Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_10.1708.259ON1416141668800.0
Skud_12.1548.259ON1417141757800.0
YLR086W (SMC4)8.259ON1418141756080.0
Smik_12.1458.259ON1418141756010.0
KAFR0B027108.259ON1416143938910.0
TDEL0F038608.259ON1399142738560.0
NCAS0B050008.259ON1409136437510.0
ZYRO0C01716g8.259ON1413142837490.0
SAKL0H17094g8.259ON1422144137120.0
Kpol_392.88.259ON1427143836510.0
KNAG0G020208.259ON1444144036170.0
NDAI0B019708.259ON1415142235790.0
Kwal_56.238258.259ON1396140034530.0
KLTH0G13750g8.259ON1399144834130.0
AGR089C8.259ON1370137433520.0
Ecym_43118.259ON1376136733380.0
TPHA0J007208.259ON1393137533180.0
TBLA0E044108.259ON1422145632430.0
KLLA0F19085g8.259ON1372137531000.0
CAGL0L12188g8.259ON1398143930920.0
TDEL0C009608.68ON12227614522e-44
YFL008W (SMC1)8.68ON12257494522e-44
NCAS0C040008.68ON12237834315e-42
KLTH0A02706g8.68ON12281703744e-35
Suva_6.528.68ON12641613564e-33
Skud_6.648.68ON12301613521e-32
TPHA0P003408.68ON12191653502e-32
Smik_6.718.68ON12284343493e-32
SAKL0B02288g8.68ON12281723484e-32
KAFR0C032008.68ON12231613466e-32
KNAG0G009108.68ON12264183342e-30
TBLA0G035308.68ON12321633342e-30
KLLA0D07502g8.68ON12431803323e-30
CAGL0F02079g8.68ON12231923243e-29
ZYRO0F03828g8.68ON12171613234e-29
TDEL0H026107.186ON11707232697e-23
NDAI0G033208.68ON12312132671e-22
ZYRO0D15642g7.186ON11701942501e-20
Kwal_23.50438.68ON12252292492e-20
CAGL0D05258g7.186ON11701912473e-20
KAFR0G029307.186ON11701912447e-20
SAKL0F07282g7.186ON11701912412e-19
Suva_6.1047.186ON11701912412e-19
KLTH0E04774g7.186ON11701982412e-19
Skud_6.1197.186ON11701912402e-19
YFR031C (SMC2)7.186ON11701912402e-19
NDAI0G020707.186ON11711912402e-19
Kwal_55.204217.186ON11701992393e-19
Kpol_1063.207.186ON11711912384e-19
AGL023W8.68ON12221932375e-19
NCAS0E019207.186ON11701842303e-18
KLLA0D16005g7.186ON11701912294e-18
Kpol_1011.58.68ON12211682251e-17
ZYRO0G21296g1.295ON12272432251e-17
Ecym_73038.68ON12221862232e-17
KAFR0A016101.295ON12274372108e-16
TDEL0D016201.295ON12232382072e-15
Kpol_1018.21.295ON12112172043e-15
Kwal_14.24351.295ON12471772044e-15
TBLA0D046107.186ON1174792018e-15
TPHA0C044407.186ON1170812001e-14
Smik_7.3467.186ON1170791991e-14
KNAG0L011607.186ON1170731991e-14
KLTH0H09966g1.295ON12241031982e-14
SAKL0D06116g1.295ON1229941972e-14
NCAS0A093301.295ON12271221964e-14
KNAG0B052301.295ON12251011954e-14
NDAI0G056301.295ON12291171929e-14
Smik_10.1671.295ON12292151892e-13
TBLA0C027401.295ON11191521873e-13
Suva_6.1491.295ON12302161856e-13
TPHA0I010901.295ON12161681856e-13
YJL074C (SMC3)1.295ON1230951848e-13
CAGL0H02805g1.295ON12191091831e-12
AAL182W1.295ON12311141784e-12
Skud_10.1701.295ON1230951767e-12
KLLA0A00286g1.295ON1224891695e-11
Ecym_43907.186ON1170941651e-10
AGR236W7.186ON1170731642e-10
Ecym_63221.295ON12321961534e-09
SAKL0B09526g7.101ON10991851231e-05
NCAS0I005707.101ON10952581222e-05
NDAI0A084507.101ON11192601212e-05
KNAG0L006307.101ON11081601184e-05
ZYRO0G01584g7.101ON10881831168e-05
TDEL0E013404.237ON1106851113e-04
KAFR0D013307.101ON10802041104e-04
KLLA0F07997g7.101ON11191841087e-04
Kwal_26.72047.101ON11171601060.001
Ecym_26257.101ON10971611030.003
ZYRO0B12122g4.237ON1109781030.003
AEL337C7.101ON10971861000.005
TBLA0E021907.101ON10891591000.006
NCAS0J013904.237ON109668970.015
KLTH0D02816g7.101ON109462960.015
TPHA0B008404.237ON111968960.017
CAGL0H05071g4.237ON111076960.019
YOL034W (SMC5)7.101ON1093166960.019
Skud_12.4684.237ON112068960.019
Suva_15.1337.101ON1092203960.020
Suva_10.5004.237ON111568960.020
YLR383W (SMC6)4.237ON111468950.021
Smik_12.4704.237ON111468950.022
TBLA0I028904.237ON1098181950.022
NDAI0J021804.237ON1108107950.023
Smik_15.1317.101ON1093178950.024
Skud_15.1217.101ON109362950.025
KNAG0B060104.237ON111768950.026
Kpol_1044.137.101ON110362940.027
TDEL0H034907.101ON110364940.033
TPHA0L006007.101ON111762930.035
KLLA0E05303g4.237ON109870920.051
TBLA0A053001.67ON70763910.070
Ecym_53444.237ON110263900.086
Kpol_483.104.237ON111884900.086
Kwal_26.93804.237ON1102157870.21
CAGL0F01155g7.101ON1105226870.23
SAKL0H03322g4.237ON111179860.28
TDEL0G028102.351ON109471850.34
AER044W4.237ON110363850.35
NCAS0B087001.67ON71572820.64
KLTH0D14080g4.237ON110273820.77
KAFR0A060404.237ON110268820.78
YLL057C (JLP1)na 1ON41282801.2
Suva_10.12na 1ON41281791.4
ZYRO0F17050g1.67ON71481746.7
AFR683C1.67ON67782737.9
KLTH0G15532g3.111aON41667728.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_10.170
         (1416 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...  2654   0.0  
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...  2231   0.0  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...  2164   0.0  
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...  2162   0.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....  1503   0.0  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....  1489   0.0  
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....  1449   0.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...  1448   0.0  
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...  1434   0.0  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...  1410   0.0  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....  1397   0.0  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....  1383   0.0  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...  1334   0.0  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...  1319   0.0  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...  1295   0.0  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...  1290   0.0  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...  1282   0.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...  1253   0.0  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...  1198   0.0  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...  1195   0.0  
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....   178   2e-44
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...   178   2e-44
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....   170   5e-42
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...   148   4e-35
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...   141   4e-33
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...   140   1e-32
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...   139   2e-32
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...   139   3e-32
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...   138   4e-32
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....   137   6e-32
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....   133   2e-30
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...   133   2e-30
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...   132   3e-30
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...   129   3e-29
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...   129   4e-29
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....   108   7e-23
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}             107   1e-22
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...   100   1e-20
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...   100   2e-20
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...   100   3e-20
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...    99   7e-20
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...    97   2e-19
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...    97   2e-19
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...    97   2e-19
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...    97   2e-19
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...    97   2e-19
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....    97   2e-19
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...    97   3e-19
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...    96   4e-19
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...    96   5e-19
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    93   3e-18
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    93   4e-18
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...    91   1e-17
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    91   1e-17
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...    91   2e-17
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    86   8e-16
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    84   2e-15
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    83   3e-15
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    83   4e-15
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    82   8e-15
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    82   1e-14
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...    81   1e-14
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    81   1e-14
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    81   2e-14
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...    80   2e-14
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    80   4e-14
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    80   4e-14
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    79   9e-14
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    77   2e-13
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    77   3e-13
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    76   6e-13
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    76   6e-13
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    75   8e-13
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    75   1e-12
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    73   4e-12
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    72   7e-12
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    70   5e-11
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...    68   1e-10
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...    68   2e-10
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    64   4e-09
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    52   1e-05
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    52   2e-05
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    51   2e-05
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    50   4e-05
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    49   8e-05
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    47   3e-04
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    47   4e-04
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    46   7e-04
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    45   0.001
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    44   0.003
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    44   0.003
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    43   0.005
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    43   0.006
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    42   0.015
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    42   0.015
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    42   0.017
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    42   0.019
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    42   0.019
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    42   0.019
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    42   0.020
Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR38...    42   0.020
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    41   0.021
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    41   0.022
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    41   0.022
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    41   0.023
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    41   0.024
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    41   0.025
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    41   0.026
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    41   0.027
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    41   0.033
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    40   0.035
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    40   0.051
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    40   0.070
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    39   0.086
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    39   0.086
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    38   0.21 
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    38   0.23 
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    38   0.28 
TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2....    37   0.34 
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    37   0.35 
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...    36   0.64 
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    36   0.77 
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    36   0.78 
YLL057C Chr12 complement(25756..26994) [1239 bp, 412 aa] {ON}  J...    35   1.2  
Suva_10.12 Chr10 complement(21728..22966) [1239 bp, 412 aa] {ON}...    35   1.4  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...    33   6.7  
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...    33   7.9  
KLTH0G15532g Chr7 (1358507..1359757) [1251 bp, 416 aa] {ON} cons...    32   8.6  

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 2654 bits (6880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1322/1416 (93%), Positives = 1322/1416 (93%)

Query: 1    MYDSPLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHT 60
            MYDSPLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHT
Sbjct: 1    MYDSPLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHT 60

Query: 61   PRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPSRGRDYKAYXXXXXXXXXXXXXX 120
            PRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPSRGRDYKAY              
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPSRGRDYKAYSQSPPRSPGRSPTR 120

Query: 121  XLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTSF 180
             LELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTSF
Sbjct: 121  RLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTSF 180

Query: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEYVV 240
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEYVV
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEYVV 240

Query: 241  DEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLI 300
            DEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLI
Sbjct: 241  DEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLI 300

Query: 301  LQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKENR 360
            LQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKENR
Sbjct: 301  LQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKENR 360

Query: 361  FEIVNREKNSLESGKETALEFLEKEXXXXXXXXXXXXXXXXXXNSKLASTLEKTSSLNKD 420
            FEIVNREKNSLESGKETALEFLEKE                  NSKLASTLEKTSSLNKD
Sbjct: 361  FEIVNREKNSLESGKETALEFLEKEKQLTLLKSKLFQFKLLQSNSKLASTLEKTSSLNKD 420

Query: 421  FESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTKNL 480
            FESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTKNL
Sbjct: 421  FESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTKNL 480

Query: 481  VNKMGKAEKILKSTNHSISXXXXXXXXXXXXXXXXXXXVKDLNQSLEEERRILDDIKLSL 540
            VNKMGKAEKILKSTNHSIS                   VKDLNQSLEEERRILDDIKLSL
Sbjct: 481  VNKMGKAEKILKSTNHSISEAEHLLEELHGEQTEHETEVKDLNQSLEEERRILDDIKLSL 540

Query: 541  KDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQXXXXXXXXXXXTQVKLKKNAEALEENI 600
            KDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQ           TQVKLKKNAEALEENI
Sbjct: 541  KDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQLAESELSLLEETQVKLKKNAEALEENI 600

Query: 601  AAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAMEAR 660
            AAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAMEAR
Sbjct: 601  AAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAMEAR 660

Query: 661  SSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVVVDT 720
            SSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVVVDT
Sbjct: 661  SSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVVVDT 720

Query: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSNAFY 780
            VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSNAFY
Sbjct: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSNAFY 780

Query: 781  SVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKNQS 840
            SVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKNQS
Sbjct: 781  SVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKNQS 840

Query: 841  DRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRXXXXX 900
            DRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILR     
Sbjct: 841  DRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRAEMEA 900

Query: 901  XXXXXXXXXXXXQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKERIK 960
                        QVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKERIK
Sbjct: 901  DSLASELALAEEQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKERIK 960

