK SY+ETL+DSN   +K     +++L SL LLRTDLSV I    +Q+ P +LFD+
Sbjct: 2714 MRQDNKNSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDM 2773

Query: 2736 EVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYMHY 2795
            EVLV++ + +S  ++T    K+KT L  Q+ +   +LS  K + +EEI + I + +Y+ +
Sbjct: 2774 EVLVLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKH 2833

Query: 2796 ASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPINFIKEMWTT 2855
            A+K+ GGTI+  P + V MTT QE  +N +E L+  SF  K+ V+WNLGPINFI+EMW T
Sbjct: 2834 ATKVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWAT 2893

Query: 2856 HVKALAVRR---SQTANISFGQTXXXXXXXXXXXXNASKFNYIALEEPQIEVPQIRDLGE 2912
            HV+ALA+RR    +  N SF +               +K+ YI LEEP+IE+PQI+DLG+
Sbjct: 2894 HVRALALRRVHDMRDKNKSFFEDEHIEEKIKDVDL-GNKYVYIPLEEPRIEMPQIKDLGD 2952

Query: 2913 ATPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQYVKILDD 2956
            ATPP+EWFGVNR+R P  THQ+ V+P+QKL ++AE++Y ++L +
Sbjct: 2953 ATPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVLGN 2996

>KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2966

 Score = 1932 bits (5004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1079/3023 (35%), Positives = 1677/3023 (55%), Gaps = 133/3023 (4%)

Query: 4    VSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRAKIK 63
             SQ + V L+  +DFSWVFLVDW+L +   L   FY GR++ Y ++F+LEWL WKR K+K
Sbjct: 2    ASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVK 61

Query: 64   INVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNSSGK 123
            I++++L+IS LGGRI+FK+L+V+ ++ T S L+GS+TW+YWLLN RK    +  +N    
Sbjct: 62   ISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENIDKS 121

Query: 124  NIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDGSSA 183
              +LPC+F +EC+GLE+FIYN+T A+DN++N L +++ ++F+ +  ++S  +  +D  S 
Sbjct: 122  VEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNS--DKNTDECSV 179

Query: 184  DK----LDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELKLNRGSLLLGN 239
            D+        L  S  + +S S  +NDR +Q  +    P  L   P+E  + +G++++GN
Sbjct: 180  DEDSAGQRSHLETSTSSPSSKSKSLNDRSFQSPD--STPPFLKLLPLEYSVQKGAVVIGN 237

Query: 240  KFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLKFK 299
            K + SVM+LSYE  +G++D   P  ++DLY+ K   E + F IS+K N+  +    LK  
Sbjct: 238  KTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESENPLKSF 297

Query: 300  LDTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAGPSDDAFFQKWKGLSLYKASAGDAKTSD 359
            +   K+SKLW    ++      P        A        ++W+GL LY      A    
Sbjct: 298  VKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNPLKRWRGLGLYWKEEDAAWD-- 355

Query: 360  LDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPP 419
             D  +FD + HEYA++T ++KC  + L Y  D PG+VPHGA PT   +DGPDVGN+G PP
Sbjct: 356  -DRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDGPDVGNSGPPP 414

Query: 420  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNIL 479
            D+++D+QI G S+ YGPW+  ++  LQ++ SPVVSR ++P+++L PGS+R+YT  R++IL
Sbjct: 415  DYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYTRLRLSIL 474

Query: 480  IMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGF 539
            I+ ++ WRIPTRE+SKD EFL+ +++T +E RPFGW+++   + +   FNI++CPT  GF
Sbjct: 475  IVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAMCPTATGF 534

Query: 540  KNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQLEAFLL 599
             N   +HFV+ EIR+SVNHDILL ++   +   +GYPLGWN    W+ +  S Q + F+L
Sbjct: 535  DNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSNQCQIFIL 594

Query: 600  REHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNPLDFNEN 659
            ++HITL+ D +SDF +G+PTPYELFRPF Y  NW   GYSIYLNVND NIVNNP++FNEN
Sbjct: 595  KDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLNVNDANIVNNPVNFNEN 654

Query: 660  CYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 719
            CYLS HGD L ++  VP+E+I G  T ++YE+ TP+FR+ +NTP WNTL+EFMK KEVGR
Sbjct: 655  CYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFMKDKEVGR 714

Query: 720  SYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFGEFFNFV 779
            S +F++ G YL +S+LD+DN+D++ I C S ST L CYG+V+RY + VKMNYFG+F +F 
Sbjct: 715  SANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYFGDFVHFK 774

Query: 780  TSEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGSMKND-AEDNGPMKRSDLKRTTN 838
            T+EEY   L         T  S  ++        ++ S +    +D    K++ LKR  N
Sbjct: 775  TTEEYMEELRGTNAVTKTTHDSETEIQEAPKQMDEDSSQREQHIKDPLTAKKTSLKRMVN 834

Query: 839  ETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRH 898
            E D+WFTF V +G  ILPE +Y  D C AL F  L +D R  NYYMD+ A L+   I+R 
Sbjct: 835  EKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPLRIRRL 894

Query: 899  VSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPTYFCQWDINLGELNIN 958
            +     EVF+   R     E   G LS L IH HRM+GLPP E TYFC+WD +LG L+++
Sbjct: 895  IDCGCEEVFEQKGR-ALCGELVAGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLGTLDLS 953

Query: 959  SDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAERINISLNDPVMKSQS 1018
            SD+ F  GF  ++ K+GFG+ D ENI+ Y    I DMTS+T+  + I +   D +    +
Sbjct: 954  SDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAIDAI-VFCTDKIKDETA 1012

Query: 1019 I-VSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSFLNFETKLRFTNFG 1077
            I ++ + +     D EN  YS R+D+ V  LT S+  +  + +N +  +F T ++ +NF 
Sbjct: 1013 IQLNAQDISAKFADLENSLYSSRVDLDVANLTASI--IDKNKSNKAIASFMTSIKISNFC 1070

Query: 1078 QYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXX 1137
            Q +D      +Q+ +I  ND+P+HRCPFL+PL  Q+S  Y+ L+G               
Sbjct: 1071 QLQDLLAHSQQQKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIPPGVSIPSLAVPL 1130

Query: 1138 XXXXXXYIIEDIVGEYATLLEATNPFKDLF----------AETPSTVEPLRASFTXXXXX 1187
                     E++   +   L+A N  KD             +  S+++  +         
Sbjct: 1131 QT-------ENVKAVFQGYLKAENASKDFVDRWFPVNEVKNKNSSSLKDFKGQLQPILDD 1183

Query: 1188 XXXXPLEFKPVAFTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMVQVLD 1247
                   F    F      E +  V+++    L I P  +    + +EQ + + + Q +D
Sbjct: 1184 NTSLSSSFSDPTF------EHNTLVVNLENSRLSISPECYEVIGNAVEQCHKKLIEQFID 1237

Query: 1248 DIEIGIVKRLSNLQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDRINYQMSEKSLE- 1306
            +IE+ +V     +     +  NI + +  L+++++   +E       ++    ++ SL+ 
Sbjct: 1238 NIELDVVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNKENTYDVEGQVKVTANQVSLDW 1297

Query: 1307 --------KNRTSKSLEVAVLAKVKTVRATVNQK--KNPELSE-DRPPALSLGLEGFEVW 1355
                        +   +   L K++++   V  K  K  + +E D   A    ++  E W
Sbjct: 1298 SLKKGLKLPGSDNDPEDTTSLLKIESLDLEVFNKLDKKTKFAEMDENIAFGCSVKELEAW 1357

Query: 1356 SSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTEL 1415
            S       +SL L S + ++   +  WL ++     N  +++   ++         + E 
Sbjct: 1358 SYLNGIADSSLYLKSINASVALDKFNWLIDFMRKAFNDSKQLINRLSYCTGQFRKAEQEF 1417

Query: 1416 ISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTN 1475
              +++ AS+ YQI+HDP VITKPA+I RL   HVRE+RSWKI+TRLRHIL YLP    ++
Sbjct: 1418 FYRISKASDEYQITHDPPVITKPAYITRLPSQHVRESRSWKIVTRLRHILNYLPTTLISD 1477

Query: 1476 IDKVLKERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLF---LADHAKHKGNSI 1532
            I   LK  +Y     A+  F+ +FS W NW++SDV + Y+Y ++F   L D   H+ ++ 
Sbjct: 1478 IFNDLKNSEYPPRSTAEETFLEIFSNWGNWDYSDVEKCYMYRRVFTNTLDDTVAHESST- 1536

Query: 1533 KKLLKCTMGSFYLTVY-----GEGYEVEHNFVVADA-NLVVDLTPPVTSLSSNREETIE- 1585
                K   G+F L  +     G    +  N           D      S  SN E+ +E 
Sbjct: 1537 ----KIETGTFMLNFFDSINTGSDSVILKNLKAQRTLEACKDEAAEKRSNMSNAEDDLEE 1592

Query: 1586 -ITGKVGSVKGKFSD----KLLKLQDLIPLV---VAVTEDDKSDPKAELSKQFKMNTVLL 1637
             ++  +   +   SD    KLL +++L        AV E++K          F+  T  L
Sbjct: 1593 RLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAAVKENEK-------LPAFQQYTA-L 1644

Query: 1638 VDKSEIQVVMDKTKVMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILG 1697
            VD+ +IQ++    +   ++ G  ++++ EN K   + A S        E  ++H +TIL 
Sbjct: 1645 VDRCDIQLLCGANRANLKSFGNTLTIVREN-KSEDADAFSTAFAWSWFEFGIRHRNTILL 1703

Query: 1698 EAQLCDFSILATTEAWSHKPTIL-VNNQCADLHFRAMSTTEQMVNAITEIKES----VLK 1752
            +A     S       +S K +   ++ +      +  S ++     I  ++ES     L 
Sbjct: 1704 DA--FSRSSAVGAHGFSGKNSRRKLDLRAKKFRLKLPSESKHYCTFIDSLEESWNNLRLA 1761

Query: 1753 VKEQIKF--KPKSKNKSQFVGSRINTVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNK 1810
            +     F  KP S    +         L+   S+++++I  LS   I    K+L + + +
Sbjct: 1762 LGPNTGFLEKPHSAATEKVAP---QFALNIDISDLTTDISLLSSLAITKNFKKLTLAYEQ 1818

Query: 1811 FGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGFSKE-AYSLINVDISISMIKL 1869
              S+ + L+    D  + S +T +QYL+ S  +I       K+   S   V +  ++ KL
Sbjct: 1819 SASSALKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHRPKKNNASPPTVKLDSNITKL 1878

Query: 1870 TFSEPRRIVNSFLQDEKLASQGIXXXXXXXXXXXTTDPMNAKKETPAKM---INWTLDTN 1926
               +PR I     +D   A   +           T +  +   +   K     +W     
Sbjct: 1879 KLYDPRDITLPLGKDIAQAKACLASLKSCFGKLNTKNDKDIMSQGNTKFNFSASWIFQVR 1938