Query: 961  ALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAXXXXXXXXXXXXXXDVTKFQKQLKNVE 1020
            ALQDQIMKIGGTNLQIQNSKVESLSQRIDILVA              DVTKFQKQLKNVE
Sbjct: 961  ALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAKLKKVKSGIKKSVGDVTKFQKQLKNVE 1020

Query: 1021 RDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKID 1080
            RDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKID
Sbjct: 1021 RDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKID 1080

Query: 1081 EFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDNNQMDILDKE 1140
            EFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDNNQMDILDKE
Sbjct: 1081 EFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDNNQMDILDKE 1140

Query: 1141 GEDRQETNQEDISGEAKGETQGEEGDNDDRHCMNIDETSDEVSRGIPRLSEDELKELNIE 1200
            GEDRQETNQEDISGEAKGETQGEEGDNDDRHCMNIDETSDEVSRGIPRLSEDELKELNIE
Sbjct: 1141 GEDRQETNQEDISGEAKGETQGEEGDNDDRHCMNIDETSDEVSRGIPRLSEDELKELNIE 1200

Query: 1201 LLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKEQLEILKKK 1260
            LLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKEQLEILKKK
Sbjct: 1201 LLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKEQLEILKKK 1260

Query: 1261 RFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITN 1320
            RFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITN
Sbjct: 1261 RFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITN 1320

Query: 1321 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS 1380
            LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS
Sbjct: 1321 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS 1380

Query: 1381 LRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILNRN 1416
            LRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILNRN
Sbjct: 1381 LRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILNRN 1416

>Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR086W
            (REAL)
          Length = 1417

 Score = 2231 bits (5780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1109/1417 (78%), Positives = 1222/1417 (86%), Gaps = 1/1417 (0%)

Query: 1    MYDSPLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHT 60
            M DSPLSK+QKRK  EEPELS+N  + E+E + E + +RTEKTPDP+S SLESSYA+SHT
Sbjct: 1    MCDSPLSKKQKRKATEEPELSLNDTDAERESRVENRVNRTEKTPDPNSPSLESSYARSHT 60

Query: 61   PRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPSRGRDYKAYXXXXXXXXXXXXXX 120
            PRKLVLSSGENRYAFSQPTNSAT+SLHVPNLQPP+  SRGRDYKAY              
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKVSSRGRDYKAYSQSPPRSPGRSPAR 120

Query: 121  XLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTSF 180
             LELLQLSPVKNSRIELQKLYDSH+ SG+QQGRLFI+KLVL+NFKSYAG+QVVGPFHTSF
Sbjct: 121  RLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQVVGPFHTSF 180

Query: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEYVV 240
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FP+LQ+CSVAVHFEY++
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVAVHFEYII 240

Query: 241  DEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLI 300
            DEPSGTSRIDEEKPGLVITR+AF+NNSSKYYIN KES+YT+VTKLLK EGIDLDHKRFLI
Sbjct: 241  DEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLI 300

Query: 301  LQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKENR 360
            LQGEVENIAQMK KAEKESDDGLLEYLEDIIGTANYKPLIE+RLSQIE+LNEICLEK NR
Sbjct: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEICLEKANR 360

Query: 361  FEIVNREKNSLESGKETALEFLEKEXXXXXXXXXXXXXXXXXXNSKLASTLEKTSSLNKD 420
            FEIV+REKNSLESGKETALEFL+KE                  NSKLASTLEK SSLN++
Sbjct: 361  FEIVDREKNSLESGKETALEFLKKEKQLTLLKSKLLQFKMLQSNSKLASTLEKISSLNRE 420

Query: 421  FESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTKNL 480
            FESEKKKFQESL+EVDEV++Q K+IKDR+SS  S+EKTL+LEKRELE +RVSLEERTKNL
Sbjct: 421  FESEKKKFQESLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSLEERTKNL 480

Query: 481  VNKMGKAEKILKSTNHSISXXXXXXXXXXXXXXXXXXXVKDLNQSLEEERRILDDIKLSL 540
            VNKMGKAEK LKST HSIS                   +KDLNQSLEEER ILDDIKLSL
Sbjct: 481  VNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILDDIKLSL 540

Query: 541  KDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQXXXXXXXXXXXTQVKLKKNAEALEENI 600
            KDKTKDISA+II+HEK+ EPWDLQLQEKKSQIQ           T+ KLKKNAEALEE I
Sbjct: 541  KDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQLAESELSLLEETRAKLKKNAEALEEKI 600

Query: 601  AAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAMEAR 660
             +KK RKQELQG +LDL + LKSLIDGRSQGE+DF +AHLKLKEMQ ILNAHRQRAMEAR
Sbjct: 601  ISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQRAMEAR 660

Query: 661  SSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVVVDT 720
            SSLSKA+NK+ VLTALS+LQKSGRINGFHGRLGDLGVID++FDVAISTACPRLDDVVVDT
Sbjct: 661  SSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRLDDVVVDT 720

Query: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSNAFY 780
            VECAQHCIDYLRKNKLGYARFILLDRLR+FNLQP+ TPENVPRLFD+VKPKDPKFSNAFY
Sbjct: 721  VECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDPKFSNAFY 780

Query: 781  SVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKNQS 840
            SVL+DTLVARDLKQAN VAYGKRRFRVVT+DGKLIDISGTMSGGGNHV+KGLMR+G NQS
Sbjct: 781  SVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQS 840

Query: 841  DRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRXXXXX 900
            D ++DYTPEEV KIE+EL+EREKNFRVANDTVHEME+ELKKVRDQEPD+ESQI R     
Sbjct: 841  DEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEA 900

Query: 901  XXXXXXXXXXXXQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKERIK 960
                        Q KEAKMAYDK+VN+  Q+N++MK LEHLRGEY+DLQ+ET+TKKE+IK
Sbjct: 901  DSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRTKKEQIK 960

Query: 961  ALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAXXXXXXXXXXXXXXDVTKFQKQLKNVE 1020
             LQDQIMKIGGT L  QNSKV SL QRIDILV               DV K+QKQLKN E
Sbjct: 961  ILQDQIMKIGGTKLHTQNSKVGSLCQRIDILVIKLKKVKSGIKKSEGDVLKYQKQLKNFE 1020

Query: 1021 RDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKID 1080
            +D ELSSNELKVIEEK +Q KL L +NDT++T I NLKS+L++Q EQLKE++ EME  ID
Sbjct: 1021 QDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTEMEENID 1080

Query: 1081 EFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDNNQMDILDKE 1140
            EFKSLE+EMKNKLEKLNSLL +IK++IKQQ+KELN+LSIRDVTHTL +LDNNQMD+++  
Sbjct: 1081 EFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDNNQMDVVEDG 1140

Query: 1141 GEDRQETNQEDISGEAKGETQGEEGDND-DRHCMNIDETSDEVSRGIPRLSEDELKELNI 1199
             +D Q+ +Q+  SG    E   E+ D D + H MNIDE S E+SRGIP+L E+ELK+L+I
Sbjct: 1141 IKDEQDADQDKPSGIPDDEKIQEKDDADNNHHSMNIDEMSSEISRGIPKLCEEELKDLDI 1200

Query: 1200 ELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKEQLEILKK 1259
            ELLE DI  LTCYI+ T+VDIGVLEEY RRL EFKRRKLDLNQAVQKRDEVKEQLEILKK
Sbjct: 1201 ELLESDISGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQAVQKRDEVKEQLEILKK 1260

Query: 1260 KRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIT 1319
             RFDEFM GFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIT
Sbjct: 1261 NRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIT 1320

Query: 1320 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1379
            NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI
Sbjct: 1321 NLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1380

Query: 1380 SLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILNRN 1416
            SLRNNMFELAQQL+G+YKRDNRTKSTTVKNIDIL R+
Sbjct: 1381 SLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILKRD 1417

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 2164 bits (5608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1087/1417 (76%), Positives = 1213/1417 (85%), Gaps = 2/1417 (0%)

Query: 1    MYDSPLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHT 60
            M DSPLSKRQKRK+A+EPELS++ G+ E++ + E + + +E TP+PD  +LE+SY+KS+T
Sbjct: 1    MSDSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYT 60

Query: 61   PRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPSRGRDYKAYXXXXXXXXXXXXXX 120
            PRKLVLSSGENRYAFSQPTNS T+SLHVPNLQPP+  SRGRD+K+Y              
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSSRGRDHKSYSQSPPRSPGRSPTR 120

Query: 121  XLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTSF 180
             LELLQLSPVKNSR+ELQK+YD HQ S +QQ RLFI++LVLENFKSYAGKQVVGPFHTSF
Sbjct: 121  RLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTSF 180

Query: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEYVV 240
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FP+LQSCSVAVHF+YV+
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYVI 240

Query: 241  DEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLI 300
            DE SGTSRIDEEKPGL+ITRKAF+NNSSKYYIN KES+YT+VTKLLKNEGIDLDHKRFLI
Sbjct: 241  DESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLI 300

Query: 301  LQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKENR 360
            LQGEVENIAQMK KAEKESDDGLLEYLEDIIGTANYKPLIE+R+ QIE LNE+CLEKENR
Sbjct: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKENR 360

Query: 361  FEIVNREKNSLESGKETALEFLEKEXXXXXXXXXXXXXXXXXXNSKLASTLEKTSSLNKD 420
            FEIV+REKNSLESGKETALEFLEKE                  NSKLASTLEK SS NKD
Sbjct: 361  FEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKD 420

Query: 421  FESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTKNL 480
             E EK KFQESLK+VDE+++QRKEIKDR+SSC+S+EKTL LE+RELE TRVSLEERTKNL
Sbjct: 421  LEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNL 480

Query: 481  VNKMGKAEKILKSTNHSISXXXXXXXXXXXXXXXXXXXVKDLNQSLEEERRILDDIKLSL 540
            V+KM KAEK LKST HSIS                   +KDL Q LE+ER ILDDIKLSL
Sbjct: 481  VSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSL 540

Query: 541  KDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQXXXXXXXXXXXTQVKLKKNAEALEENI 600
            KDKTK+ISAEII+HEK+LEPWDLQLQEK+SQIQ           TQ KLKKN E LEE I
Sbjct: 541  KDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVETLEEKI 600

Query: 601  AAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAMEAR 660
             AKK  KQELQ  ILDLKK L SL D RSQGEK+F++AHLKLKEMQ +LNAHRQRAMEAR
Sbjct: 601  LAKKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEAR 660

Query: 661  SSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVVVDT 720
            SSLSKA+NKSKVLTALSRLQKSGRINGFHGRLGDLGVIDD+FDVAISTACPRLDDVVVDT
Sbjct: 661  SSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVVDT 720

Query: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSNAFY 780
            VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQP+ TPENVPRLFDLVKPK+PKFSNAFY
Sbjct: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAFY 780

Query: 781  SVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKNQS 840
            SVLRDTLVA++LKQANNVAYGK+RFRVVT+DGKLIDISGTMSGGGNHV KGLM++G NQS
Sbjct: 781  SVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQS 840

Query: 841  DRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRXXXXX 900
            D++DDYTPEEV+KIE ELSERE NFRVA+DTVHEME+ELKK+RD EPD+ESQI +     
Sbjct: 841  DKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEA 900

Query: 901  XXXXXXXXXXXXQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKERIK 960
                        QVKEA+MAY K+V+D AQLN +MK LE LRGEY+DLQ+ETKTKKE+IK
Sbjct: 901  DSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKIK 960

Query: 961  ALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAXXXXXXXXXXXXXXDVTKFQKQLKNVE 1020
             LQD+IMKIGG  LQ+QNSKVES+ Q++DILVA              DV KFQK L+N E
Sbjct: 961  GLQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSASKKSGGDVVKFQKLLQNSE 1020

Query: 1021 RDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKID 1080
            RD+ELSS+ELKVIEE+ +  KL L +NDT++   LNLK +L+EQSEQLKE++ +ME  I+
Sbjct: 1021 RDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLKEQMEDMEESIN 1080

Query: 1081 EFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDNNQMDILDKE 1140
            EFKS+E+EMKNKLEKLNSLLTYIKS+I QQEK LNELSIRDVTHTL +LD+N+MD + ++
Sbjct: 1081 EFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKMDSVKED 1140

Query: 1141 GEDRQETNQEDISGEAKGETQGEEGDN--DDRHCMNIDETSDEVSRGIPRLSEDELKELN 1198
             ++ QE +QE  S E + E++ ++ +   D+ H MNIDETSDEVSRGIPRLSEDEL+EL+
Sbjct: 1141 VKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDETSDEVSRGIPRLSEDELRELD 1200

Query: 1199 IELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKEQLEILK 1258
            +EL+E  I EL+ Y++ TNVDIGVLEEYARRLAEFKRRKLDLN AVQKRDEVKEQL ILK
Sbjct: 1201 VELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKRDEVKEQLGILK 1260

Query: 1259 KKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1318
            KKRFDEFM GFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI
Sbjct: 1261 KKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1320

Query: 1319 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1378
            TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV
Sbjct: 1321 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1380

Query: 1379 ISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILNR 1415
            ISLRNNMFELAQQLVGVYKRDNRTKSTT+KNIDILNR
Sbjct: 1381 ISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNR 1417

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 2162 bits (5601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1092/1417 (77%), Positives = 1200/1417 (84%), Gaps = 2/1417 (0%)

Query: 1    MYDSPLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHT 60
            M DSPLSKRQKRK  EEPELS++  +  QE +AEKQ DR+EKTPDP+S +LE+SYAKSHT
Sbjct: 1    MCDSPLSKRQKRKAVEEPELSLDDSDATQELQAEKQADRSEKTPDPNSPALETSYAKSHT 60

Query: 61   PRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPSRGRDYKAYXXXXXXXXXXXXXX 120
            PRKLVLSSGENRYAFSQPTNSAT+SLHVPNLQPP   SRGRDYKAY              
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGTSSRGRDYKAYSQSPPRSPGRSPTR 120

Query: 121  XLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTSF 180
             LELLQLSPVKNSR+ELQKLY+SHQ S +QQGRLFI++LVLENFKSYAG+QVVGPFHTSF
Sbjct: 121  RLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQVVGPFHTSF 180

Query: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEYVV 240
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FPNLQSCSVAVHFEYV+
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSVAVHFEYVI 240

Query: 241  DEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLI 300
            DE SGTSRIDEEKPGLVITRKAF+NNSSKYYINGKES+YT+VTKLLKNEGIDLDHKRFLI
Sbjct: 241  DESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLI 300

Query: 301  LQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKENR 360
            LQGEVENIAQMK KAEKESDDGLLEYLEDIIGTANYKPLIE++++QIE LNE+CLEKENR
Sbjct: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENR 360

Query: 361  FEIVNREKNSLESGKETALEFLEKEXXXXXXXXXXXXXXXXXXNSKLASTLEKTSSLNKD 420
            FEIV+REKNSLESGKETALEFL KE                  NSKLASTLEK SSLNKD
Sbjct: 361  FEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKD 420

Query: 421  FESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTKNL 480
            FE+EK KFQESLK+V+EV++QRKEIKDR+SS  S+EK L LE+RELE TRVSLEERTKNL
Sbjct: 421  FETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTKNL 480

Query: 481  VNKMGKAEKILKSTNHSISXXXXXXXXXXXXXXXXXXXVKDLNQSLEEERRILDDIKLSL 540
             NK+ K+E+  K T  SIS                   +KDLNQ LEEER +LD+IKLSL
Sbjct: 481  ANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIKLSL 540

Query: 541  KDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQXXXXXXXXXXXTQVKLKKNAEALEENI 600
            KDKTKDIS EIIQHEK+LEPWDLQLQEK+SQIQ           TQ KLKKN E +EE I
Sbjct: 541  KDKTKDISTEIIQHEKELEPWDLQLQEKESQIQLAESELSLLEETQSKLKKNVETMEEKI 600

Query: 601  AAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAMEAR 660
             A+KA KQELQ  IL+LKK L SL D RSQGE++FS+AHLKL+EMQ +LN HRQRAMEAR
Sbjct: 601  LARKAHKQELQDLILNLKKKLSSLRDERSQGEENFSSAHLKLEEMQKVLNTHRQRAMEAR 660

Query: 661  SSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVVVDT 720
            SSLS+A+NKSKVLTALS+LQKSGRINGFHGRLGDLG+ID++FDVAISTACPRLDDVVVDT
Sbjct: 661  SSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPRLDDVVVDT 720

Query: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSNAFY 780
            VECAQ CIDYLRKNKLGYARFILLDRLRQFNLQP+ TPENVPRLFDLVKPKDPKFSNAFY
Sbjct: 721  VECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKDPKFSNAFY 780

Query: 781  SVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKNQS 840
            SVLRDTLVAR LKQANNVAYG++RFRVVTIDGKLIDISGT+SGGGNHV KGLMR+G NQS
Sbjct: 781  SVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQS 840

Query: 841  DRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRXXXXX 900
            +++DDYTPEEVNKIE+ELSERE NFRVANDTVHEME ELK +RDQEP +ES+I +     
Sbjct: 841  NKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEMEA 900

Query: 901  XXXXXXXXXXXXQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKERIK 960
                        QVKEA++AY  +++D AQ+N IMK LE L+GE+DDLQ+ETKTKKE+IK
Sbjct: 901  DSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIK 960

Query: 961  ALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAXXXXXXXXXXXXXXDVTKFQKQLKNVE 1020
             LQ +IMKIGGT LQ+QNSKV SL QR+DILVA              DV KFQKQLKN E
Sbjct: 961  VLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAKLKKVKSGIKKSEGDVLKFQKQLKNSE 1020

Query: 1021 RDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKID 1080
            RD+ELSSNELK IEEK +  KLDL +ND  +T   NL+S+L+E+SEQLKE VAE E  ID
Sbjct: 1021 RDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRSELKEESEQLKEMVAETEENID 1080

Query: 1081 EFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDNNQMDILDKE 1140
            EFKSLE+EMKNKLEKLNSLL +IK +I QQEK L+ELSIRDVTHTL ILDNN MDI+  +
Sbjct: 1081 EFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEILDNNTMDIVKTD 1140

Query: 1141 GEDRQETNQEDISGEAKGE--TQGEEGDNDDRHCMNIDETSDEVSRGIPRLSEDELKELN 1198
             +  Q   +E  S E + E   Q EE   DD H M+IDETS+EV RGIPR SE+ELKEL+
Sbjct: 1141 NKIEQAVVKEKRSSETQDEKNIQEEERTCDDHHSMDIDETSNEVIRGIPRFSEEELKELD 1200

Query: 1199 IELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKEQLEILK 1258
            IELLE +I EL+ YID TNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVK Q+E+LK
Sbjct: 1201 IELLEKEISELSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLK 1260

Query: 1259 KKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1318
            KKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI
Sbjct: 1261 KKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1320

Query: 1319 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1378
            TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV
Sbjct: 1321 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1380

Query: 1379 ISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILNR 1415
            ISLRNNMFELAQQLVG+YKRDNRT+STTVKNIDILNR
Sbjct: 1381 ISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILNR 1417

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 1503 bits (3891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 803/1439 (55%), Positives = 1010/1439 (70%), Gaps = 49/1439 (3%)

Query: 1    MYDSPLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHT 60
            M  +PLSK+QK  + EE    I     EQ+      ND+T     P+  +  SS+ KSHT
Sbjct: 1    MSHTPLSKKQKVVSDEE---RITPNQNEQD------NDKTH----PEVTA--SSFLKSHT 45

Query: 61   PRKLVLSSGENRYAFSQPT----NSATSSLHVPNLQPP-EAPSRGRDYKAYXXXXXXXXX 115
            PRKL+L S +N+Y  SQP     +  +SSL VPNLQPP   PSRGRD KAY         
Sbjct: 46   PRKLLLGSADNKYVLSQPIISSSSHGSSSLQVPNLQPPLSQPSRGRDKKAYSQSPPRSPG 105

Query: 116  XXXXXXLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGP 175
                  LEL+QLSP+KN+RIELQKLY+S     + + RL+IDKLVL++FKSYAG Q+VGP
Sbjct: 106  RSPVRKLELIQLSPIKNNRIELQKLYNS---KNQNKVRLYIDKLVLQDFKSYAGTQIVGP 162

Query: 176  FHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVH 235
            F+TSFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRL DLIHKSE FPN+QSCSV VH
Sbjct: 163  FNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVH 222

Query: 236  FEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDH 295
            F+YV+DE  GTS+I E++  LV+ RKAF+NNSSKYYINGKESNYT+VT+LLK EGIDLDH
Sbjct: 223  FQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDH 282

Query: 296  KRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICL 355
            KRFLILQGEVENIAQMK+KAEKE DDGLLEYLEDIIGT+ YK LIED++ +IE LNEIC+
Sbjct: 283  KRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICV 342

Query: 356  EKENRFEIVNREKNSLESGKETALEFLEKEXXXXXXXXXXXXXXXXXXNSKLASTLEKTS 415
            EKE RFEIV  EKNSLES K+ ALEF+ KE                  N+KLA+TL+K S
Sbjct: 343  EKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKIS 402

Query: 416  SLNKDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEE 475
            +     + E+ K+++   E+D+   + +E  +++++  +QE+ L  +KRE +   VS+EE
Sbjct: 403  NFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEE 462

Query: 476  RTKNLVNKMGKAEKILKSTNHSISXXXXXXXXXXXXXXXXXXXVKDLNQSLEEERRILDD 535
            R KNL  K  KAEK L      I                      +L + L++ER  LDD
Sbjct: 463  RIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERSKLDD 522

Query: 536  IKLSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQXXXXXXXXXXXTQVKLKKNAEA 595
            IKLSLKDKTKDIS++I  +EKD+EPW  ++QEK+ QIQ           +Q KLK+   +
Sbjct: 523  IKLSLKDKTKDISSQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGS 582

Query: 596  LEENIAAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQR 655
            L+  I   +         I +LKK   SL    S GE + S A  K KEM+ ILN+HRQR
Sbjct: 583  LKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQR 642

Query: 656  AMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDD 715
            A++ARS+L  AENKS VL+AL+RLQKSGRINGFHGRLGDLGVI D +D+AISTAC RLDD
Sbjct: 643  AIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDD 702

Query: 716  VVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKF 775
            +VVD+VEC Q CI+YLRKNKLGYARFILLD+LR F L  + TPENV RLFDLV+P D KF
Sbjct: 703  IVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKF 762

Query: 776  SNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRI 835
            SNAFYSVLRDTLVA D++QAN VAYGKRR+RVVT+DGKLIDISGTM+GGG+HV KGLM++
Sbjct: 763  SNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKL 822

Query: 836  GKNQSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILR 895
              +  + ++ Y   +V KIE +L+ERE NF++A+DT+ EM  ELK+++D+EP++E +I +
Sbjct: 823  KNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAK 882

Query: 896  XXXXXXXXXXXXXXXXXQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTK 955
                             Q+KE +  Y   +N    L++    L+ LR E+  L+ ++++K
Sbjct: 883  LLMDVDSLNDQLNLKEQQLKELEKNYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSK 942

Query: 956  KERIKALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAXXXXXXXXXXXXXXDVTKFQKQ 1015
            KE+I  L+++IMKIGG  LQIQNSKV SL++RI I+ A              ++ K Q+ 
Sbjct: 943  KEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRL 1002

Query: 1016 LKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEM 1075
             K  E D     N+L+ ++     I+  L + + +   ILN K DL  Q E LKEK+ +M
Sbjct: 1003 FKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDM 1062

Query: 1076 EGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDN---- 1131
            E  ++E+KS E+E+KNKLEKLNSLL Y K DI+   +EL    +RDVT +L  + N    
Sbjct: 1063 EESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENAN 1122

Query: 1132 ---------NQMDI-------LDKEGEDRQETNQEDISGEAKGETQGEEGDNDDRHCMNI 1175
                     N +D+       +DK  +   E + ED   +++ E + +E D D    M++
Sbjct: 1123 NSVGVKQSSNNLDVSSSHTPNVDKHDD---EISMEDADNDSQNEIEEKEQDAD---IMDL 1176