Query: 1927 ISYFGILVPVASTYFVFELHMXXXXXXX---XXXXXXPEQTRLTGQLSIENILFLIKERS 1983
            ++Y G+L+P+ ST ++ EL+                   Q  L G LS  +I FLI +R 
Sbjct: 1939 LNYVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGALRGDLSAASIAFLINDRM 1998

Query: 1984 LPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLDMVQY 2043
            LP  LS+++DF++ +   + + +  +S Q+ES +FR+ LSP SL+R+++   +L  + + 
Sbjct: 1999 LPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPFSLVRILFLVNELSRLSEL 2058

Query: 2044 YSKRHAPNIWNIRMFTGKSDKPKEIPIN--------FRSIHILSYKFCIGWLFQYGAGDD 2095
              ++    +            P+ + +         FRS+ +LSY FC+GW+F      +
Sbjct: 2059 QKRQTVGKL------------PESVEVRETFRFRRAFRSVQVLSYNFCLGWIFDVNDSPE 2106

Query: 2096 PGLMFGYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQIS 2155
            PGL++GY RLF+A+EK +GK T++DA+FS++ G+TS  F++  N  E  NRSFLP+MQI 
Sbjct: 2107 PGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFLPSMQIR 2166

Query: 2156 YWFKRCGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAFQELKKNILDMPHESNME 2215
            YW +  G   + F R +GE LDV FL   +DV    ++S+  F ELKK  +D P +S   
Sbjct: 2167 YWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVD-PFKSVAN 2225

Query: 2216 NSSPDAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPV 2275
               P A      ++ S  P L  I+ V+C  +Y GGVFR+Y+ DD++ ++ PSF+L+SP 
Sbjct: 2226 PKRPSAT-----STFSKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQLESPS 2280

Query: 2276 VTINCTYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEKK 2335
            V I   Y+        H +R  + V  +HNT++  C P+L E +  ++ ++K  +   ++
Sbjct: 2281 VEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLKGFNRSPQE 2340

Query: 2336 PNFTKPSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNE 2395
             +    S +++DY+  L   D++  +   KQQ+S SCEPKAKVQAD+GFE     + TN+
Sbjct: 2341 ASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFTND 2400

Query: 2396 FDSEQPLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDV 2455
             D  +PL  S+ + +  A  +HIFSREVSTS ++  +    + THPD I  YG   + ++
Sbjct: 2401 LDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIPNI 2460

Query: 2456 SVFFNVKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNMST----LSSNSNVDVGTEIP 2511
             V+FN+KQLQ+L +F++IW+  S + T+P     +     S     ++    V   T  P
Sbjct: 2461 DVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSEEKPLVAKFKKVSSTTSFP 2520

Query: 2512 WCFTLIFTNLSGDVDLGPSLGVISLRSQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLS 2571
            W F LI + + GD+DLG SLGV+SL + R W  TDHY +  Q L    + I L+S+GRL 
Sbjct: 2521 WNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDGRLG 2580

Query: 2572 GLFEVANASWVSEVKWPLENSKNTHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHL 2631
            G   + N SW+S ++WP+       PLV+  + +D+  +K +FDYH+ LI ++  ++  L
Sbjct: 2581 GTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLKLKL 2640

Query: 2632 HNEKDSKGILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDS 2691
             N++D +GI  +LL V+ SS+   L  TAL  ANILD+YNTI+RMR+DN+ SY ETL DS
Sbjct: 2641 FNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKSYFETLGDS 2700

Query: 2692 NPSESKQPILYKDILRSLKLLRTDLSVNISSLKVQISPISLFDVEVLVVRIDKVSIRSET 2751
            N  +++     KDIL SL  LRT+L V++  + +QI P  LFD+EVL  +      +S+ 
Sbjct: 2701 NTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQSQI 2760

Query: 2752 HSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYMHYASKIVGGTIIDIPKLA 2811
               +KLKT L+ Q+  V  ALS  K +L E+  + I + +Y+ +A K  GGTI+ IP + 
Sbjct: 2761 EGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGTILVIPAIL 2820

Query: 2812 VHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPINFIKEMWTTHVKALAVRRSQTANIS 2871
            + MTT  +  TN +E L++ SF  KI +RWNLG INF++EMW THV+A+A+RRS      
Sbjct: 2821 IGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALRRSHNGQPR 2880

Query: 2872 FGQTXXXXXXXXXXXXNASKFNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPKFT 2931
                               ++ Y+ LEEP IE+PQ +DLGEATPP+EWFGVNRK+ P  T
Sbjct: 2881 GFFEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLT 2940

Query: 2932 HQTAVIPVQKLVYLAEKQYVKIL 2954
            HQ  ++P+QKL ++AE ++ +IL
Sbjct: 2941 HQAMIVPLQKLAHIAETEWARIL 2963

>Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp, 2941
            aa] {ON} ANNOTATED BY YGOB -
          Length = 2941

 Score = 1910 bits (4947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1093/3008 (36%), Positives = 1671/3008 (55%), Gaps = 130/3008 (4%)

Query: 5    SQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRAKIKI 64
            S+ R VP++  +DFSWVFL DW+L +   L + FY GR+  Y ++ ILE+L WKR  +K+
Sbjct: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

Query: 65   NVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNSSGKN 124
                       GR++FK+L+VI +D T SIL GS+TW+YWLL+ RK  L    ++ S K 
Sbjct: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSL----ESQSEKA 107

Query: 125  IELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEPFS------ 178
             +LPC+F +EC+GLE+FIYNRT A+DN+++ L +++++  +K+ ++   P P +      
Sbjct: 108  AKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSD---PSPRATEETST 164

Query: 179  -DGSSADKLDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELKLNRGSLLL 237
             + S+A K   + S S+ + +++S  +NDR YQ  N    P  L   P+E  + +G+L++
Sbjct: 165  ENDSAAQKSHLETSMSSPSASTES--LNDRTYQLPN--SMPSFLRLLPLEYSVQKGALII 220

Query: 238  GNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLK 297
            GNK T SVM+ S+E  +G +D   P  ++DLY+ K   ++  F++S++ N+ YD+   LK
Sbjct: 221  GNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLK 280

Query: 298  FKLDTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAGPSDDAF--FQKWKGLSLYKASAGDA 355
                  ++ KL   +      V K  + R  K      D     ++W+GL LY      A
Sbjct: 281  NLPKANRLPKLLHKYYETFLRVRKRYLSRGSKTESTRKDLRNPLERWRGLGLYWKENDPA 340

Query: 356  KTSDLDDI-EFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVGN 414
                 DD+  F+   HEYA+++ ++KC  + + Y  D PGVVPHGA PT+  +DGPDVGN
Sbjct: 341  ----WDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGN 396

Query: 415  NGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLF 474
             GAPPDF+LD+Q+ G +I YGPWA  ++  +Q+V SPVVSR + P ++L  GS RV+T  
Sbjct: 397  GGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRL 456

Query: 475  RMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVCP 534
            R++I+IM D+ WRIPTRE SKD +FL+ YK+T ++ RPFGW++L   + +    NI++CP
Sbjct: 457  RISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCP 516

Query: 535  TVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQL 594
            T  GF N   +HF++ EIR+SVNHDILL ++  D++  IGYPLGWN+   W  ++KS Q 
Sbjct: 517  TSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQA 576

Query: 595  EAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNPL 654
              F+L++HITL+ D LSDF  GDPTPY+LFRPF+Y+ NWE+ GYS+YLNVND NIVNNP+
Sbjct: 577  RMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPV 636

Query: 655  DFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKH 714
            DFNENCYLS HGD L I   VP++SI G  T + Y + TP+FR+ +NTP WNTL+EFMK 
Sbjct: 637  DFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKD 696

Query: 715  KEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFGE 774
            KEVGR+ DF++ G YL +S+LD++N+D++ I C S  T L CYG+V+R+L+ VKMNYFG+
Sbjct: 697  KEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGD 756

Query: 775  FFNFVTSEEYTGVLGAREVGEVVTKSSVVDLASTL---DSEYQNGSMKNDAEDNGPMKRS 831
            F +F T+EEY   L    V          +   T    + E +  + KN   D    K+ 
Sbjct: 757  FVHFKTTEEYMEELRDAYVEPKANSEQSANSTETTTAGEGEDKQNAPKNHTTDPVMAKKL 816

Query: 832  DLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYMDIMAVLN 891
             LKR  NE D+WFTF V +G LILP+ +Y  + C A  F  L +D R  NYYMD+ A L+
Sbjct: 817  SLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALS 876

Query: 892  GTSIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPTYFCQWDIN 951
               ++         +F              G +SDL IH HRM+GLPP E TYFC+WD +
Sbjct: 877  PVIVRNLSDCDPAHLFSG-SEGRCPSRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFS 935

Query: 952  LGELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAERINISLND 1011
            +G L+I+SD+  +  F  ++ K+ F + D ENI+ Y    I DMTS+  HA  I + +ND
Sbjct: 936  MGVLDISSDLSCILSFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRVKIND 995

Query: 1012 PVMKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSFLNFETKL 1071
              +    IV VE++    +DFENERYS R D+ +  +TV +     DG+     +F + L
Sbjct: 996  VAVDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQVKEGGKDGSLIG--DFSSSL 1053

Query: 1072 RFTNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGXXXXXXXXX 1131
            + T F Q K+      +Q+ +I  ND+P+HRC FLLPL  Q SD Y+KL G         
Sbjct: 1054 KITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIP 1113

Query: 1132 XXXXXXXXXXXXYIIEDIV-GEYATLLEATNPFKDLFAETPSTVEPLRASFTXXXXXXXX 1190
                         I+++ + GE  +L      F        S  E    +F         
Sbjct: 1114 GMVEPITPENVTMILDEFLKGEKNSLQMGNEHF-------CSKKEEDGYAFNFASGL--- 1163

Query: 1191 XPLEFKPVAFTE-EINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMVQVLDDI 1249
                   ++ TE + N E ++ V+ +      I        +S  +Q YS  + Q++D  
Sbjct: 1164 -------MSSTENDSNVESESLVVKLIKPQASISACCIKPFRSFSDQAYSNFVEQLIDSN 1216

Query: 1250 EIGIVKRLSNLQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDRINYQMSEKSLE--- 1306
            EI +V              N+ +      +     G +      D ++  + E S++   
Sbjct: 1217 EIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDISM 1276

Query: 1307 -----KNRTSKSL--EVAVLAKVKTVRATV-NQKKNPELSEDRPPAL-SLGLEGFEVWSS 1357
                  N + KS   ++  L KV+++   V N  +N  L       L S  ++  E W +
Sbjct: 1277 REEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQLCSTSIKDLEFWMT 1336

Query: 1358 TEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTR-SSTKTELI 1416
            +ED + +S N TS D  +   + E    +  +    I  + T V S+   R    + +  
Sbjct: 1337 SEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTI-TEVVSVHKERLQKAQRDFF 1395

Query: 1417 SKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTNI 1476
             +++ AS+ YQI HDP VITKPA+I RL   HVREN+SWKIITRLRHIL YLP      I
Sbjct: 1396 YRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAEI 1455