Query: 1176 DETSDEVSRGIPRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKR 1235
            D  ++EVS+GIP+L++D+LK ++++ LE +I +L  Y++ +N DI +LEEY RRL EFK+
Sbjct: 1177 DNVTEEVSKGIPKLTDDDLKSIDLDSLESEINQLQDYVENSNADIELLEEYIRRLEEFKK 1236

Query: 1236 RKLDLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVD 1295
            RKLDLN  V +RDEV+++LE LKK R DEFM GF+IIS+TLKEMYQMITMGGNAELELVD
Sbjct: 1237 RKLDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVD 1296

Query: 1296 SLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1355
            SLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL
Sbjct: 1297 SLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1356

Query: 1356 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILN 1414
            DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG+YKR N T+S T+KN DILN
Sbjct: 1357 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILN 1415

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 1489 bits (3856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 782/1427 (54%), Positives = 1005/1427 (70%), Gaps = 41/1427 (2%)

Query: 1    MYDSPLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHT 60
            M D+PL+KRQ+    E  E    +G              + K+P    L+  S+   SHT
Sbjct: 1    MPDTPLTKRQRVNDNESREFEAVNG--------------STKSP----LTSNSNSTISHT 42

Query: 61   PRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPSRGRDYKAYXXXXXXXXXXXXXX 120
            P+KLV+ + ++  + SQP  S +SSL  P+LQ P + SRGR+ + Y              
Sbjct: 43   PKKLVIGTNDDTTSQSQPIVS-SSSLQAPSLQHPNSSSRGREQRTYSQSPPRSPGRSPTR 101

Query: 121  XLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTSF 180
             LEL+++SPVK +R+ELQ+LYD+ Q S     RL I+KLVL++FKSYAG+QVVGPFH+SF
Sbjct: 102  KLELIKISPVKKNRLELQRLYDAEQ-SQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSF 160

Query: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEYVV 240
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIH SE  PNL+SCSV VHF+YVV
Sbjct: 161  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVV 220

Query: 241  DEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLI 300
            DEP GT+RIDEEKP LV+TRKAF+NNSSKYY+N KESNYT+VT+LLK EGIDLDHKRFLI
Sbjct: 221  DEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLI 280

Query: 301  LQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKENR 360
            LQGEVENIAQM+ KAEKE +DGLLEYLEDI GTA YKP IE  L +IE LNE C+EKENR
Sbjct: 281  LQGEVENIAQMRPKAEKEGEDGLLEYLEDITGTAKYKPQIETILQEIEVLNESCIEKENR 340

Query: 361  FEIVNREKNSLESGKETALEFLEKEXXXXXXXXXXXXXXXXXXNSKLASTLEKTSSLNKD 420
            F IV++EK+SLE+GK+ ALEFLEKE                  + KL STL+K+S L   
Sbjct: 341  FHIVDQEKSSLETGKDEALEFLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKSSKLKGQ 400

Query: 421  FESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTKNL 480
             + E +K+ E+LKEVD ++ + K++  R+ + A +EK L  +KR L+  RV++EE+ K++
Sbjct: 401  LDQENEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSV 460

Query: 481  VNKMGKAEKILKSTNHSISXXXXXXXXXXXXXXXXXXXVKDLNQSLEEERRILDDIKLSL 540
              K  KAEK+LKS  HS++                   ++DLNQ L  ER  L+D+K+SL
Sbjct: 461  NQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISL 520

Query: 541  KDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQXXXXXXXXXXXTQVKLKKNAEALEENI 600
            K+KT +ISA I Q+EKDLEPWD QLQ+K+++IQ           T  ++ K+ E L+  I
Sbjct: 521  KEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEI 580

Query: 601  AAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAMEAR 660
            A     K   +  I +LK+    +         + S+A  +LK+M  IL A RQR ++AR
Sbjct: 581  ARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDAR 640

Query: 661  SSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVVVDT 720
            ++ S A+NKS VLTAL++LQKSGRI+GFHGRLGDLGVID+ +DVAISTACPRL+D+VV++
Sbjct: 641  AAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVES 700

Query: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSNAFY 780
            VEC Q CI+YLRKNKLGYARFILLD+LR+F+   + TPENVPRLFDLVKPKD KF  AFY
Sbjct: 701  VECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFY 760

Query: 781  SVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKNQS 840
            SVLRDTL A+ L QAN VAYGK+RFRVV++DGKLIDISGTMSGGG+HVV+GLMR+ +N S
Sbjct: 761  SVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNS 820

Query: 841  DRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRXXXXX 900
               D ++PEEV ++ENEL+E+EK+F++A+DT  EME +LKK++D+ P+++ ++ +     
Sbjct: 821  YSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMET 880

Query: 901  XXXXXXXXXXXXQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKERIK 960
                         + E   A  K+     +       ++ L+ E   L  +T T +++I 
Sbjct: 881  ESWMSELKLKEKLLLERLEAQKKATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIA 940

Query: 961  ALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAXXXXXXXXXXXXXXDVTKFQKQLKNVE 1020
             L+D+IM+IGG+ LQIQNSKV S  QR++IL +              ++ K  K + N +
Sbjct: 941  VLKDKIMEIGGSELQIQNSKVTSTIQRMEILTSKQKKGKASIKKAENELKKSAKIVGNTQ 1000

Query: 1021 RDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKID 1080
            +D++L S E+  ++E ++ ++  L   +  V    +L  ++ E+ +QLK+++A+ME    
Sbjct: 1001 KDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFT 1060

Query: 1081 EFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDN--------- 1131
            EFKSL++E+ +KLEKLN+LL +I  +++Q E +LN L IRDVT TL +LD          
Sbjct: 1061 EFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNNSKM 1120

Query: 1132 -NQMDILDKEGED--RQETNQEDISGEAKGETQGEEGDNDDRHCMNIDETSDEVSRGIPR 1188
             N++     EG D  RQE  + D+S E       EE  ND+   M +DE   E+  G+PR
Sbjct: 1121 PNELQEKRTEGADATRQEGEESDVSME-------EEKSNDE--VMEVDEKPHELENGLPR 1171

Query: 1189 LSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRD 1248
            +SE ELK L++E L   I +L  Y+D+ NVD+ +LEEYA+RLAE KRRK+DLN+AV +RD
Sbjct: 1172 VSEAELKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERD 1231

Query: 1249 EVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV 1308
             ++E+L  LKK+RFDEFM GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV
Sbjct: 1232 AMREKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV 1291

Query: 1309 MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1368
            MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK
Sbjct: 1292 MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1351

Query: 1369 ERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILNR 1415
            ERTKNAQFIVISLRNNMFELAQQLVG+YK  N TKS ++KN DILNR
Sbjct: 1352 ERTKNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILNR 1398

>NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8.259
            YLR086W
          Length = 1409

 Score = 1449 bits (3751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 773/1364 (56%), Positives = 972/1364 (71%), Gaps = 16/1364 (1%)

Query: 56   AKSHTPRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPS-RGR-DYKAYXXXXXXX 113
            +KSHTPRKL+L   +NRYA     + ++SS  VP LQPP++ S RGR D K+Y       
Sbjct: 51   SKSHTPRKLILGQNDNRYA-FSQPSVSSSSFQVPTLQPPDSSSSRGRKDIKSYSQSPPRS 109

Query: 114  XXXXXXXXLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVV 173
                    LEL+QLSPVKN+RI+L++LYD+H    +++ RLFI+KL L NFKSYAG+QVV
Sbjct: 110  PGRSPKRRLELIQLSPVKNNRIKLRELYDAHNSQSKKE-RLFINKLTLNNFKSYAGQQVV 168

Query: 174  GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVA 233
            GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE+FP+L SCSV 
Sbjct: 169  GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVD 228

Query: 234  VHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDL 293
            V F Y +DE  G ++I E KP LVI+RKAF+NNSSKYYINGKESNYT VTKLLK EGIDL
Sbjct: 229  VEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDL 288

Query: 294  DHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEI 353
            DHKRFLILQGEVENIAQMK KAEKESDDGLLEYLEDIIGT+ YK LIE  L +IE+LNEI
Sbjct: 289  DHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEI 348

Query: 354  CLEKENRFEIVNREKNSLESGKETALEFLEKEXXXXXXXXXXXXXXXXXXNSKLASTLEK 413
            C+EKENRFEIV+REKNSLESGK  ALEFLEKE                  NSKL +TL+K
Sbjct: 349  CIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQK 408

Query: 414  TSSLNKDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSL 473
             S+LN+++  EK K Q    E++  +    E + ++     +EK     KR LE   VSL
Sbjct: 409  ISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSL 468

Query: 474  EERTKNLVNKMGKAEKILKSTNHSISXXXXXXXXXXXXXXXXXXXVKDLNQSLEEERRIL 533
            +E+ KNL  K  K EKI+ +T  +IS                   ++ LNQ L+ ER  L
Sbjct: 469  DEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESL 528

Query: 534  DDIKLSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQXXXXXXXXXXXTQVKLKKNA 593
            + +KL LK+KT  IS EI+ HE DLEPW++++QEKK++IQ            QVKLK + 
Sbjct: 529  EAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDI 588

Query: 594  EALEENIAAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHR 653
            + L + ++ + A K + +  +++LKK   S+    S GE + +    KLKEM+ +LN  R
Sbjct: 589  KVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQR 648

Query: 654  QRAMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRL 713
            QRA EAR +L+  +N+ KVLTAL +LQKSGRI GFHGRLGDLG ID+ +DVA+STACPRL
Sbjct: 649  QRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRL 708

Query: 714  DDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDP 773
            DD+VV+TVEC Q CI+YLRKNKLGYARFILLD+LR FN   + TP+NVPRLFDL+KPKD 
Sbjct: 709  DDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDS 768

Query: 774  KFSNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLM 833
            KF  AFYSVLRDTLVA+DLKQAN VAYG+RR+RVVT+DGKLID+SGTMSGGGNHV KGLM
Sbjct: 769  KFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLM 828

Query: 834  RIGKNQSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQI 893
             + +   +  DDY PE+V +IE +LS++EKNF +AN+  +EME EL+K+ +++P++E +I
Sbjct: 829  MLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEI 888

Query: 894  LRXXXXXXXXXXXXXXXXXQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETK 953
             +                 Q++E     +  + D  +L   ++ L+ L+ E+  LQ +TK
Sbjct: 889  SKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTK 948

Query: 954  TKKERIKALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAXXXXXXXXXXXXXXDVTKFQ 1013
             KK++I +L+++IMKIGG  LQ+QNSKV S+ QRIDIL A              ++ K +
Sbjct: 949  AKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAK 1008

Query: 1014 KQLKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVA 1073
            K L   + DI L ++++K I E+ ++I   L   D  +      K  L+++ ++LK+KV 
Sbjct: 1009 KTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVV 1068

Query: 1074 EMEGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDNNQ 1133
            ++E  I+EFKS E+E+ NKLEKLN LL +IK+ IK  E  L++L++R +   L+ LD   
Sbjct: 1069 DLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALD--- 1125

Query: 1134 MDILDKEGEDRQETNQEDISGEAKGETQGEEGDN---DDRHCMNIDETSDEVSRGIPRLS 1190
                  E  + +  N   +S E   +  G E  N    D   M+ID  ++ +S G+P LS
Sbjct: 1126 ------EESEAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILS 1179

Query: 1191 EDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEV 1250
            +DEL  L+I L+E ++ +L  YI++T+ +I VLEEY +RL EFK RKLDLN AV KR+ V
Sbjct: 1180 DDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETV 1239

Query: 1251 KEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMP 1310
            ++QLE LKK R++EFM GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMP
Sbjct: 1240 RKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMP 1299

Query: 1311 PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1370
            PKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER
Sbjct: 1300 PKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1359

Query: 1371 TKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILN 1414
            TKNAQFIVISLRNNMFELAQQLVG+YK +NRT S T+KN +ILN
Sbjct: 1360 TKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILN 1403

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 1448 bits (3749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 800/1428 (56%), Positives = 1026/1428 (71%), Gaps = 36/1428 (2%)

Query: 3    DSPLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHTPR 62
            D  LSKRQK          +N  +G+  P  +   D+ E    P + S ++++A + TPR
Sbjct: 4    DDSLSKRQKVD-------GLNQIDGKH-PTVDL--DQGENLSLPTTSSSQNTFAHAKTPR 53

Query: 63   KLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPSRGRDYKAYXXXXXXXXXXXXXXXL 122
            KLV+ +G+NRYA S   + ++SSL VP LQPP   SRGR  K Y               L
Sbjct: 54   KLVVGNGDNRYAHSS-QSISSSSLQVPPLQPPATSSRGRGSKTYSQSPPRSPGRSPTRKL 112

Query: 123  ELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTSFSA 182
            EL+Q+SP+KNSR+ELQK+YD+ Q    +  RL ID+L+L++FKSYAG+QVVGPF+TSFSA
Sbjct: 113  ELIQISPLKNSRLELQKIYDAQQNQA-RHTRLCIDQLILQDFKSYAGRQVVGPFNTSFSA 171

Query: 183  VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEYVVDE 242
            VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEE+P+L SCSV VHF+YV+DE
Sbjct: 172  VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFKYVIDE 231

Query: 243  PSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQ 302
            PSG +RIDEEKP LV+TRKAFRNN+SKYY+N +E+NY +VTKLLK EG+DLDHKRFLILQ
Sbjct: 232  PSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQ 291

Query: 303  GEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKENRFE 362
            GEVENIAQMKSKAE+E +DGLLEYLEDIIGTA YKPLIE  L+ +E+LN+IC+EKENRF+
Sbjct: 292  GEVENIAQMKSKAEREGEDGLLEYLEDIIGTAKYKPLIEKNLADMESLNDICIEKENRFQ 351

Query: 363  IVNREKNSLESGKETALEFLEKEXXXXXXXXXXXXXXXXXXNSKLASTLEKTSSLNKDFE 422
            IV+REKNSLE+GKE AL FLE E                  N KL +TL+K ++LN+  E
Sbjct: 352  IVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLE 411

Query: 423  SEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTKNLVN 482
             E  K     KE+D++ +   E++ ++ +C ++EK L  +KREL+   V  EE+ KN   
Sbjct: 412  KESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEK 471

Query: 483  KMGKAEKILKSTNHSISXXXXXXXXXXXXXXXXXXXVKDLNQSLEEERRILDDIKLSLKD 542
            K  KAEK L S + SIS                   +K+LN+  E E+  L+ IK SLKD
Sbjct: 472  KRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKD 531

Query: 543  KTKDISAEIIQHEKDLEPWDLQLQEKKSQIQXXXXXXXXXXXTQVKLKKNAEALEENIAA 602
            KT  IS EI Q EK+LEPW+ QLQEKK+QIQ            + KL +  +  ++ I  
Sbjct: 532  KTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIET 591

Query: 603  KKARKQELQGF--ILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAMEAR 660
            +K  +Q LQG   +  L    KS+ +  S GEK+   A ++LKEMQ ILN  RQ+A++AR
Sbjct: 592  RK--QQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKALDAR 649

Query: 661  SSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVVVDT 720
            S+LS AENKSKVLTALSRLQKSGRI+GFHGRLGDLGVID+ +DVAISTACPRL+D+VV+T
Sbjct: 650  SALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVET 709

Query: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSNAFY 780
            VEC Q CI+YLRKNKLGYARFILLD+LR+FNL  ++TPE+VPRLFDL+ PKDPKFS+AF+
Sbjct: 710  VECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSSAFF 769

Query: 781  SVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKNQS 840
            SVL +TLVA DLKQAN VAYGK+RFRVVT+DG LIDISGTMSGGG+ V +GLM+I +N++
Sbjct: 770  SVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRNKT 829

Query: 841  DRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRXXXXX 900
            + ++ Y+ EEV ++E  L EREKNF+VA+DT+++ME++LK ++++EP +E+ I +     
Sbjct: 830  EDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEI 889

Query: 901  XXXXXXXXXXXXQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKERIK 960
                        Q+ E++ AY  + ++  +L + ++ ++ L+ E+  +Q +TK+KK RI+
Sbjct: 890  ESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIE 949

Query: 961  ALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAXXXXXXXXXXXXXXDVTKFQKQLKNVE 1020
             L+++IM+IGG  L+IQ+SKV+S+ QRIDI+V+              ++ K  K      
Sbjct: 950  TLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETS 1009

Query: 1021 RDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKID 1080
            RD+E  + E++ ++   E ++  L K    VT + + K  L E+S  L++K+ ++   I 
Sbjct: 1010 RDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDINEDIA 1069

Query: 1081 EFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLIL---DNNQMDIL 1137
             FKS EMEMKN+LEKLNSL  ++K +IK  E++L +L IRDVT  L  L    NN  D  
Sbjct: 1070 IFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDESNNASDPS 1129

Query: 1138 DKEGEDRQETNQEDISGEAKGETQG-----------EEGDNDDRHCMNIDETSDEVSRGI 1186
            +    D +E+  E   GE K E +            ++GDN     M++++  +   RG+
Sbjct: 1130 ENPVSDVEES--ESSVGEGKDENKDLDAQDQVQDAEKQGDNQ----MDVEDGGEYSDRGL 1183

Query: 1187 PRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQK 1246
             + SEDEL E+ IE LE +I +L  ++DA+N DI VLEEYARRL EFK R+LDLNQAV++
Sbjct: 1184 TQFSEDELHEIEIEELEKEIEDLQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAVEE 1243

Query: 1247 RDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1306
            R++VKE+L+ LKKKRFDEFM GF IISMTLKEMYQMITMGGNAELELVD+LDPFSEGVTF
Sbjct: 1244 RNKVKEKLDELKKKRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVTF 1303

Query: 1307 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1366
            SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY
Sbjct: 1304 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1363

Query: 1367 IKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILN 1414
            IKERTKNAQFIVISLRNNMFELAQQLVG+YKRDN+TKS T+KNID ++
Sbjct: 1364 IKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFVS 1411

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 1434 bits (3712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 787/1441 (54%), Positives = 995/1441 (69%), Gaps = 48/1441 (3%)

Query: 1    MYDSPLSKRQKRKTAEEPELSINHG-------NGEQEPKAEKQNDRTEKTPDPDSLSLES 53
            M DSPL+K+QK +T +  ++  N         +G      +    R ++ P P       
Sbjct: 1    MSDSPLAKKQKTRTDDRGQIQSNPTVSPIPPVSGSSLMAVKSSPTRQDRLPSP------- 53

Query: 54   SYAKSHTPRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEA-PSRGRDY--KAYXXXX 110
                  TPRKLVL S E +YA+SQP+ S++ S  VPNLQPP    SRGR +  ++     
Sbjct: 54   ------TPRKLVLGSPEKKYAYSQPSTSSSLS--VPNLQPPNVDGSRGRRFYSQSPPRSP 105

Query: 111  XXXXXXXXXXXLELLQLSPVKNSRIELQKLYDSHQPSGEQQ-GRLFIDKLVLENFKSYAG 169
                       LEL+QLSPVKN+R ELQK+YD     G Q   RL IDKL L NFKSYAG
Sbjct: 106  HRSPNRSPTRRLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAG 165

Query: 170  KQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQS 229
             Q++GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LSDLIHKSE +PNL+S
Sbjct: 166  TQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLES 225

Query: 230  CSVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNE 289
            CSV +HF YVVDE  GT+R D+EKP +VITRKAFRNNSSKYYI+GKESNYT+VT+LL+++
Sbjct: 226  CSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQ 285

Query: 290  GIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIET 349
            GIDLDHKRFLILQGEVE+I+QMK KAE+ESDDGLLEYLEDIIGTA YK  IE  L +I+T
Sbjct: 286  GIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDT 345

Query: 350  LNEICLEKENRFEIVNREKNSLESGKETALEFLEKEXXXXXXXXXXXXXXXXXXNSKLAS 409
            LN++C+EKENRFE+V +EKNSLESGK+ ALEFLEKE                    KL+ 
Sbjct: 346  LNDVCVEKENRFELVEKEKNSLESGKDEALEFLEKEKSLTLLKSKLAQYHIWQDQRKLSE 405

Query: 410  TLEKTSSLNKDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELEST 469
            TL K S LN+    EK K+ +  +EV ++  +  + K +M     + K L  ++R ++  
Sbjct: 406  TLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDRE 465

Query: 470  RVSLEERTKNLVNKMGKAEKILKSTNHSISXXXXXXXXXXXXXXXXXXXVKDLNQSLEEE 529
            + S+EE+ +NL  K  KAEK+LKST +S++                   +  LN+SL EE
Sbjct: 466  KTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEE 525

Query: 530  RRILDDIKLSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQXXXXXXXXXXXTQVKL 589
            R  LD+IKLSL+DKT +ISAEI  HE+DLEPW+ QLQEKKSQ++           ++ K 
Sbjct: 526  RSKLDEIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKK 585

Query: 590  KKNAEALEENIAAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTIL 649
             +N   L+  I A   +    +  I  L+    +++     GEK+  +A  KL EM+ +L
Sbjct: 586  VQNIIQLKTEIEAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVL 645

Query: 650  NAHRQRAMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTA 709
             +HRQRAMEARS+LS  ENK+KVL+AL RLQ+SGRI GFHGRLGDLG IDD +DVAISTA
Sbjct: 646  ISHRQRAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTA 705

Query: 710  CPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVK 769
            CPRLDD+VVD VEC Q CI++LRKNKLGYARFI+LD+LR+FNL P+ TPE VPRLFDLV+
Sbjct: 706  CPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVR 765

Query: 770  PKDPKFSNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVV 829
             K+ KF  AFYSVLRDTLV  DLKQAN VAYGKRRFRVVT+DGKLID SGT+SGGG HV+
Sbjct: 766  SKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVM 825

Query: 830  KGLMRIGKNQSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDM 889
            KGLM   K++      YTPEEV  IE EL+EREKNF +A +T H+ME+ LKK +D+EP++
Sbjct: 826  KGLM---KSKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEI 882

Query: 890  ESQILRXXXXXXXXXXXXXXXXXQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQ 949
            E +I +                 Q+KE +   D    +  +L      L+ L  EYD+++
Sbjct: 883  EVEIAKRRLDIESSSTELKLKQEQLKELETDRDGGSVEDRELADAESKLQVLSEEYDEIE 942

Query: 950  AETKTKKERIKALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAXXXXXXXXXXXXXXDV 1009
             ETK K++ I +L+++IMKIGGT LQ+QNSKV S++++I+I+ +              D+
Sbjct: 943  NETKNKQQLINSLKEKIMKIGGTKLQLQNSKVNSINEQINIISSKQKKDRTATKKAENDL 1002

Query: 1010 TKFQKQLKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLK 1069
             + + Q +    DIE  + E+  I   + +++  + K DT +    +LK ++EE+ E++K
Sbjct: 1003 KRLENQCREASNDIESCNLEISKISVLNTELEAKIYKLDTSLNETESLKEEVEEEFERVK 1062

Query: 1070 EKVAEMEGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLIL 1129
              + E      +FKS+E+E+ N+LEKLN L ++IK +IK  + ELN L IRD+T TL  L
Sbjct: 1063 TNLEEKTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQAL 1122

Query: 1130 DNNQM--------DILDKEGEDRQ-----ETNQEDISGEAKGE---TQGEEGDNDDRHCM 1173
            +  ++        ++ D+E +  Q     + N  DI  E   E    Q  +G+ D    M
Sbjct: 1123 NEGKLPEENEDDFEVQDEEVQREQREMSSDPNAMDIDEEQAAEQFQVQQTDGEID---SM 1179

Query: 1174 NIDETSDEVSRGIPRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEF 1233
            +IDE  +E S G+P+ SE +L+ + IE +E  I EL  Y+D  +VDI VLEEYARRLAE+
Sbjct: 1180 DIDEYENETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEY 1239

Query: 1234 KRRKLDLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELEL 1293
            K+RKLDLNQAV KRDEV++  E LKKKR D+FM GF+IISMTLKEMYQMITMGGNAELEL
Sbjct: 1240 KKRKLDLNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELEL 1299

Query: 1294 VDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1353
            VDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDA
Sbjct: 1300 VDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDA 1359