Query: 1477 DKVLKERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKLL 1536
               LK   +    +A  IF+++FS WR+WE SDV + Y+Y K F   +++++G +    L
Sbjct: 1456 YGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAF---YSQYEGQAGPLNL 1512

Query: 1537 KCTMGSFYLTVY------GEGYEVEHNFVVADANLVVDLTPPVTSLS-SNREETIEITGK 1589
            +  + S   TV       G+   V+   ++    L  ++   + ++      +   ++  
Sbjct: 1513 RVEVDSCSATVSDSTHKEGDMIAVKGLKLLKKFILKSEMVGSILAIDDGTATDGNSLSCS 1572

Query: 1590 VGSVKGKFSDKLLKLQDLIPLVVAVTEDD-----KSDPKAELSKQFKMNTVLLVDKSEIQ 1644
            + +VK   S+  +KL     L  +    D     +  P  ++ K   M   LL+D+ EI+
Sbjct: 1573 LKAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKL--MELALLIDRCEIK 1630

Query: 1645 VVMDKTKVMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDF 1704
            + +D      ++ G  +S    + + +     S+ +     E  ++H + I+ +A     
Sbjct: 1631 ISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNAIIVDA-FARR 1689

Query: 1705 SILATTEAWSHKPTI-LVNNQCADLHFRAMSTTEQMVNAITEIKESVLKVKEQIKFKPKS 1763
              L +  + S   T+  V+     L  +  S+T+   N I  + ES   +  ++KF  +S
Sbjct: 1690 GSLGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWSSLAPKLKFNTRS 1749

Query: 1764 KNKSQFVGSRINTVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDT 1823
            K+ S  + +        +  + +SEI  LSP  I    K L + F K  ++ + L + + 
Sbjct: 1750 KDLSPEMKNFSKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVENF 1809

Query: 1824 DFFMTSHQTKEQYLRFSFGDIEIKGGFSKEAYSLIN-VDISISMIKLTFSEPRRIVNSFL 1882
            D  + S  T +QYL+ S   +E+      +   + + + +  ++ K    +PR I+ +  
Sbjct: 1810 DLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLT 1869

Query: 1883 QDEKLASQGIXXXXXXXXXX-------XTTDPMNAKKETPAKMINWTLDTNISYFGILVP 1935
            QD   A Q +                  T + + A    P + + W LD  + Y G+LVP
Sbjct: 1870 QDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWL-WQLD--MKYVGLLVP 1926

Query: 1936 VASTYFVFELHMXXXXXXXXXXXXXPEQTRLTGQLSIENILFLIKERSLPIGLSKLLDFS 1995
            + +T ++ E++                   + G+LS+  I FLI ++ LP  LSK+L+F+
Sbjct: 1927 LGTTSYISEINELSSSLSCDEAAEF-SFPLVHGELSVAGISFLINDKELPEDLSKVLEFA 1985

Query: 1996 IKVSTLQRTADTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLDMVQYYSKRHAPNIWNI 2055
             ++   +   ++ +S Q+ES+HFR+ L P SL+R++  AY+   +    + +    +   
Sbjct: 1986 FRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEATHLSGLQALKDNAGV--- 2042

Query: 2056 RMFTGKSDKPKE---IPINFRSIHILSYKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKD 2112
                  SD  K+   I   F SI ILSY FC+GW+F      + GL +GY RLF+A+EK 
Sbjct: 2043 ----KSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKP 2098

Query: 2113 FGKFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFKRCGELKDWFFRFH 2172
            +GK T++DA+F ++ G+TS+ F+ + +E ++ NRS LP+MQI YWF+  G   + F R +
Sbjct: 2099 YGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRIN 2158

Query: 2173 GEALDVNFLPSFMDVIDSTLQSIRAFQELKKNILDMPHESNMENSSPDAAPNTENASNSL 2232
            GE LDV+FL   + +     +S+  FQELK+  LD           P        ++ S 
Sbjct: 2159 GERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPFKPEEPVKRVP------AGSAFSK 2212

Query: 2233 APFLDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTINCTYKHDESKAKPH 2292
             P L +I  VNC  +Y GGVF++Y+ DDI+ K+ PSF+L+SP V +   Y    +  + H
Sbjct: 2213 LPILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKH 2272

Query: 2293 RIRTLITVDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEKKPNFTKPSTQNVDYKRLL 2352
             +R L++VD +HNTL+  C P++ E +  ++ ++K  +    +   T    + ++Y+ LL
Sbjct: 2273 LLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVETPRTSNMQEGINYRSLL 2332

Query: 2353 DQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTK 2412
               D++  +   KQQ+SLSCEPKAKVQADVGFE F   + TN+FD  +PL  SL +    
Sbjct: 2333 QDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNIT 2392

Query: 2413 ASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLD 2472
            A+ +HIFSREVSTS  +  +    + THPD I  YG + +  + V+FN+KQLQ+L +F++
Sbjct: 2393 ATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFIN 2452

Query: 2473 IWRFSSILHTRP------TQRPNNKEVNMSTLSSNSNVDVGTEIPWCFTLIFTNLSGDVD 2526
            IW+  S + ++P         P N E  ++  S    V   +  PW F +I + + G++D
Sbjct: 2453 IWKLDSKILSQPELDNKFVIGPTNLEKPLT--SKYKKVISNSSFPWNFVVILSRIRGEID 2510

Query: 2527 LGPSLGVISLRSQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWVSEVK 2586
            LG SLGV+SL +++ W  TDHY +  Q L    D +SL+S+GRL G F + N  W+S++K
Sbjct: 2511 LGISLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIK 2570

Query: 2587 WPLENSKNTHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSKGILPDLLQ 2646
            WPL       PLV  ++ +D+ AVK  FDYH+ LI ++  +   L N++D +G++ +LL 
Sbjct: 2571 WPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLS 2630

Query: 2647 VSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPSESKQPILYKDIL 2706
            VS SSD   +  TAL  ANI D+YNTI+RMR+DN+ SY+ETL DSN  ++K      +IL
Sbjct: 2631 VSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGSSSSHEIL 2690

Query: 2707 RSLKLLRTDLSVNISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVL 2766
             SL  LRT+LSV +  + +Q+ P +LFD+EV+  +    S  S+T   KKLKT L+L+V 
Sbjct: 2691 SSLSFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVH 2750

Query: 2767 DVSAALSTSKEELDEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLE 2826
            +V  ALST K +L E + + I + +Y+ +ASK+ GGTI+  P + + MTT  +  TN +E
Sbjct: 2751 NVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVE 2810

Query: 2827 YLFACSFSDKISVRWNLGPINFIKEMWTTHVKALAVRRSQTANISFGQTXXXXXXXXXXX 2886
             L++ SF  KI VRWNLG INF++EMW TH +A+A+RRS                     
Sbjct: 2811 LLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSHNGQSKSFFEDEHLGDKLKDV 2870

Query: 2887 XNASKFNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLA 2946
                ++ YI LEEP IE+PQ +DLGEATPP+EWFGVNRK+ P  THQ  ++P+QKL +LA
Sbjct: 2871 DLGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLA 2930

Query: 2947 EKQYVKIL 2954
            E ++ +IL
Sbjct: 2931 ESEWARIL 2938

>Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR087C
            (CSF1) -  [contig 172] PARTIAL
          Length = 2763

 Score = 1754 bits (4542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1012/2802 (36%), Positives = 1540/2802 (54%), Gaps = 103/2802 (3%)

Query: 204  INDRDYQETNIGKYPKGLSFFPIELKLNRGSLLLGNKFTPSVMILSYENGEGIIDVLPPK 263
            +NDR YQ  N    P  L   P+E  + +G+L++GNK T SVM+ S+E  +G +D   P 
Sbjct: 11   LNDRTYQLPN--SMPSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPD 68

Query: 264  ERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRVVTKPV 323
             ++DLY+ K   ++  F++S++ N+ YD+   LK      ++ KL   +      V K  
Sbjct: 69   TKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRVRKRY 128

Query: 324  IPRRGKKAGPSDDAF--FQKWKGLSLYKASAGDAKTSDLDDI-EFDFTSHEYAKFTSILK 380
            + R  K      D     ++W+GL LY      A     DD+  F+   HEYA+++ ++K
Sbjct: 129  LSRGSKTESTRKDLRNPLERWRGLGLYWKENDPA----WDDVFHFELPKHEYARYSKVMK 184

Query: 381  CPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQR 440
            C  + + Y  D PGVVPHGA PT+  +DGPDVGN GAPPDF+LD+Q+ G +I YGPWA  
Sbjct: 185  CEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHH 244

Query: 441  QVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNILIMEDTTWRIPTRESSKDAEFL 500
            ++  +Q+V SPVVSR + P ++L  GS RV+T  R++I+IM D+ WRIPTRE SKD +FL
Sbjct: 245  EIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFL 304

Query: 501  QHYKKTSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGFKNDFHVHFVETEIRSSVNHDI 560
            + YK+T ++ RPFGW++L   + +    NI++CPT  GF N   +HF++ EIR+SVNHDI
Sbjct: 305  KRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDI 364

Query: 561  LLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTP 620
            LL ++  D++  IGYPLGWN+   W  ++KS Q   F+L++HITL+ D LSDF  GDPTP
Sbjct: 365  LLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTP 424

Query: 621  YELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDKLTIDITVPRESI 680
            Y+LFRPF+Y+ NWE+ GYS+YLNVND NIVNNP+DFNENCYLS HGD L I   VP++SI
Sbjct: 425  YDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSI 484

Query: 681  LGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGRSYDFTIKGCYLLYSELDIDNV 740
             G  T + Y + TP+FR+ +NTP WNTL+EFMK KEVGR+ DF++ G YL +S+LD++N+
Sbjct: 485  AGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENI 544

Query: 741  DSLTINCTSNSTVLHCYGFVMRYLINVKMNYFGEFFNFVTSEEYTGVLGAREVGEVVTKS 800
            D++ I C S  T L CYG+V+R+L+ VKMNYFG+F +F T+EEY   L    V       
Sbjct: 545  DTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKANSE 604

Query: 801  SVVDLASTL---DSEYQNGSMKNDAEDNGPMKRSDLKRTTNETDIWFTFSVWNGALILPE 857
               +   T    + E +  + KN   D    K+  LKR  NE D+WFTF V +G LILP+
Sbjct: 605  QSANSTETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPK 664

Query: 858  TIYSFDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGAD 917
             +Y  + C A  F  L +D R  NYYMD+ A L+   ++         +F          
Sbjct: 665  NLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSG-SEGRCPS 723

Query: 918  EQEHGVLSDLTIHGHRMYGLPPTEPTYFCQWDINLGELNINSDIEFLKGFFTSFYKVGFG 977
                G +SDL IH HRM+GLPP E TYFC+WD ++G L+I+SD+  +  F  ++ K+ F 
Sbjct: 724  RANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWSKLAFS 783

Query: 978  YNDLENILLYDTETINDMTSLTVHAERINISLNDPVMKSQSIVSVESLLFTLIDFENERY 1037
            + D ENI+ Y    I DMTS+  HA  I + +ND  +    IV VE++    +DFENERY
Sbjct: 784  FKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERY 843