Query: 1354 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDIL 1413
            ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG+YK +N T+STT++NIDIL
Sbjct: 1360 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDIL 1419

Query: 1414 N 1414
            N
Sbjct: 1420 N 1420

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 1410 bits (3651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 769/1438 (53%), Positives = 993/1438 (69%), Gaps = 33/1438 (2%)

Query: 1    MYDSPLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHT 60
            M  +PLSKR K   A      ++H + +Q  +  +Q  +   T   D+ ++     KS T
Sbjct: 1    MPKTPLSKRPKLVEANLNANELDHNDDDQ--RYNRQEIKVSPTTQ-DAAAVSHLNFKSQT 57

Query: 61   PRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPP-EAPSRGRDYKAYXXXX----XXXXX 115
            P+KL+L   ++           +SSL  P+L PP E+ SRGR  + Y             
Sbjct: 58   PKKLILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESSSRGRTARTYSQSPPRSPARSPA 117

Query: 116  XXXXXXLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGP 175
                  LEL+QLSPVKNSRI LQK+Y+S     +Q  RL IDKLVL +FKSYAG QVVGP
Sbjct: 118  RSPTRKLELIQLSPVKNSRIALQKIYESKNE--KQIERLCIDKLVLHDFKSYAGTQVVGP 175

Query: 176  FHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVH 235
            FH+SFSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQDRLSDLIHKSE FP+L+SCSV VH
Sbjct: 176  FHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSVEVH 235

Query: 236  FEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDH 295
            FEYV+D+P GT+ I+  K  LVITRKAF+NN+SKYYINGKESNYT VTKLLK+EGIDLDH
Sbjct: 236  FEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDH 295

Query: 296  KRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICL 355
             RFLILQGEVENIAQMK KAE + DDGLLEYLEDIIGTA YKPLIE +  +IE LNEIC+
Sbjct: 296  NRFLILQGEVENIAQMKPKAENDGDDGLLEYLEDIIGTAKYKPLIEKKFEEIEALNEICI 355

Query: 356  EKENRFEIVNREKNSLESGKETALEFLEKEXXXXXXXXXXXXXXXXXXNSKLASTLEKTS 415
            EKENRFEIV+REK SLESGK+ ALEFLEKE                  N KL++TLEK S
Sbjct: 356  EKENRFEIVDREKASLESGKDEALEFLEKEKELTLVKSKLYQYKLWQDNKKLSTTLEKLS 415

Query: 416  SLNKDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEE 475
            ++ ++FE  KKK   +  +++E+     E+   + +   QEK L ++KR  ++ RVSLEE
Sbjct: 416  NIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERVSLEE 475

Query: 476  RTKNLVNKMGKAEKILKSTNHSISXXXXXXXXXXXXXXXXXXXVKDLNQSLEEERRILDD 535
            + KN++ K  K EK L+  N +IS                   + +LN  L+ ER +L++
Sbjct: 476  QRKNIMKKKKKMEKELEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIERGLLEE 535

Query: 536  IKLSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQXXXXXXXXXXXTQVKLKKNAEA 595
            IK+SLKDKT + S EI QHEK+LEPW+LQLQ KKSQIQ            +VKL+ + E 
Sbjct: 536  IKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLENDIEN 595

Query: 596  LEENIAAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQR 655
            L   I+ K   K   +  I  L+  L  +    S G+ +++ A  KL+EM+ +LN HRQ+
Sbjct: 596  LNSLISVKIEEKISREKEIGSLRNELNRITKEVSIGDTEYTNAKEKLREMKAVLNQHRQK 655

Query: 656  AMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDD 715
            A++AR+SLS  ENK++VL +L RLQKSGRI+GF+GRLGDLG IDD +D+AISTACPRL+D
Sbjct: 656  AIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTACPRLND 715

Query: 716  VVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKF 775
            +VV+TVEC Q CI+YLRKNKLGYARFILL++LR F++  + TP NVPRLFDLV   DPKF
Sbjct: 716  LVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVISSDPKF 775

Query: 776  SNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRI 835
              AFYSVLRDTLV  +LK AN VAYG +RFRVVT+ G+LID+SGTMSGGG    +GLM++
Sbjct: 776  LPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVSGTMSGGGTQTSRGLMKL 835

Query: 836  GKNQSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILR 895
             K+ +     YT E+V KIE EL+ REKNF +AN+T  EME EL++++D++PD+E +I +
Sbjct: 836  TKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVELEISK 895

Query: 896  XXXXXXXXXXXXXXXXXQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTK 955
                             Q+ E + + D+ +++  +L+ +   L  L+ +Y  LQ ETK+K
Sbjct: 896  FELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQLETKSK 955

Query: 956  KERIKALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAXXXXXXXXXXXXXXDVTKFQKQ 1015
            K+RIK L+D+IMK+GG  LQ+Q+SKV+S+ Q+ DIL                ++ +  K+
Sbjct: 956  KDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDILNGKHKKDKNDLKKAETELKRLSKK 1015

Query: 1016 LKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEM 1075
                  D+  S+++L+  + +  +I   L + +T +  +   + +  + SE LK+++ E 
Sbjct: 1016 QSECSTDLLTSTDKLENTDGQLSKISKSLSETETLLHELEFSREESLQNSENLKDQLKEF 1075

Query: 1076 EGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDNNQMD 1135
            E  ++ FK  ++E +NK EKLN+LL +IK DI+  + EL  L IRD+THTL  LDN  +D
Sbjct: 1076 EENLNSFKVFQLEHQNKEEKLNNLLNFIKKDIRSTDSELQSLKIRDITHTLQELDNGNID 1135

Query: 1136 ILDKEGEDRQETNQED--ISGEAK---GETQGEEG------------DNDDRHCMNIDET 1178
                  +D ++ + +D  +S  A    G ++  EG            D ++   M IDE 
Sbjct: 1136 ------QDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPDANNDLEMEIDED 1189

Query: 1179 SDEVSRGIPRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKL 1238
            ++E+S+GIPR+SEDE K +++E LE    +L  YID  NV+I VLEEYARR+AE+KRRKL
Sbjct: 1190 NNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVAEYKRRKL 1249

Query: 1239 DLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLD 1298
            DLN AV +R++V+E L+ LKK RF+EFM GF +IS+TLKEMYQMITMGGNAELELVDSLD
Sbjct: 1250 DLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLD 1309

Query: 1299 PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1358
            PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR
Sbjct: 1310 PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1369

Query: 1359 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILNRN 1416
            NVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVG+YK +N+TKS T++N DI+NR+
Sbjct: 1370 NVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDIINRD 1427

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 1397 bits (3617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 757/1440 (52%), Positives = 991/1440 (68%), Gaps = 33/1440 (2%)

Query: 1    MYDSPLSKRQKRKTAEEPELSINHGNGEQEPKA---EKQNDRTEKTPDPDSLS-LESS-- 54
            M D+P SK  KR+T  E  ++       +E      E+  +   K+   DSL  L+SS  
Sbjct: 1    MLDTPSSK--KRRTVGEDAVTPCQDLALEEDTTRNDERNKNNATKSSLHDSLPKLQSSVS 58

Query: 55   ---YAKSHTPRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAP----SRGRDYKAYX 107
               + K+ TPRKL++   EN+YA SQPT SA+SSL VP LQ    P    SRGR  K Y 
Sbjct: 59   PLDFKKTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRRIKMYS 118

Query: 108  XXXXXXX----XXXXXXXLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLEN 163
                              LEL+QLSP+KNSR+ELQKLYD+H     +  RL+I KLVL N
Sbjct: 119  QSPPRSPGRSPNRSPVRKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHN 178

Query: 164  FKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEE 223
            FKSYAG+Q +GPF  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE 
Sbjct: 179  FKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSER 238

Query: 224  FPNLQSCSVAVHFEYVVDEPSGTSRID--EEKPGLVITRKAFRNNSSKYYINGKESNYTQ 281
            F NL  CSV VHF YV DE +  +  D  E +  LVITRKAF+NNSSKY+INGKESN+T+
Sbjct: 239  FTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFINGKESNFTE 298

Query: 282  VTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIE 341
            VTKLLK +GIDLDHKRFLILQGEVENIAQMK+KAEK+++DGLLEYLEDIIGT +YKPLIE
Sbjct: 299  VTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIE 358

Query: 342  DRLSQIETLNEICLEKENRFEIVNREKNSLESGKETALEFLEKEXXXXXXXXXXXXXXXX 401
             +  +IE +NE+C+EKENRF IV+ EKNSLE  K+ ALEFLEKE                
Sbjct: 359  QKTVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAALEFLEKEKQLTLLKSKLTQYHLY 418

Query: 402  XXNSKLASTLEKTSSLNKDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLAL 461
              N K+ +TL +  SL  DFE EK++  + +KEV+ +++   E K+ ++S  ++EK+L  
Sbjct: 419  VNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQ 478

Query: 462  EKRELESTRVSLEERTKNLVNKMGKAEKILKSTNHSISXXXXXXXXXXXXXXXXXXXVKD 521
             KRE+ +  VSLEE TKNL  K+ KA+  ++S+   IS                   V D
Sbjct: 479  RKREINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNEHELQEQSQLQEEYEAEVND 538

Query: 522  LNQSLEEERRILDDIKLSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQXXXXXXXX 581
            L++  E E +IL DIKL LKDKT   S EI   EK+LEP + ++QEKKSQI+        
Sbjct: 539  LSKQREVEEKILLDIKLQLKDKTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDL 598

Query: 582  XXXTQVKLKKNAEALEENIAAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLK 641
               ++ K+    E+L+E +   +   ++ +  + DL K+ ++L+  + +G+K+   A +K
Sbjct: 599  IRDSKRKVGAEIESLKEELLKLQKDLEDNEKDVTDLNKSKRNLVKEKQEGDKECKDAGVK 658

Query: 642  LKEMQTILNAHRQRAMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDN 701
            L EM+ ILN+HRQ+ MEARS++S A+NK+KVLT+L R+Q+SGRINGFHGRLGDLG+I D 
Sbjct: 659  LNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQ 718

Query: 702  FDVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENV 761
            +DVAISTACPRLDD+VV++VEC Q CI++LRKNKLGYARF++LD+L++F++ P+ TPENV
Sbjct: 719  YDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENV 778

Query: 762  PRLFDLVKPKDPKFSNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTM 821
            PRLFDLVKPK+ +F+ A YSVLRDTLVA+DLKQAN VAYGKRRFRVVT+DG+LIDISGTM
Sbjct: 779  PRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTM 838

Query: 822  SGGGNHVVKGLMRIGKNQSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKK 881
            SGGG+ V KGLM +    S   + ++ E++ K+E EL+ REK F VA++T H MEQEL+K
Sbjct: 839  SGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRK 898

Query: 882  VRDQEPDMESQILRXXXXXXXXXXXXXXXXXQVKEAKMAYDKSVNDTAQLNKIMKILEHL 941
            + D+EP +E +I +                 Q+ E    Y+KS+ DT  L+ ++  LE L
Sbjct: 899  LCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKDTDDLDLLLGNLEAL 958

Query: 942  RGEYDDLQAETKTKKERIKALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAXXXXXXXX 1001
              E   LQ ++KT  ER+  L+D+IM+IGG+ LQ+QNSKV SL+QRIDIL A        
Sbjct: 959  NQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAKLKKSKTV 1018

Query: 1002 XXXXXXDVTKFQKQLKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDL 1061
                  ++ K +K L     +   S+ E+   + ++E  K  L+  +  +  I + K +L
Sbjct: 1019 VKKLNTELKKARKSLIASTEESTNSTEEIAHAKARAEVAKNSLLDINKSLESIQDEKINL 1078

Query: 1062 EEQSEQLKEKVAEMEGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRD 1121
            E++ E   +K+ E    ++EFK++++E++NK+E+ NS+L+Y+K +  Q  +ELN   +RD
Sbjct: 1079 EQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNFRLRD 1138

Query: 1122 VTHTLLILDNNQMDILDKEGEDRQETNQEDISGEAKGET-QGEEGDN-----------DD 1169
            VTHTL +L   +    +++     +    ++  E  G    G E  N            D
Sbjct: 1139 VTHTLDLLREEEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVKVASD 1198