Query: 1038 SQRIDIKVPKLTVSLSCVMGDGTNTSFLNFETKLRFTNFGQYKDSDKKRSEQRRYIMMND 1097
            S R D+ +  +TV +     DG+     +F + L+ T F Q K+      +Q+ +I  ND
Sbjct: 844  SSRADVDIHSITVQVKEGGKDGSLIG--DFSSSLKITKFCQLKNFLVHSMQQKSHIATND 901

Query: 1098 SPYHRCPFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXXXXXXYIIEDIV-GEYATL 1156
            +P+HRC FLLPL  Q SD Y+KL G                      I+++ + GE  +L
Sbjct: 902  APFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSL 961

Query: 1157 LEATNPFKDLFAETPSTVEPLRASFTXXXXXXXXXPLEFKPVAFTE-EINHERDNYVIDV 1215
                  F        S  E    +F                ++ TE + N E ++ V+ +
Sbjct: 962  QMGNEHF-------CSKKEEDGYAFNFASGL----------MSSTENDSNVESESLVVKL 1004

Query: 1216 SYILLDIDPLLFVFTKSLLEQFYSEDMVQVLDDIEIGIVKRLSNLQEGIVSISNIDIHVA 1275
                  I        +S  +Q YS  + Q++D  EI +V              N+ +   
Sbjct: 1005 IKPQASISACCIKPFRSFSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSP 1064

Query: 1276 YLNLIWQETGEEGFELYLDRINYQMSEKSLE--------KNRTSKSL--EVAVLAKVKTV 1325
               +     G +      D ++  + E S++         N + KS   ++  L KV+++
Sbjct: 1065 TFEMTLSNFGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDITALVKVESL 1124

Query: 1326 RATV-NQKKNPELSEDRPPAL-SLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWL 1383
               V N  +N  L       L S  ++  E W ++ED + +S N TS D  +   + E  
Sbjct: 1125 ALCVSNTSRNGPLENIHEDQLCSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELC 1184

Query: 1384 FEYCSDQGNLIQEVFTSVNSIQNTR-SSTKTELISKLTAASEYYQISHDPYVITKPAFIM 1442
              +  +    I  + T V S+   R    + +   +++ AS+ YQI HDP VITKPA+I 
Sbjct: 1185 CIFLKNTAANIDTI-TEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPPVITKPAYIT 1243

Query: 1443 RLSKGHVRENRSWKIITRLRHILTYLPDDWQTNIDKVLKERKYSFAKDAKNIFMSVFSTW 1502
            RL   HVREN+SWKIITRLRHIL YLP      I   LK   +    +A  IF+++FS W
Sbjct: 1244 RLPNQHVRENKSWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNIFSKW 1303

Query: 1503 RNWEFSDVARSYIYGKLFLADHAKHKGNSIKKLLKCTMGSFYLTVY------GEGYEVEH 1556
            R+WE SDV + Y+Y K F   +++++G +    L+  + S   TV       G+   V+ 
Sbjct: 1304 RSWESSDVEQCYMYRKAF---YSQYEGQAGPLNLRVEVDSCSATVSDSTHKEGDMIAVKG 1360

Query: 1557 NFVVADANLVVDLTPPVTSLSSNRE-ETIEITGKVGSVKGKFSDKLLKLQDLIPLVVAVT 1615
              ++    L  ++   + ++      +   ++  + +VK   S+  +KL     L  +  
Sbjct: 1361 LKLLKKFILKSEMVGSILAIDDGTATDGNSLSCSLKAVKASISETAIKLLAFRELFESQN 1420

Query: 1616 EDD-----KSDPKAELSKQFKMNTVLLVDKSEIQVVMDKTKVMSRTVGGRVSLLWENLKD 1670
              D     +  P  ++ K   M   LL+D+ EI++ +D      ++ G  +S    + + 
Sbjct: 1421 SQDILSNTQVLPSGKILKL--MELALLIDRCEIKISLDSKTANLKSFGNSISFALVDTES 1478

Query: 1671 STSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDFSILATTEAWSHKPTI-LVNNQCADLH 1729
            +     S+ +     E  ++H + I+ +A       L +  + S   T+  V+     L 
Sbjct: 1479 ARDTGSSMALAWSWFEFDVRHNNAIIVDA-FARRGSLGSFISQSESTTLHRVHLGSQKLR 1537

Query: 1730 FRAMSTTEQMVNAITEIKESVLKVKEQIKFKPKSKNKSQFVGSRINTVLSCYFSNVSSEI 1789
             +  S+T+   N I  + ES   +  ++KF  +SK+ S  + +        +  + +SEI
Sbjct: 1538 LKVPSSTKDYCNFINSLSESWSSLAPKLKFNTRSKDLSPEMKNFSKVAFEAHVDDFTSEI 1597

Query: 1790 MPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGG 1849
              LSP  I    K L + F K  ++ + L + + D  + S  T +QYL+ S   +E+   
Sbjct: 1598 SALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAK 1657

Query: 1850 FSKEAYSLIN-VDISISMIKLTFSEPRRIVNSFLQDEKLASQGIXXXXXXXXXX------ 1902
               +   + + + +  ++ K    +PR I+ +  QD   A Q +                
Sbjct: 1658 IHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQLKIHLLALGALFGT 1717

Query: 1903 -XTTDPMNAKKETPAKMINWTLDTNISYFGILVPVASTYFVFELHMXXXXXXXXXXXXXP 1961
              T + + A    P + + W LD  + Y G+LVP+ +T ++ E++               
Sbjct: 1718 DSTDEEVFAGALWPREWL-WQLD--MKYVGLLVPLGTTSYISEINELSSSLSCDEAAEF- 1773

Query: 1962 EQTRLTGQLSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHFRVC 2021
                + G+LS+  I FLI ++ LP  LSK+L+F+ ++   +   ++ +S Q+ES+HFR+ 
Sbjct: 1774 SFPLVHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIA 1833

Query: 2022 LSPDSLLRLIWGAYKLLDMVQYYSKRHAPNIWNIRMFTGKSDKPKE---IPINFRSIHIL 2078
            L P SL+R++  AY+   +    + +    +         SD  K+   I   F SI IL
Sbjct: 1834 LCPFSLIRILSLAYEATHLSGLQALKDNAGV-------KSSDDAKDFFNISQTFHSIQIL 1886

Query: 2079 SYKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEG 2138
            SY FC+GW+F      + GL +GY RLF+A+EK +GK T++DA+F ++ G+TS+ F+ + 
Sbjct: 1887 SYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQP 1946

Query: 2139 NEKEKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAF 2198
            +E ++ NRS LP+MQI YWF+  G   + F R +GE LDV+FL   + +     +S+  F
Sbjct: 1947 DEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLF 2006

Query: 2199 QELKKNILDMPHESNMENSSPDAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTY 2258
            QELK+  LD           P        ++ S  P L +I  VNC  +Y GGVF++Y+ 
Sbjct: 2007 QELKRQYLDPFKPEEPVKRVP------AGSAFSKLPILSSISHVNCKVRYAGGVFKLYSL 2060

Query: 2259 DDIEAKSEPSFELKSPVVTINCTYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLMEF 2318
            DDI+ K+ PSF+L+SP V +   Y    +  + H +R L++VD +HNTL+  C P++ E 
Sbjct: 2061 DDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEM 2120

Query: 2319 SESLQNMIKKHSTGEKKPNFTKPSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKV 2378
            +  ++ ++K  +    +   T    + ++Y+ LL   D++  +   KQQ+SLSCEPKAKV
Sbjct: 2121 ALDIRQLLKDLNKSSVETPRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKV 2180

Query: 2379 QADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLLF 2438
            QADVGFE F   + TN+FD  +PL  SL +    A+ +HIFSREVSTS  +  +    + 
Sbjct: 2181 QADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFML 2240

Query: 2439 THPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSILHTRP------TQRPNNKE 2492
            THPD I  YG + +  + V+FN+KQLQ+L +F++IW+  S + ++P         P N E
Sbjct: 2241 THPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVIGPTNLE 2300

Query: 2493 VNMSTLSSNSNVDVGTEIPWCFTLIFTNLSGDVDLGPSLGVISLRSQRTWLATDHYDEKR 2552
              ++  S    V   +  PW F +I + + G++DLG SLGV+SL +++ W  TDHY +  
Sbjct: 2301 KPLT--SKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWT 2358

Query: 2553 QLLHAFTDGISLTSEGRLSGLFEVANASWVSEVKWPLENSKNTHPLVSTSLNIDDVAVKA 2612
            Q L    D +SL+S+GRL G F + N  W+S++KWPL       PLV  ++ +D+ AVK 
Sbjct: 2359 QTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKL 2418

Query: 2613 AFDYHMFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSDEITLSSTALVAANILDIYNT 2672
             FDYH+ LI ++  +   L N++D +G++ +LL VS SSD   +  TAL  ANI D+YNT
Sbjct: 2419 TFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNT 2478

Query: 2673 IVRMRQDNKISYMETLRDSNPSESKQPILYKDILRSLKLLRTDLSVNISSLKVQISPISL 2732
            I+RMR+DN+ SY+ETL DSN  ++K      +IL SL  LRT+LSV +  + +Q+ P +L
Sbjct: 2479 ILRMRKDNRKSYLETLGDSNTRDTKGSSSSHEILSSLSFLRTELSVMLKFVHIQVYPSTL 2538

Query: 2733 FDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDY 2792
            FD+EV+  +    S  S+T   KKLKT L+L+V +V  ALST K +L E + + I + +Y
Sbjct: 2539 FDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEY 2598

Query: 2793 MHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPINFIKEM 2852
            + +ASK+ GGTI+  P + + MTT  +  TN +E L++ SF  KI VRWNLG INF++EM
Sbjct: 2599 IEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREM 2658

Query: 2853 WTTHVKALAVRRSQTANISFGQTXXXXXXXXXXXXNASKFNYIALEEPQIEVPQIRDLGE 2912
            W TH +A+A+RRS                         ++ YI LEEP IE+PQ +DLGE
Sbjct: 2659 WATHARAMALRRSHNGQSKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKDLGE 2718

Query: 2913 ATPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954
            ATPP+EWFGVNRK+ P  THQ  ++P+QKL +LAE ++ +IL
Sbjct: 2719 ATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARIL 2760

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score = 1400 bits (3623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 928/3000 (30%), Positives = 1504/3000 (50%), Gaps = 202/3000 (6%)

Query: 36   TIFYMGRIYAYLVSFILEWLLWKRAKIKINVETLRISLLGGRIYFKHLSVIHKDYTISIL 95
             IFY+GR+  Y+VS     +LWK+ ++ +++++L  S L G+++FK++SV  +D  IS+L
Sbjct: 5    AIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLISVL 64

Query: 96   EGSLTWKYWLLNCRKAELIENEKNSSGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINL 155
            +G++TW+YWL        I   + S   +    C+F L+ EG EYF+YNR   YD +   
Sbjct: 65   KGTITWRYWL--------IGRYRRSGTADGARRCRFALKFEGFEYFVYNRNGVYDRIARE 116

Query: 156  LSKDERDKFEKYLNEHSFPEPFSDGSSADKLDEDLSESAYTTNSDSSIINDRDYQETNIG 215
            L             E +  EP     S +++  +L +                       
Sbjct: 117  LD-----------GEDTSAEPTVSVPSVEEVIAELQDD---------------------- 143

Query: 216  KYPKGLSFFPIELKLNRGSLLLGNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHL 275
              P    F P+E   N+G+++LGNK T SV I++YE   G + +  P +       +T  
Sbjct: 144  --PLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEA 201

Query: 276  ELKNFEISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAGPSD 335
            ++ N  ++IK NI Y+    +K  ++  + ++LWK +  +L  V +  +  + KK     
Sbjct: 202  KISNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVLEATLHAKRKKEQHQT 261

Query: 336  DAFFQKWKGLSLYKASAGDAKTSDLDD-IEFDFTSHEYAKFTSILKCPKVTLSYDVDVPG 394
              ++  W+GLS+Y  +  +    +LD+ ++FD   HEYAK T++LK  ++ ++Y   +PG
Sbjct: 262  PKWYDNWRGLSMYDVNLDE----ELDEEVKFDIEHHEYAKCTTVLKADQMDVTYSYGMPG 317

Query: 395  V--VPHGAHPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPV 452
               V    +   P ++ P++       D ++D+ ++  +  YGPWA RQV    RV SP 
Sbjct: 318  TARVTDSDNAENPLLERPEL-------DHSVDILVYDANCTYGPWANRQVQQCLRVFSPT 370

Query: 453  VSRTAKPIKKLPPGSRRVYTLFRMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRP 512
            V R  K         +     F++++ IMED+  R+P +ESSKDA FL+ YK+T +E RP
Sbjct: 371  VCRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTRDETRP 430

Query: 513  FGWMDLRFCKDTYANFNISVCPTVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGD 572
            FGW+D+R  K++     ++  PT  GF+N  H + V+T I +SVNHD LLK+K  D+  D
Sbjct: 431  FGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSHDITVD 490

Query: 573  IGYPLGWNSNTIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMN 632
              YP GW     W  N+ S Q E F+LR+H+ L++D ++DFS G+   YE FRPF Y+  
Sbjct: 491  FSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPFDYRFR 550

Query: 633  WEMDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEIS 692
            W++ GYS YLNVND NI+NNP+DF ENCYLS+HGD   I  ++P  SI+  Y  + + I 
Sbjct: 551  WDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTVDFNIF 610

Query: 693  TPMFRMMLNTPPWNTLNEFMKHKEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNST 752
            TP F + LN PPW+T +E + +KE+GRS +F IKG Y  YSE+D+DNVD+L I C ++  
Sbjct: 611  TPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIACETDYI 670

Query: 753  VLHCYGFVMRYLINVKMNYFGEFFNFVTSEEYTGVLGAREVGEVVTKSSV--------VD 804
            V+ CYG +++ ++NVK+NYFGE  +F T+EEY   L  R      T             D
Sbjct: 671  VVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSDGNVHDSD 730

Query: 805  LASTLDSEYQNGSMKNDAEDNGP-MKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFD 863
            + +T  +E  + S   DA    P +K+S LKR+ NE D+WFTF    G    PE IY FD
Sbjct: 731  VVATESNEIIDASF--DAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFFPENIYKFD 788

Query: 864  PCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGV 923
             C+  +F  L    R  NYY+D    L+    KRH       +F  I       +     
Sbjct: 789  ACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDAY 848

Query: 924  LSDLTIHGHRMYGLPPTEPTYFCQWDINLGELNINSDIEFLKGFFTSFYKVGFGYNDLEN 983
            LS  +   H+M G+ P+E +Y C++D+ +  L+++ D+  LK F  +   + FG+ D+EN
Sbjct: 849  LSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVEN 908

Query: 984  ILLYDTETINDMTSLTVHAERINISLNDPVMKSQSI---VSVESLLFTLIDFENERYSQR 1040
             L Y+ E + D+  ++   E + + L + V K + I   +++     T  D  NERYS+R
Sbjct: 909  SLQYEREQVFDLNKISCVIENVTVKLQN-VDKDEDIWLSLNLPVTTLTSFDLANERYSRR 967

Query: 1041 IDIKVPKLTVSLSCVMGDGTNTSFLNFETKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPY 1100
             D+ +P+L   +    GD  +T    F T +  T F +++   + R  QR++I++ND+P+
Sbjct: 968  SDLSIPELLFGI--YRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAPF 1025

Query: 1101 HRCPFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXXXXXXYIIEDIVGEYATLLEAT 1160
            HRC F+LP  Y+    Y+ LYG                      I E ++GE      + 
Sbjct: 1026 HRCSFMLPPEYKKMPIYRSLYGCIPPSSSLPLFPEPISADNFEVIFEKLLGEIYQEYASD 1085

Query: 1161 NPFKDLFAETPSTVEPLRASFTXXXXXXXXXPLEFKPVAFTEEINHERDNYVIDVSYILL 1220
            + ++ +  ++ S+ E    + T          L      F    NH++      +S  ++
Sbjct: 1086 SSYQ-ITDDSISSTEHDYHNQTVNAAIGTSSSL------FIRSQNHQQ-----TLSSFIV 1133

Query: 1221 DIDP----LLFVFTKSLLE--QFYSE-DMVQVLDDIEIGIVKRLSNLQEGIVSISNIDIH 1273
            + DP    L    T+ +LE  ++ +E  + + +D +EIGI+ +          IS  ++ 
Sbjct: 1134 EFDPIDGYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGIS--EVR 1191

Query: 1274 VAYLNLIWQETGEEG-FELY-----LDRINYQMSEKSLEKNRTSKSLEVAVLAKVKTVRA 1327
            V   N+    T ++  F ++     +  ++     KS + N      +  +  K+  +RA
Sbjct: 1192 VLCPNISLSATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDPEKTTLCYKIDYIRA 1251

Query: 1328 TVNQKKNPELSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYC 1387
             + Q       +      S  +E  E + S +   +   N+ S  +T+     + LFE+ 
Sbjct: 1252 NIVQDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTDKLLFEFL 1311

Query: 1388 SDQGNLIQEVFTSVNSIQNTRSSTKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKG 1447
            +   +    +   ++S ++T  ++K E +  +      Y+I HDP VITKPA I R S  
Sbjct: 1312 NPFISTFDLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITKPANITRFSNR 1371

Query: 1448 HVRENRSWKIITRLRHILTYLPDDWQTNIDKVLKERKYSFAKDAKNIFMSVFSTWRNWEF 1507
            H+R   SW+II RLRHIL YLP +W  +  + L  + ++  ++A   F+S+FS WR+WE 
Sbjct: 1372 HIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSIFSDWRSWEP 1431

Query: 1508 SDVARSYIYGKLFLADHAKHKGNSIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVV 1567
            +DV  S+++ K+F     K +      L   T  S          ++  N +  DA + +
Sbjct: 1432 TDVQGSFVHEKVF----TKKRSRPFAALQGFTFSS---------DDIRLN-MKDDARVPI 1477

Query: 1568 DLTPPVTSLSSNREETIEITGKVGSVKGKFSDKLLKLQDLIPLVV---AVTEDDKSDPKA 1624
             +      + +N     ++ G+    +G   D      D I        V   D+S  K 
Sbjct: 1478 TVKGVTLGIRNNGLAPEQVDGR---TEGSMPDP-----DYISFCTTDEVVMRVDRSFVKT 1529

Query: 1625 -----ELSKQFKMNTVLLVDK-------SEIQVVMDKTKVMSRTVGGRVSLLWENLK--- 1669
                 +L  +FK+   +   K       S I     K  V+++  G  + +  +NL    
Sbjct: 1530 LKEFRDLIHRFKIGGPVGTAKHDNVSLFSNITFQFGKLYVVAKLAGVYLRICLDNLSALM 1589

Query: 1670 -DSTSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDFSILATTEAWSHKPTILVNNQCADL 1728
              S S   S VI S  S +   H   ILG       +I    + +S     L    C  +
Sbjct: 1590 LTSQSSVESKVISS--STLSFDHMQAILGYRSFRFMTI--DIDMFSVLLHYLPGQGCYSI 1645

Query: 1729 HFRAMSTTEQMVNAIT-EIKESVLKVKEQIKF-----------KPKSKNKSQFVGSRINT 1776
             ++A        +A T ++ ES+  V+++IK+           +P  + +S   G++I+ 
Sbjct: 1646 DWKARKFHIDSSSATTKDLTESLPYVRDEIKYLVEALVPELFAEPPIERESS--GNKIHA 1703

Query: 1777 VL-SCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQ 1835
            VL     +N++ ++  LSPF I + A+  ++      S    L+  ++   ++S + K  
Sbjct: 1704 VLFQGQVANITLKLQILSPFIILYCAENFELQAESTDSVIFDLNSGESYMEISSAKQKLD 1763

Query: 1836 YLRFSFGDIEIKGGFSKEAYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGIXXX 1895
            Y +++   +++ G  S  A    ++   I ++KL+  + +  +   LQD K A       
Sbjct: 1764 YFKYTHTCLKLSGT-SSSARLFEHISCDIGILKLSVFDLKTRITDLLQDIKAA------- 1815

Query: 1896 XXXXXXXXTTDPMNAKKETP--AKMINW------TLDTNISYFGILVPVASTYFVFEL-H 1946
                     +D +N  + +P  +   +W       L    +Y G+L+    T ++ E  +
Sbjct: 1816 --LFSMKSLSDILNISQSSPTASAFGSWFSILPDNLSLQATYAGLLLGFGHTLYILEFNN 1873

Query: 1947 MXXXXXXXXXXXXXPEQTRLTGQLSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTAD 2006
                            +       SIE+  FLIK+R +   L+K++DF++  + +  T  
Sbjct: 1874 FEAKHTRDGLPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFNMVHDTDL 1933

Query: 2007 TEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLDMVQYYSKR--HAPNIWNIRMFTGKSDK 2064
              QS Q+ES+H ++ L+P +++RL+    +   + + +++   + P+  +      +  +
Sbjct: 1934 CIQSVQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESIYTPSSAHNNSTATECLE 1993

Query: 2065 PKEIPINFRSIHILSYKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDFGKFTIVDAFFS 2124
            P    +  +S HILS+ F I WLF        GL+ GY+RLFS YEK +GK T+++A+FS
Sbjct: 1994 PSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKLTLLNAYFS 2053

Query: 2125 VSNGNTS-STFFSEGNEKEKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFLPS 2183
             +    S + F+S    K++ N S+L +MQ+ YWF    E  D F R HG  L V+    
Sbjct: 2054 AAKILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAKLAVDISAE 2113

Query: 2184 FMDVIDSTLQSIRAFQELKKNILDMPHESNMENSSPDAAPNTENASNSLAPFLDNIRSVN 2243
             + +++ T+QSI+ F  LKK ++D P  +  ++S  D +    N +N LA     +RS+N
Sbjct: 2114 IVTLLEETIQSIQTFNNLKKALVD-PFRTKKQDS--DISKEPYNWNNQLAT---GVRSLN 2167