Query: 1170 RHCMNIDETSDEVSRGIPRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARR 1229
               M++D+  D VS+GIPRLS+ EL  ++ + L  +I +L  +I+  +++I +LEEYA+R
Sbjct: 1199 EISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYAKR 1258

Query: 1230 LAEFKRRKLDLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNA 1289
            L EFK+RK+DLN +V +R+++   +E LKKKR++EFM GF+IISMTLKEMYQMITMGGNA
Sbjct: 1259 LVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNA 1318

Query: 1290 ELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1349
            ELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD
Sbjct: 1319 ELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1378

Query: 1350 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKN 1409
            EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVG+YK +N TK+ T++N
Sbjct: 1379 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKNATIRN 1438

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 1383 bits (3579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 755/1422 (53%), Positives = 980/1422 (68%), Gaps = 33/1422 (2%)

Query: 5    PLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHTPRKL 64
            P  KRQK   +  PE    +   + E     ++ ++  +  P ++S      KSHTPRKL
Sbjct: 8    PSPKRQKVLESHTPEQQEENRREDDESPLRFEHQQSAVSLSPPAIS------KSHTPRKL 61

Query: 65   VLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPS---RGR-DYKAYXXXXXXXXXXXXXX 120
            +L   +NRYAFSQPT SA SSL VP+LQPPE  S   RGR D K Y              
Sbjct: 62   ILHQSDNRYAFSQPTVSA-SSLQVPSLQPPETSSSSSRGRRDIKVYSQSPPRSPGRSPTR 120

Query: 121  XLELLQLSPVKNSRI-ELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTS 179
             LEL+QLSPVKN+RI +LQ+LY+S      ++ RLFI+KLVL NFKSYAG+QV+GPF+T+
Sbjct: 121  KLELIQLSPVKNNRIRKLQELYNSQI----KKERLFINKLVLNNFKSYAGEQVIGPFNTN 176

Query: 180  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEYV 239
            FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FPNL SCSV V F+YV
Sbjct: 177  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEFQYV 236

Query: 240  VDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFL 299
            VD+ +G+S+ID+ KP L+ITRKAF+NNSSKY+INGKES+YT+VTKLLK EGIDLDHKRFL
Sbjct: 237  VDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFL 296

Query: 300  ILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKEN 359
            ILQGEVENIAQMK KAE+E DDGLLEYLEDIIGTA+YK  IE    +++TLNEIC+EKEN
Sbjct: 297  ILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKEN 356

Query: 360  RFEIVNREKNSLESGKETALEFLEKEXXXXXXXXXXXXXXXXXXNSKLASTLEKTSSLNK 419
            RFEIV REKNSLES K  ALEF++KE                  + KLASTL+K S L +
Sbjct: 357  RFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQE 416

Query: 420  DFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTKN 479
            ++++E  KF+ + +E +++E   K++  ++ S     K    +KREL++ + SLEE+ K+
Sbjct: 417  EYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIKS 476

Query: 480  LVNKMGKAEKILKSTNHSISXXXXXXXXXXXXXXXXXXXVKDLNQSLEEERRILDDIKLS 539
               K  KA K +  +   +                    ++ L   L++E+ +L++IKLS
Sbjct: 477  YTRKKEKASKSIAQSKKLLKNYRNEIETLNVDQQERESNLQSLLSELKKEKNVLEEIKLS 536

Query: 540  LKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQXXXXXXXXXXXTQVKLKKNAEALEEN 599
            LKDKT DIS EI QHE++LEPW  QLQEKK +IQ            Q KLK   E L+ +
Sbjct: 537  LKDKTTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQISLLQENQSKLKDEIEKLKND 596

Query: 600  IAAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAMEA 659
            +  +   K+  +  ++DLK    ++     +GE + + A  K+K+MQ +L   RQ+ M+A
Sbjct: 597  LKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKVMDA 656

Query: 660  RSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVVVD 719
            RS L+  ENKSKVL+AL +LQKSGRI+GF+GRLGDLGVID+ +D+AISTA  RLDD+VVD
Sbjct: 657  RSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDDIVVD 716

Query: 720  TVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSNAF 779
            +VEC QHCI+YLRKNKLGYARFILL++LR   L+ + TPENV RLFDLVKP    F  AF
Sbjct: 717  SVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIPAF 776

Query: 780  YSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKNQ 839
            YSVLR+TLVA+DLKQAN VAYG  RFRVVT+DGKLIDISGT++GGG    +GLM++ K  
Sbjct: 777  YSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKKG 836

Query: 840  SDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRXXXX 899
             + +D Y+ +++ KIE EL ERE NF+ ANDT  EMEQ L++++D++P++E +I +    
Sbjct: 837  QENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLMD 896

Query: 900  XXXXXXXXXXXXXQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKERI 959
                         Q+K+    Y++   +  ++ +I   L  L+ EY  L   TK   E+I
Sbjct: 897  TDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHQLNLLQKEYQLLLDSTKNISEKI 956

Query: 960  KALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAXXXXXXXXXXXXXXDVTKFQKQLKNV 1019
              L+ +IM+IGG +LQ+QNSKV S+ Q IDI+ +              ++ + +K L   
Sbjct: 957  DKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALSGA 1016

Query: 1020 ERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKI 1079
            E D +  S E+    ++ E ++  L   D     + N  S+LE +   LKEK+ E E + 
Sbjct: 1017 ELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEAEIEG 1076

Query: 1080 DEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLI-LDNNQMDILD 1138
             +FKS E+++K++LEKLN+LL +IK  IK+ +++L  L +R+ T       DNN ++ +D
Sbjct: 1077 TKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFGDEGDNNSINGVD 1136

Query: 1139 KEG-------EDRQETNQEDISGEAKGETQGEEGDNDDRHCMNIDETSDEVSRGIPRLSE 1191
            +         +D+ +  +E+     K  T+ E         M ID+ +DE S GIPR+S+
Sbjct: 1137 RTSHGGGVPLQDQNKVVRENNMRNEKNSTEAE---------MEIDDVADEFSPGIPRISK 1187

Query: 1192 DELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVK 1251
             +L +++++ LE +IG+L  Y+  TNV+I VLEEYARRLA++  RKLDLNQAV++R+ +K
Sbjct: 1188 AKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQAVERREALK 1247

Query: 1252 EQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPP 1311
            + L+ LKKKR+DEFM GF IISMTLKEMYQMITMGGNAELEL+DSLDPFSEGVTFSVMPP
Sbjct: 1248 KLLDELKKKRYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFSEGVTFSVMPP 1307

Query: 1312 KKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1371
            KKSWRNI NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT
Sbjct: 1308 KKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1367

Query: 1372 KNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDIL 1413
            KNAQFIVISLRNNMFELAQQL+G+YKRDN+TKS  ++N D L
Sbjct: 1368 KNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] {ON}
            YLR086W (SMC4) - SMC chromosomal ATPase family member
            [contig 172] FULL
          Length = 1396

 Score = 1334 bits (3453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 733/1400 (52%), Positives = 948/1400 (67%), Gaps = 74/1400 (5%)

Query: 56   AKSHTPRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPE---APSRGRDYKAYXXXXXX 112
            ++S TPRKLVL S + R+AFSQP +S++S  +VP+LQP +   + SRGR    Y      
Sbjct: 32   SRSRTPRKLVLGSPDKRFAFSQPVSSSSS--NVPHLQPLKNELSSSRGR---VYSQSPPR 86

Query: 113  XXXXXXXXXLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQV 172
                     LEL+QLSP+K SR+E QK  +S    G  Q RL ID+LVL NFKSYAG QV
Sbjct: 87   SPNRSPTRKLELIQLSPMKKSRLESQKFQESRAMMGSIQ-RLCIDRLVLHNFKSYAGTQV 145

Query: 173  VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSV 232
            VGPFH SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LS+LIHKSE  P+L SC V
Sbjct: 146  VGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHV 205

Query: 233  AVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGID 292
             + F+YV DEP GT+ I ++KP +VI RKAFRNN+SKYY+NGKES+YT +T+LL++EGID
Sbjct: 206  DIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGID 265

Query: 293  LDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNE 352
            LDHKRFLILQGEVE+IAQMK KAEKESDDGLLEYLEDIIGTA YKPLIE+ LS+I  LN+
Sbjct: 266  LDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLND 325

Query: 353  ICLEKENRFEIVNREKNSLESGKETALEFLEKEXXXXXXXXXXXXXXXXXXNSKLASTLE 412
            IC EKENRFEIV REK+SLE GK  ALE+LEKE                    KL ST E
Sbjct: 326  ICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKE 385

Query: 413  KTSSLNKDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVS 472
            K +   +   +EK K  +  +E+  +++  + +K  +      EK L LEKR  +  RVS
Sbjct: 386  KIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVS 445

Query: 473  LEERTKNLVNKMGKAEKILKSTNHSISXXXXXXXXXXXXXXXXXXXVKDLNQSLEEERRI 532
            LEE+ KNL  K  K+ + L+S   SIS                   + +LN +++EE+  
Sbjct: 446  LEEKLKNLTQKEVKSSRSLQSITSSISTTQAKMEELANDQEQHEKDLLELNGTMKEEKEK 505

Query: 533  LDDIKLSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQXXXXXXXXXXXTQVKLKKN 592
            LD+IK SLKDK   IS +I + EK+LEPW+++LQEKK+Q++           +  K++++
Sbjct: 506  LDEIKSSLKDKISLISEQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQD 565

Query: 593  AEALEENIAAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAH 652
               + + I   + +  E +G +  L+K    +    + G+ +   A  K+KEM+ IL AH
Sbjct: 566  IILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAH 625

Query: 653  RQRAMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPR 712
            RQR+++ARSSLS  ENK+KVL AL RLQ+SGRI+GFHGRLGDLG IDD +DVAISTACPR
Sbjct: 626  RQRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPR 685

Query: 713  LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKD 772
            LDD+VV+TVEC Q CI+YLRKNKLGYARFILLD+LR FNL P+ TPENVPRL+DLV+P +
Sbjct: 686  LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNN 745

Query: 773  PKFSNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGL 832
            PKF NAFYSVLRDTLVA+DLK+AN VAYGK+R+RVVT+DGKLID+SGTMSGGGN   +G+
Sbjct: 746  PKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGM 805

Query: 833  MRIGKNQSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQ 892
            M+  + QS+    +T EEV +I+ ELSERE NF++A DT+HEME+ L+K++D+EP++E  
Sbjct: 806  MK-SEQQSNSA--FTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELD 862

Query: 893  ILRXXXXXXXXXXXXXXXXXQVKEAKMAY---DKSVNDTA--QLNKIMKILEHLRGEYDD 947
            I +                 +  E ++ Y   +K+  +++  +L+     L+ L+ EY +
Sbjct: 863  ISK-----RKLDIDSLSSEMKASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRE 917

Query: 948  LQAETKTKKERIKALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAXXXXXXXXXXXXXX 1007
            L+ E ++KK+ +K LQ+QIMK+GGT LQ+Q+S V+S++QRI I++A              
Sbjct: 918  LENEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVLAKSKKTKTDLKKAQN 977

Query: 1008 DVTKFQKQLKNVERDIELSSNELKVIEEK--SEQIKLDLIKNDTDVTGILNLKSDLEEQS 1065
            D+ ++QKQ + +  +++  S E  +IE    S   K+D +        I  LK +L    
Sbjct: 978  DIKRYQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSE-----SINKLKDEL---- 1028

Query: 1066 EQLKEKVAEMEGKIDE-------FKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELS 1118
            E  +E+V + E  IDE       F++LE++   +L+KL  L   +  +  +    LN L 
Sbjct: 1029 ELTEERVRKAEESIDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLK 1088

Query: 1119 IRDVTHTLLILDNNQMDILDKEGEDRQETNQEDISGEAKGETQGEEGDNDDRHCMNIDE- 1177
            IRDVT TL  LD           E  +  ++ +++ E  GE  GE   +     M++DE 
Sbjct: 1089 IRDVTATLQALD-----------ESLENESKNEVAAETPGEEDGEHS-SSLHDPMDVDEN 1136