Query: 2244 CNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTINCTYKHDESKAKPHRIRTLITVDPT 2303
            C   Y G   +++++D     + P  EL SP   +   YK+  +  K HR RTLIT  PT
Sbjct: 2168 CIINYAGVTLKLHSHDG-RGDASP-LELTSPSYKVAIDYKYFPNLEKTHRFRTLITATPT 2225

Query: 2304 HNTLYAGCAPLLMEFSESLQNMIKKHSTGEKKPNFTKPSTQNV---DYKRLLDQFDVAVK 2360
            HNT Y+  A L+ +       ++K  ST  K  + +  S+  V   D   LL   D+ + 
Sbjct: 2226 HNTFYSTSAFLIHDLCYRFSKLLKTSSTENKSSSASTSSSIKVEGSDNSTLLGSIDLVII 2285

Query: 2361 LTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIFS 2420
            L   KQ+++ SCEPKAKVQA VGFE F   +  N  + E+ L  ++ +E    + +HI+S
Sbjct: 2286 LNVGKQEVTFSCEPKAKVQATVGFEKFDIKIFNNNINDEESLCLAIEIENLMTNSRHIYS 2345

Query: 2421 REVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSIL 2480
            REV  S ++  + +        V  +YG++L+S    +FN+KQLQ+L LF+D W F    
Sbjct: 2346 REVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQW-FPQKT 2404

Query: 2481 HTRPTQRPNNKEVNMSTLSSNSNVDVG---TEIPWCFTLIFTNLSGDVDLGPSLGVISLR 2537
                   P    V+  + S  S    G   +   W +++I      +++LGPSLGV+++ 
Sbjct: 2405 PMNTGSYPEGVLVDDISRSIGSKFYKGSSSSSFTWGYSVIVAGSCAEIELGPSLGVLNVT 2464

Query: 2538 SQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWVSEVKWPLENSKNTHP 2597
            S+  W  +    +  Q L      + +TS GRL G F V NA    E+KWP        P
Sbjct: 2465 SEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDFFQVP 2524

Query: 2598 LVSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSDEITLS 2657
            LV   L  D V  K +FDYH F I ++      L NE+D  G L DLL V+ S + + + 
Sbjct: 2525 LVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVSFESVNIF 2584

Query: 2658 STALVAANILDIYNTIVRMRQDNKISYMETLRDSNPSESKQPILYKDILRSLKLLRTDLS 2717
             TAL AANI DI N+I R+++DN++SY+ +   S+   S +P     I  +L LLRT LS
Sbjct: 2585 LTALAAANISDIKNSITRLKKDNELSYLSSFLASD-QPSDEPEEDGGIFDTLSLLRTQLS 2643

Query: 2718 VNISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKE 2777
            +N+   ++QISP SLFD +VL++   K+   +   +  K+KTDL  Q+ DVS AL     
Sbjct: 2644 LNLGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVSLALLPFNN 2703

Query: 2778 ELDEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKI 2837
             LDE   A++ +  Y+  +S I GG I   P + V+MTT QE ++N +E L++ SF   +
Sbjct: 2704 SLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFGGTV 2763

Query: 2838 SVRWNLGPINFIKEMWTTHVKALAVRRS---QTANISFGQTXXXXXXXXXXXXNASKFNY 2894
             +RWNLGPI+FIK+MW  H+ A+ +R       A      T              S + Y
Sbjct: 2764 KIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPLEMHLGSDYQY 2823

Query: 2895 IALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954
            + L+EP IE+P+I+DLG+ATPP+EWFGVNR + P FTHQ  ++P+QKL   AEK+Y KIL
Sbjct: 2824 LPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQKLARTAEKEYEKIL 2883

>Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar to
            Ashbya gossypii AGR088W
          Length = 2943

 Score =  943 bits (2438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/1548 (34%), Positives = 832/1548 (53%), Gaps = 62/1548 (4%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60
            M+  ++   + + +++ F WVFLV+W   ++  + T FY+ R   Y+V+ IL W++WKR 
Sbjct: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60

Query: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNS 120
            K+ IN+++L  S++GG++YFK++S+  +D TISIL+G+ TW+YWLLN R  +L    KNS
Sbjct: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQL----KNS 116

Query: 121  SGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYL--NEHSFPEPFS 178
            +  +    C+F LEC+G+E FIYN+   Y++++N L+K ++D   K+   +E  F    +
Sbjct: 117  NINDENSKCRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFATDDESIFGRVKT 176

Query: 179  DGSSADKLDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELKLNRGSLLLG 238
            D S    + + L ES+  +    +I+N      +N    P  L F P E+ L+ G++++G
Sbjct: 177  DSSV---MFDPLDESSEQSKVGQTILN----SVSNQSAVPLYLDFLPAEVILSSGAVVVG 229

Query: 239  NKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLKF 298
            NK TPSV I+ Y   EGIIDV  P   LD Y+ ++  EL +  +S+K NI + +    K 
Sbjct: 230  NKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSSKK 289

Query: 299  KLDTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAG-PSDDAFFQKWKGLSLYKASAGDAKT 357
                GK   LW+     L      ++   G K G    + F   WKGL++Y  +  D  +
Sbjct: 290  HKIDGKPFNLWQKLKDCLLFTISHILAFTGNKKGLTGQEEFLTSWKGLAMYDVATSDTFS 349

Query: 358  SDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVGNNGA 417
               D+I FD  +HEYAK+T+IL   ++ L Y  D PGV+          I G + G+   
Sbjct: 350  ---DEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVITETL------IKGYENGDIPP 400

Query: 418  PPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMN 477
             P++++DVQ++  +  YGPWA RQ+ +  ++ SP VSR     +K   G  R +  FR  
Sbjct: 401  SPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHANFRCE 460

Query: 478  ILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVCPTVE 537
            I+IMED+ WRIPT+E SKDA FL  YK T++E R FGW+D++  KDT  +  + +  +  
Sbjct: 461  IVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGLQASEC 520

Query: 538  GFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQLEAF 597
            GF+N FH + V   I +SVNHD+L  +K   +     YP  WNS   W ++  S  LE F
Sbjct: 521  GFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHFISSDLELF 580

Query: 598  LLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNPLDFN 657
            +LR+H  L+ D  +DF++GD  PYELFRP +Y+ +W++  YS+YLN ND NIVNNPLDFN
Sbjct: 581  ILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANIVNNPLDFN 640

Query: 658  ENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEV 717
            ENCY+S+HG+   I + +P E+I      +SYEI TP F + L TPPW+TL+EFM  + V
Sbjct: 641  ENCYISIHGNSARIGVKLPIETISEESITISYEIYTPKFDIQLKTPPWHTLHEFMAQRFV 700

Query: 718  GRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFGEFFN 777
            GRS++F+  G YL Y+++DIDNVD++ + C +N      YGF++RY++N+K+NYFGEF  
Sbjct: 701  GRSHEFSASGSYLSYNDVDIDNVDTINLECKTNHATFLAYGFLLRYVMNLKLNYFGEFAQ 760

Query: 778  FVTSEEYTGVLGAR-EVGEVVTKSSVVDLASTLDSEYQNGSMKNDAEDNGPMKRSDLKRT 836
            F T+EEY+  L  R +V   +  ++  D  + L      G    D      + ++ LKRT
Sbjct: 761  FRTTEEYSEELAQRNDVATDIFNNNDDDQTTELVEPNSYGESGFDILHGKKIDKASLKRT 820

Query: 837  TNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIK 896
             NE DIW TF   +G  +LPE+ Y F  C  LHF  +  D R  +YY D+   +N T IK
Sbjct: 821  VNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYLSYYADLAFSMNSTYIK 880

Query: 897  RHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPTYFCQWDINLGELN 956
            R+     N VFD    N        G LS+  IH HRM+GLPP E TY  + D++LG L+
Sbjct: 881  RYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPAEETYLFKIDVSLGYLS 940

Query: 957  INSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAERINISLNDPVMKS 1016
              SDIE LKGF     K  FG+++ E++L Y+     D++ L+  A+ I+I LN+     
Sbjct: 941  FESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSFFADDISIRLNNIDTNK 1000

Query: 1017 QSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSFLNFETKLRFTNF 1076
               +S+ ++   L+DF   +YS R +I +P     +S +  D  N       T + F  F
Sbjct: 1001 FISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSM--DDHNIVLGTISTSISFAIF 1058

Query: 1077 GQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXX 1136
             +  D     + Q ++I+++D+P+ RC FL P  YQ SD Y+ LY               
Sbjct: 1059 SRNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTSDLYKLLYASIPPSSSIPLLPEP 1118

Query: 1137 XXXXXXXYIIEDIVGEYATLLEATNPFKDLFAETP---STVEPLRASFTXXXXXXXXXPL 1193
                    I E+++G+          ++D  +E     S    L+ +             
Sbjct: 1119 IGPNNFDTIFENLLGDI---------YQDYISEGTFDISNDTKLQLNIDEFKKHSENSFS 1169

Query: 1194 EFKPVAFTEEIN---HERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMVQVLDDIE 1250
            + K    T +I    HE  ++V ++ +I +DI   +      L  Q  +  +   +D + 
Sbjct: 1170 KHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFADLYRQLTTFTISDTIDGLG 1229

Query: 1251 IGIVKRLSNLQEGIVSISNIDIHVAYLNL---IWQETGEEGFELY-------LD---RIN 1297
            + IV   S    G  S++   +    ++    +++    E  + Y       LD   R+ 
Sbjct: 1230 VDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKHYFVSDINKLDLNLRLR 1289

Query: 1298 YQMSEKSLEKNRTSKSLEVAVLAKVKTVRATVNQKKN----PELSEDRPPALSLGLEGFE 1353
             +  ++S      SK+ +++V  K   +   +  K+N     E SE    +    LEG+ 
Sbjct: 1290 QEYDKESANSEMNSKN-KLSVYYKTALINGKMLSKENFIYPSESSEFSYKSTFEELEGYA 1348

Query: 1354 VWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKT 1413
             +   +D  V   NL    + I++   + + E+             SV   +N   S K 
Sbjct: 1349 FY---DDDLVTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFIKSVTISKNFNKSMKR 1405

Query: 1414 ELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQ 1473
            EL+ ++  A + Y I HDP VITKPA I RLS+ HVRE+RSW+I+TRLRH+L YLP  W 
Sbjct: 1406 ELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRLRHVLNYLPQYWY 1465

Query: 1474 TNIDKVLKERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFL 1521
                  L++ K+   +DAK  F+ +F+ WR+WEF+DV R ++Y K ++
Sbjct: 1466 ETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTYI 1513

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/1193 (36%), Positives = 664/1193 (55%), Gaps = 52/1193 (4%)

Query: 1785 VSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEIL---LSIWDTDFFMTSHQTKEQYLRFSF 1841
            ++ ++  L PF +R+  K+ +I  + FG   IL   LS+ DT   + S + +E Y+++S 
Sbjct: 1777 INIQLQLLLPFILRYSCKEFEINVD-FG--RILQSSLSLQDTSVELLSLEFQEPYMKYSH 1833

Query: 1842 GDIEIKGGFSKEAYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGIXXXXXXXXX 1901
              +++ G       +L  + +  S  KL+  EP++ +  FL D     Q +         
Sbjct: 1834 SYLKLIGMDLGNTDNLGRISLDSSFSKLSIFEPKKNMRLFLSD---IEQAVKNIEILRST 1890

Query: 1902 XXTTDPMNAKKETP-AKMINWTLDTNISYFGILVPVASTYFVFELHMXXXXXXXXXXXXX 1960
               T     + E P +++I   L+ N+ Y G+L+   +T +V E +              
Sbjct: 1891 MLETKSSTVQNEFPFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSN 1950

Query: 1961 PEQTRLTGQLSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHFRV 2020
            P     +   S E+I FLIK+R +   LSK+LDFS+++  ++ +    QS Q+ESS+   
Sbjct: 1951 PVVPTFSSDYSSESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHA 2010

Query: 2021 CLSPDSLLRLIWGAYKLLDMVQYYSKRHAPNIWNIRMFTGKSDKPKEI-PINFRSIHILS 2079
             LSP SL+RL+    +   M   Y         +I+  +  S+    I PI+ +S HILS
Sbjct: 2011 VLSPMSLVRLLSFVNEFSIMKSIYH--------DIKPRSTSSNSTLSILPISIKSAHILS 2062

Query: 2080 YKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEGN 2139
            Y  CIGWLF  G   + GL++GY RLF+ Y+K +GK T++DA+FSV++G +SST++ +GN
Sbjct: 2063 YNLCIGWLFDLGYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGN 2122

Query: 2140 EKEKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAFQ 2199
            EK   NRS+LP+MQI+YW +     KD F R +GE LDV+ L  +  ++D   QS+  F+
Sbjct: 2123 EKGAMNRSYLPSMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFK 2182

Query: 2200 ELKKNILDMPHESNMENSSPDAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTYD 2259
            +LK+ ILD      ++ +S D      N  ++  P   ++RS+NC   Y G   ++Y+ D
Sbjct: 2183 KLKETILD-----PLKVTSNDPILGEWNYLDN--PLASSVRSINCIINYAGSSMKLYSRD 2235

Query: 2260 DIEAKSEPSFELKSPVVTINCTYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLME-- 2317
            DI+  +  SFE++SP  T+   YK+  SK K H IRTL TV+ THNTL+  C PLL E  
Sbjct: 2236 DIQHGT-CSFEIRSPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMW 2294

Query: 2318 --FSESLQNMIKKHSTGEKKPNFTKPSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPK 2375
              F+  L+N   + S G   PN      + ++Y+ LL+ FD+AV +   KQ++SL+CEP 
Sbjct: 2295 LTFNTMLKNSCSQFSNG--APNLASAKAE-INYRDLLEAFDIAVIINVGKQEISLTCEPT 2351

Query: 2376 AKVQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLT 2435
            AK+QA +GFE F   + TN    ++PL  S+ L    AS +H+FSRE+S+S  +  + + 
Sbjct: 2352 AKIQATIGFEKFDIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREISSSLSLQQISMV 2411

Query: 2436 LLFTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNM 2495
               TH + I  YG++L+S    +FNVKQ+++L LFL+IW   SI   +         V  
Sbjct: 2412 FSLTHSEYIHTYGSTLISKPLFYFNVKQIEDLNLFLEIW---SIEKQKSVNDIILAPVTA 2468

Query: 2496 STLSSNSNVDVGTEIP------WCFTLIFTNLSGDVDLGPSLGVISLRSQRTWLATDHYD 2549
            S+  S  ++     +P      W + LI + +  ++DLGPSLG++ ++S   W  + H  
Sbjct: 2469 SSFESVPSMPKLQRVPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNI 2528

Query: 2550 EKRQLLHAFTDGISLTSEGRLSGLFEVANASWVSEVKWPLENSKNTHPLVSTSLNIDDVA 2609
            +  Q L      I ++S GRL G   + +  W S++ WP+ N+ +  PLV  SL +    
Sbjct: 2529 DWTQKLLISMKEICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFN 2588

Query: 2610 VKAAFDYHMFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSDEITLSSTALVAANILDI 2669
             K +FDYHMF I TI N    L N++D +G L DLL VS S D I +  T+L  AN+ DI
Sbjct: 2589 TKLSFDYHMFFISTIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDI 2648

Query: 2670 YNTIVRMRQDNKISYMETLRDSNPSESKQPILYKDILRSLKLLRTDLSVNISSLKVQISP 2729
            Y+TI RMR D+  + ++ L +SN  +         +L SL  LRT+LSVN   L + I  
Sbjct: 2649 YSTIRRMRNDSGRTNLDLL-ESNELKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFS 2707

Query: 2730 ISLFDVEVLVVRIDKV------SIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEI 2783
             +L   EV+V+R  KV         S+T S  K++T+L  Q+ D+S +LS+ K +LDE  
Sbjct: 2708 TTLIGTEVVVLRTRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQ 2767

Query: 2784 GASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNL 2843
               I + DY+  AS I GG I++ P + V M T Q + +N +E L++ SF + +S+ WNL
Sbjct: 2768 LDKIDVIDYVKLASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNL 2827

Query: 2844 GPINFIKEMWTTHVKALAVRRSQTANIS--FGQTXXXXXXXXXXXXNASKFNYIALEEPQ 2901
             PINFIK+MW+ H+ A+ +R  Q  N S                    +K+ Y  LEEP 
Sbjct: 2828 RPINFIKDMWSIHINAMKLRHMQKGNSSEIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPN 2887

Query: 2902 IEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954
            IE+P+I+DLG+ATPP+EWFG+NR R P  THQ  V+P+QKL  +AEK+YV+IL
Sbjct: 2888 IEMPKIKDLGDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRIL 2940

>KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087C CSF1 Protein required for fermentation at low
            temperature
          Length = 2923

 Score =  826 bits (2133), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/1587 (31%), Positives = 815/1587 (51%), Gaps = 113/1587 (7%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60
            M++ S  R + ++ +KD S  FLVDWIL VI C+   FY+GRI A++++  L++ +W++ 
Sbjct: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60

Query: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAEL-IENEKN 119
            KIKIN++++++S LGGRI+FK+L+V+  D+TIS LEGS TW+YWLL+ R   +  E+E  
Sbjct: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDG 120

Query: 120  SSGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEPFSD 179
             + +N +LPC+FLL+C+GLE F+YN+   Y++V+       RD F              D
Sbjct: 121  DASENAKLPCRFLLQCDGLEVFVYNKIDVYESVL-------RDHFTNVT---------KD 164

Query: 180  GSSADKLDEDLSESAYTTNSDSSIINDRDY------QETNIGKYPKGLSFFPIELKLNRG 233
            G   +  ++D++ +     ++S + N   Y      + T+  K       FPI+L+ NR 
Sbjct: 165  GQETES-NDDITINTEKAAANSKLSNSSRYSYSGRSKSTDAPKLSAKTKLFPIQLEANRA 223

Query: 234  SLLLGNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDA 293
            +++LGN+ T  V +  +E  +G+ D+      LD YR K  L+L +    ++ N+GY + 
Sbjct: 224  AIVLGNRNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLGYQND 283

Query: 294  IGLKFKLDTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAGPSDDAFFQKWKGLSLYKASAG 353
              +K  +    + K+W+T  +    ++K ++P +GK    +  A+   WKGL LY  +  
Sbjct: 284  NPIKTFVVEKTMDKIWQTVKKQCISISKLLLPNQGKTIN-NQQAYIDSWKGLDLYHHTKA 342

Query: 354  DAKTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVG 413
              +  ++D         EYA+++ ++K  +V+L+Y  D+PG+VP  +       D  +  
Sbjct: 343  -VQEENVDTTVLH--EQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRDESL 399

Query: 414  N---NGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRV 470
            N   +   P F  D+ I+  ++ YGPWA + +  + R+ SP+VSR      K  PGS R+
Sbjct: 400  NCNQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRI 459

Query: 471  YTLFRMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNI 530
            Y  F++++   + +   IPTRESSKD EF++ YK T + +R FGW+++   +     FN+
Sbjct: 460  YENFKLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNL 519

Query: 531  SVCPTVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMK 590
            ++C   +   N+ +V  +  EI+SSVNH++L +     +  +IGYP GWN    W+  + 
Sbjct: 520  ALCSQADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLFELD 579

Query: 591  SEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIV 650
            S   E FLLR+HI+L++D  +DFSA D   YELFRPF Y++ W    Y ++LNVND NI+
Sbjct: 580  SRTAELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFLNVNDANII 639

Query: 651  NNPLDFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNE 710
            NN LD NENC+LSL GD L   I +P  SI+    + ++ + +P+ ++ ++ P WNTL+E
Sbjct: 640  NNLLDLNENCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHE 699

Query: 711  FMKHKEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMN 770
            F+     G   DF++ G Y+ +  +D+DN D++ I+  S+ST    +GFV+RYL+N+K+N
Sbjct: 700  FLSETTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLN 759

Query: 771  YFGEFFNFVTSEEYTGVLGAREVGEVVTKS----SVVDLASTLDSEYQNGSMKNDAEDNG 826
            YFG+F +F T+EEY+  L   E  +  TK+       D+ S   S         D  +  
Sbjct: 760  YFGDFNHFKTTEEYSNDLSMEEDTKTKTKNFQEQPTNDVESLTSSSSDGSYQVADTINEN 819

Query: 827  PMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYMDI 886
             + +S L RT NETD+W TF V +G +I+PE +Y       L F  L  D R  NY+MD+
Sbjct: 820  TIHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEFDMRYTNYFMDL 879

Query: 887  MAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEH----GVLSDLTIHGHRMYGLPPTEP 942
             A  +   +        N V         A E+ H    G L DL +HGHRM+G+PP E 
Sbjct: 880  TAFFSRIYLNHSNEFSFNRVV--------AIEESHSENTGYLDDLNLHGHRMFGVPPVEE 931

Query: 943  TYFCQWDINLGELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHA 1002
            TY C+WDI++G L+ +SD +FL  F  +  KVGF Y D ENIL+Y      D+TSLT+  
Sbjct: 932  TYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPEDVTSLTISI 991

Query: 1003 ERINISLNDPVMKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNT 1062
             R++ S+        + +S+  +     D  N RYS+R+D+ V  ++V   C + D   T
Sbjct: 992  GRVS-SIVRTNHGGSATLSLNDITINSWDLSNSRYSKRVDLLVAAISV---CAI-DEKKT 1046

Query: 1063 SFLNFETKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDT-YQKLY 1121
                 +T +  T F    +    R  Q+  +++NDSP+HRC FLL     +  T Y  L 
Sbjct: 1047 VLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNHSTLYDDLL 1106

Query: 1122 GXXXXXXXXXXXXXXXXXXXXXYIIEDIVGEYATLLEATNPF---KDLFAETPSTVEPLR 1178
            G                      I E ++G Y  L+         K+L  + P     L 
Sbjct: 1107 GSITPSISLPTLSEPLTFQTFDNIYERLLGSYINLINFDTDIIDTKNLTDDRPDDKRLLP 1166

Query: 1179 ASFTXXXXXXXXXPLEFKPVAFTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFY 1238
             S T           EF           E +N  +++S + + + P  F F ++      
Sbjct: 1167 LSNTVSNDLSGQLAEEF-----------ESENTTVNISTLSVFVTPKAFTFAENAAHFML 1215

Query: 1239 SEDMVQVLDDIEIGIVKRLS--NLQEGIVSISNIDIHVAYLNLIWQETGEEGFEL-YLDR 1295
            +     ++D  E+ IV   S  ++  G    S++ +    +N I  ET  +  +L  LDR
Sbjct: 1216 TMSTESIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVN-ISDETALDKTQLEALDR 1274

Query: 1296 INYQMSEKSLEKNRTSKSLEVAVLAKVKTVRATVNQ-KKNPELSEDRPPALSLGLEGFEV 1354
            +   +S              ++V++K+      + Q  ++  +++D   + +     F +
Sbjct: 1275 LELSVS-------------NISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFNI 1321

Query: 1355 WSSTEDR------------------------QVNSLNLTSSDITIDESQMEWLFEYCSDQ 1390
            + S+++R                        +V+ L   S    I ++ +EW  EY    
Sbjct: 1322 FKSSKNRLTKVLPIAWFEILMFNTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYLLKL 1381

Query: 1391 GNLIQEVFTSVNSIQNTRSSTKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVR 1450
                 +   S   +   RS    E I ++    +   I   PY+ITKPA+I RLSK HVR
Sbjct: 1382 AKAFCKEGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHVR 1441

Query: 1451 ENRSWKIITRLRHILTYLPDDWQT--NIDKVLKERKYSFAKDAKNIFMSVFSTWRNWEFS 1508
            +  SWKIITRLRH+  +     +T    D + +E + +  KD K+ F+ +F  W+NW+  
Sbjct: 1442 DTASWKIITRLRHVSKHTSHVSETTSQCDDIPEEVR-NICKD-KSQFLDIFVDWKNWDVY 1499

Query: 1509 DVARSYIYGKLFLADHAKHKGNSIKKL 1535
            +V +S ++  LF  +   H+ +   +L
Sbjct: 1500 EVEQSSLFTLLFSGESTVHEEDLFNEL 1526

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/1070 (35%), Positives = 600/1070 (56%), Gaps = 53/1070 (4%)

Query: 1909 NAKKETPA-KMINWTLDTNISYFGILVPVASTYFVFELHMXXXXXXXXXXXXXPEQTRLT 1967
            NA  E  A K    +   N  Y G+L  + +T +V E +               E+T   
Sbjct: 1880 NADNEPAAPKFKPCSFKMNAIYIGLLTDLKTTNYVLEFNETAFSCASRAEAL--EETHAN 1937

Query: 1968 GQLS-----IENILFLIKERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHFRVCL 2022
              L      I+N+  L+    +   LSK+ D    +  ++   D +++ Q+E+ H RV L
Sbjct: 1938 DNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKLIED--DIKKTLQIETPHSRVML 1995

Query: 2023 SPDSLLRLIWGAYKLLDMVQYYSKRHAPNIWNIRMFTGKSDKPKEIPINFR--SIHILSY 2080
            +P +L+ +I+   +    +Q   ++   N          S    EIP  F   S++ILS 
Sbjct: 1996 APSTLIAVIFFIQEAKVSLQKVKQKGKFN---------SSSNAIEIPPYFETLSVNILSN 2046

Query: 2081 KFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEGNE 2140
            K C+GW+F+    D+ G++ GY  LF+AYEK +GK TIVD + + + G  S+ FF   N 
Sbjct: 2047 KLCLGWIFEEDT-DENGIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFFF-ANG 2104

Query: 2141 KEKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAFQE 2200
              + NRS L +MQI++WF      KD F R + + LDV  L + +++++    SI +FQ+
Sbjct: 2105 VPELNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIESFQK 2164

Query: 2201 LKKNILDMPHESNMENSSPDAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTYDD 2260
                I      SN++ SS       EN S+ ++    +IRS+NC  KY GG+  +YT DD
Sbjct: 2165 KLAKI------SNIKKSSISTHNVAENLSDKVSIL--SIRSINCIAKYGGGIINLYTPDD 2216

Query: 2261 IEAKS-EPSFELKSPVVTINCTYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLMEFS 2319
            I   S + S EL SP + ++  Y H+    K H IR+L+ V+ THN L++ C P+L+  +
Sbjct: 2217 IAQDSPKSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNVESTHNILFSSCVPVLVNLT 2276

Query: 2320 ESLQNMIKK---------HSTGEKKPNFTKPSTQNVDYKRLLDQFDVAVKLTSAKQQLSL 2370
              +Q  +++         H T E+  N  + S    DYK L  + D A+ +    Q ++L
Sbjct: 2277 TEIQKQMERFNSEKKQLVHKTQEQTTNTQRIS---FDYKNLFKKIDTAIVINVGAQNITL 2333

Query: 2371 SCEPKAKVQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIFSREVSTSFEVG 2430
            +CEP+AK+QAD+GF +F  SM T+  D  +PL  SL   + + S +HIFSRE+S+S  + 
Sbjct: 2334 TCEPRAKIQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSAGIN 2393

Query: 2431 FMDLTLLFTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSILHTRPTQRPNN 2490
             + L  + TH + I  YG +L+SD+  + N+KQLQ + LFLDIW       T+  Q+  +
Sbjct: 2394 EVYLDFMLTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWS----PKTKKAQKLGS 2449

Query: 2491 KEVNMSTLSSNSNVDVGT-EIPWCFTLIFTNLSGDVDLGPSLGVISLRSQRTWLATDHYD 2549
               +       +  +  T +IPW + +IF N S  +D+ PSLG I+ +    W+++ H  
Sbjct: 2450 GPHSGQKCQPQALTEFTTPKIPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHRV 2509

Query: 2550 EKRQLLHAFTDGISLTSEGRLSGLFEVANASWVSEVKWPLENSKNTHPLVSTSLNIDDVA 2609
            +    +  + D ++  S+GRL GLFE+ N  + S + WP++++K   PL++ +  +  ++
Sbjct: 2510 DWSHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHLS 2569

Query: 2610 VKAAFDYHMFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSDEITLSSTALVAANILDI 2669
             K  FDYH FLI  +++++  + NE+D  G+L DLL VS S   + +  TAL +AN+ DI
Sbjct: 2570 SKIGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDI 2629

Query: 2670 YNTIVRMRQDNKISYMETLRDSNPSESKQPILYKDILRSLKLLRTDLSVNISSLKVQISP 2729
            Y T  RMR +NK SY++TL++SNP  S +     + L +   LRT+L+  I S ++ + P
Sbjct: 2630 YATFARMRIENKKSYVQTLKESNPESSGKIHFSNNELLAPLRLRTNLTAEIGSFRLYVFP 2689

Query: 2730 ISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAI 2789
             +LFD EVLV++ +K+++ + T + +K KTDL  Q+ D++ +L+  K EL EE  A +++
Sbjct: 2690 STLFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFAELSV 2749

Query: 2790 DDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPINFI 2849
            ++Y   A+ + G  I+  P + V +TT Q+    ++E+L++ SF DK+ ++WNL PINFI
Sbjct: 2750 EEYNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDPINFI 2809

Query: 2850 KEMWTTHVKALAVRRSQT---ANISFGQTXXXXXXXXXXXXNASKFNYIALEEPQIEVPQ 2906
            +EMW THV+AL+VRR  T    +  F +               +K+ YI LEEP IE+P 
Sbjct: 2810 REMWATHVRALSVRRGHTEPSPSKPFFEDENIAEKIKIVNL-GTKYKYIPLEEPHIEMPL 2868

Query: 2907 IRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQYVKILDD 2956
            +RDLG ATPP+EWFGVNRKR P   HQ  V+P+QKL+Y+AE QY + L D
Sbjct: 2869 LRDLGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLGD 2918

>Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C
          (CSF1) -  [contig 173] PARTIAL
          Length = 62

 Score = 65.1 bits (157), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 41/60 (68%)

Query: 5  SQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRAKIKI 64
          S+ R VP++  +DFSWVFL DW+L +   L + FY GR+  Y ++ ILE+L WKR  +K+
Sbjct: 3  SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

>KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.53
            YLR303W
          Length = 445

 Score = 37.4 bits (85), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 83/198 (41%), Gaps = 28/198 (14%)

Query: 2647 VSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRD-SNPSESKQPILYKDI 2705
            + + +D +T S+T  +  +   +   IV   +     Y E     S P+E     +Y + 
Sbjct: 196  LKYGADIVTHSATKWIGGHGTTLGGIIVDSGKFPWKDYPEKFPQFSKPAEGYHGTIYNEA 255

Query: 2706 LRSLKLL---RTDLSVNISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQ 2762
              +L  +   RT+L  ++ S+   ISP + F   +L+  ++ +S+R E H    LK    
Sbjct: 256  YGNLAYIVHVRTELLRDLGSM---ISPFAAF---LLIQGVETLSLRGERHGQNALKLAKW 309

Query: 2763 LQV-----------LDVSAALSTSKEELDEEIGA--SIAIDDYMHYAS-----KIVGGTI 2804
            L+            L   +    +K+ L    G   S  + D  + A+     K+ G  +
Sbjct: 310  LEASPYVSWVSYPGLPSHSHHENAKKYLSNGFGGMLSFGVKDLPNAATETDPFKLSGAQV 369

Query: 2805 IDIPKLAVHMTTLQEEKT 2822
            +D  KLA ++  + + KT
Sbjct: 370  VDNLKLASNLANVGDSKT 387

>TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5.94
            YHR154W
          Length = 1015

 Score = 35.8 bits (81), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 55/125 (44%), Gaps = 15/125 (12%)

Query: 1483 RKYSFAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKLLKCTMGS 1542
            +KY FA    NI ++   +W       +   YI G+   A+ AK+K N   +LL  ++G 
Sbjct: 392  KKYDFAMRRPNILVTTNHSW-------LEDCYISGEKLDANVAKYKSNECNELLSASLGQ 444

Query: 1543 FYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLSSNREETI--EITGKVGSVKG---KF 1597
                 YG+      +F +  +++V D     + + +  EE      T K   V+    K+
Sbjct: 445  SVNCTYGKS---PLSFNLQPSSMVSDSCKEKSPIENKSEENFVNAETYKADDVQNHFLKY 501

Query: 1598 SDKLL 1602
            SDK L
Sbjct: 502  SDKFL 506

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 318,978,281
Number of extensions: 14699943
Number of successful extensions: 43917
Number of sequences better than 10.0: 49
Number of HSP's gapped: 44409
Number of HSP's successfully gapped: 64
Length of query: 2958
Length of database: 53,481,399
Length adjustment: 128
Effective length of query: 2830
Effective length of database: 38,804,151
Effective search space: 109815747330
Effective search space used: 109815747330
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 75 (33.5 bits)