Query: 1178 ---------------------TSDEVSRGIPRLSEDELKELNIELLEGDIGELTCYIDAT 1216
                                 T + +  G+P+L EDEL+   +E +E +I +L  Y++  
Sbjct: 1137 QGESTSTTEAQLQAGEAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENA 1196

Query: 1217 NVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTL 1276
              DI +LEEYARRL E+K RK+DLN AVQ+RD+V++  E LKKKR DEFM GFN I M L
Sbjct: 1197 YADIEILEEYARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMIL 1256

Query: 1277 KEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFA 1336
            KEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNITNLSGGEKTLSSLALVFA
Sbjct: 1257 KEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFA 1316

Query: 1337 LHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVY 1396
            LHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGVY
Sbjct: 1317 LHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVY 1376

Query: 1397 KRDNRTKSTTVKNIDILNRN 1416
            K  N TKS  ++N D+++R+
Sbjct: 1377 KNKNMTKSVALQNTDLIDRS 1396

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 1319 bits (3413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 744/1448 (51%), Positives = 969/1448 (66%), Gaps = 84/1448 (5%)

Query: 3    DSPLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHTPR 62
            +SPLSK+QK     + + S                 +TE++ D       +  ++S TPR
Sbjct: 2    ESPLSKKQKTFVNRDEDFS-----------------QTEESVDV------TRASRSRTPR 38

Query: 63   KLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEA---PSRGRDYKAYXXXXXXXXXXXXX 119
            KLVL S + R+AFSQP  S++S  +VP LQP ++    SRGR    Y             
Sbjct: 39   KLVLGSPDKRFAFSQPVTSSSS--NVPYLQPLKSELSSSRGR---VYSQSPPRSPTRSPT 93

Query: 120  XXLELLQLSPVKNSRIELQKLYDSHQPSGEQQG--RLFIDKLVLENFKSYAGKQVVGPFH 177
              LEL+QLSP K +R+E QK   + Q  G  Q   RL I++L L NFKSYAG QVVGPFH
Sbjct: 94   RKLELIQLSPTKKTRLESQK---TEQVRGLAQPIERLCINRLSLHNFKSYAGTQVVGPFH 150

Query: 178  TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFE 237
            +SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LSDLIHKSE  PNL SC V V F+
Sbjct: 151  SSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDSCHVEVFFQ 210

Query: 238  YVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKR 297
            YV DE  G + + +++PGLV+TRKAF+NN+SKYY+NGKES+YTQVT+LL+ EGIDLDHKR
Sbjct: 211  YVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKR 270

Query: 298  FLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEK 357
            FLILQGEVE+IAQMK KAEKE DDGLLEYLEDIIGTA YKPLIE  L QI+ LN++C EK
Sbjct: 271  FLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEK 330

Query: 358  ENRFEIVNREKNSLESGKETALEFLEKEXXXXXXXXXXXXXXXXXXNSKLASTLEKTSSL 417
            ENR+EIV REK+SLESGK+ ALEFLEKE                  + K  +T EK  +L
Sbjct: 331  ENRYEIVEREKSSLESGKDEALEFLEKEKKLTFLRSKLLQHKLWKNSFKSTNTQEKIKTL 390

Query: 418  NKDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERT 477
             +   +E+ K+ E  +E+ ++ES+ K +   +      E +L  EKR  +  RVSLEE+ 
Sbjct: 391  EEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDRVSLEEKL 450

Query: 478  KNLVNKMGKAEKILKSTNHSISXXXXXXXXXXXXXXXXXXXVKDLNQSLEEERRILDDIK 537
            KN+  K  KAEK   +T +SI+                   + +LN+SL  E+  LD+IK
Sbjct: 451  KNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIK 510

Query: 538  LSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQXXXXXXXXXXXTQVKLKKNAEALE 597
            +SLK KT  IS +I + E++LEPW+++LQEK+SQI+           +  K+ +     E
Sbjct: 511  ISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSE 570

Query: 598  ENIAAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAM 657
             +I+  + +  E    I  L+K    +      G+ +   A  K+KEM+ +L  HRQR++
Sbjct: 571  NDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQRSL 630

Query: 658  EARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVV 717
            +A+SSLS  ENK+KVL+AL RLQ+SGRI+GFHGRLGDLG IDD +DVAISTACPRLDDVV
Sbjct: 631  DAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDVV 690

Query: 718  VDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSN 777
            V+TVEC Q CI++LRKNKLGYARFILLD+LR FN+  + TP NV RLFDLV P D KF N
Sbjct: 691  VETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHPIDNKFRN 750

Query: 778  AFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGK 837
            AFYSVLRDTLVA+DLK+AN VAYGK+RFRVVT+DGKLID+SGTMSGGGNH   G+M+   
Sbjct: 751  AFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMMK--- 807

Query: 838  NQSDRMD---DYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQIL 894
              S+R++    +T EEV +I+ EL+ERE+NF++A DT+HEME  L+ ++D+EP++E+ I 
Sbjct: 808  --SERLNTGASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETDIS 865

Query: 895  RXXXXXXXXXXXXXXXXXQVKEAKMAYDKSVNDTA--QLNKIMKILEHLRGEYDDLQAET 952
            +                 +   A +  ++ +N+++   L +    L+ L+ E   L+ E 
Sbjct: 866  KRRMEIDSLLSEIKLCEDRA--ASLKKEQKLNESSDDTLIEANSRLDSLKAECKLLEGEM 923

Query: 953  KTKKERIKALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAXXXXXXXXXXXXXXDVTKF 1012
            K+KK +IK LQ+QIMKIGGT LQ+Q S V+S+ QRI I +               D+ ++
Sbjct: 924  KSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAVKKAENDLKRY 983

Query: 1013 QKQLKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSD---LEEQSEQLK 1069
            +KQ   +  DI+  +NEL+ I+E        LI +  +   IL L++    L+++ E+++
Sbjct: 984  EKQAGQLSVDIDQCTNELESIKE--------LISSSDN--KILELEASIDKLQKEGEEIE 1033

Query: 1070 EKVAEMEGKIDE-------FKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDV 1122
            EKV E+E  I+E       F   E+++ N+LEKLN LL +I  D     K+L  L IRDV
Sbjct: 1034 EKVREIERLIEEKSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLKIRDV 1093

Query: 1123 THT------LLILDNNQMDILDKEGEDRQETNQEDISGE------AKGETQGEEGDNDDR 1170
            T T      LL+ ++   D L   G+  +  +QE  +G+       +G    E   +   
Sbjct: 1094 TATLQTLNKLLLSESRSGDEL--HGQSSEARSQEPSNGDLMEVDTVEGCMGNEPTASQPE 1151

Query: 1171 HCMNIDETSD-EVSRG-IPRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYAR 1228
              M++DE  + E S   +P+L+E +LKELN+E +E +IG+L  +++    DI VLEEY +
Sbjct: 1152 DQMDVDEPEEMETSPSDLPKLTEAQLKELNVEEVELEIGQLNDFVENAYADIEVLEEYTK 1211

Query: 1229 RLAEFKRRKLDLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGN 1288
            RL +F+ RKL+LN+AV++RD V++  + L+KKR DEFM GFN ISMTLKEMYQMITMGGN
Sbjct: 1212 RLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGN 1271

Query: 1289 AELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVM 1348
            AELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVM
Sbjct: 1272 AELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVM 1331

Query: 1349 DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVK 1408
            DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG+YK  N TKS  ++
Sbjct: 1332 DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALE 1391

Query: 1409 NIDILNRN 1416
            N D++NR+
Sbjct: 1392 NKDLINRS 1399

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 1295 bits (3352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 699/1374 (50%), Positives = 918/1374 (66%), Gaps = 38/1374 (2%)

Query: 60   TPRKLVLSSGENRYAFSQPTN-SATSSLHVPNLQPPEAPSRGRDYKAYXXXXXXXXXXXX 118
            TP KL+ +S + +   S+ ++ S T  L  P+LQPP A    R    Y            
Sbjct: 14   TPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQISRGRSQYSQSPPRSPNRSP 73

Query: 119  XXXLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHT 178
               +EL+QLSP+KNSR+ELQ+LYD+ Q   E   RL I  LVLENFKSYAG+QVVGPFH+
Sbjct: 74   GRAVELIQLSPIKNSRLELQRLYDTKQKKVE---RLCIRTLVLENFKSYAGRQVVGPFHS 130

Query: 179  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEY 238
            SFSAVVGPNGSGKSNVIDSMLF FGFRANKMRQ +LS LIHKSE++P+L  CSV + F+Y
Sbjct: 131  SFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQFQY 190

Query: 239  VVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRF 298
            VVDEP GT+R+   KP L + RKAF+NN+SKYY+NGKES YT+VT+LL++EGIDLDHKRF
Sbjct: 191  VVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRF 250

Query: 299  LILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKE 358
            LILQGEVE+IAQMK KAE E DDGLLEYLEDIIGT  YK  IE  L ++++LN+IC+EKE
Sbjct: 251  LILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICMEKE 310

Query: 359  NRFEIVNREKNSLESGKETALEFLEKEXXXXXXXXXXXXXXXXXXNSKLASTLEKTSSLN 418
            NRF++V +EK SLE GK+ AL FL+KE                   SKLA TL   S+  
Sbjct: 311  NRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSNTM 370

Query: 419  KDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTK 478
               E EK K  E+ KE+ E+    +++ +R+ S  +  K    + R+LE   VS EE+ K
Sbjct: 371  NKLEQEKAKKVEAQKEIVELTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEEKQK 430

Query: 479  NLVNKMGKAEKILKSTNHSISXXXXXXXXXXXXXXXXXXXVKDLNQSLEEERRILDDIKL 538
            +L+ K  KAEK L +   SI                    +  LN ++ + +  L+ +KL
Sbjct: 431  SLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKMKL 490

Query: 539  SLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQXXXXXXXXXXXTQVKLKKNAEALEE 598
            +L DKT DI+ E+   EK+LEPW  +++EKKS+I+             +KL+     L +
Sbjct: 491  ALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANLSQ 550

Query: 599  NIAAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAME 658
             I   +      +  I  L     S+ D    GE++ ++A  KL+EM+ +L  HRQR  +
Sbjct: 551  EIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRVND 610

Query: 659  ARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVVV 718
            ARS++S AENK+KVLTALSRLQKSGRI+G+HGRLGDLG IDD +D+AISTACPRLDD+VV
Sbjct: 611  ARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLDDIVV 670

Query: 719  DTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSNA 778
            DTVEC Q CI++LRKNKLGYARFILLD+LR+FNLQP  TPENVPRLFDLVKPK+PKF+ A
Sbjct: 671  DTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPKFAPA 730

Query: 779  FYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKN 838
            FYSVLRDTLV  DL QAN VAYGK+R+RVVT+DGKLIDISGTM+GGG+    GLM+  + 
Sbjct: 731  FYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLMKSTQQ 790

Query: 839  QSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRXXX 898
             S     YTPEEV ++E EL+EREKNF+VA +T  EME  L+   D++P++E ++ +   
Sbjct: 791  SSL----YTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSKQKM 846

Query: 899  XXXXXXXXXXXXXXQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKER 958
                          +  E + +   S+ D+++L    + L  L  + +   + +++K +R
Sbjct: 847  DIETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSASESKNQR 906

Query: 959  IKALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAXXXXXXXXXXXXXXDVTKFQKQLKN 1018
            IK L+ +IM+IGG  LQ  NSKV+SL+Q+I I+ A              ++ + +KQ   
Sbjct: 907  IKELRAKIMEIGGLELQTLNSKVDSLNQQIKIVAAKQKKDKTAQKKAELELKRARKQQIT 966

Query: 1019 VERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLK---SDLEEQSEQL------- 1068
             + DIE    E++ ++             DT  TG+  L+   SDL+E+   L       
Sbjct: 967  AKDDIEHCDIEIQKMKSSY----------DTISTGMQELQKQLSDLQEEIGTLTDEHAVT 1016

Query: 1069 KEKVAEMEGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLI 1128
            K ++ +   KID + S+E+E+  +L+KL +L  Y+K ++ + + +L+ L +RD+   +L 
Sbjct: 1017 KHELDQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLD 1076

Query: 1129 LDNNQMDILDKEGEDRQETNQEDISGEAKGETQGEEGDNDDRHC--------MNIDETSD 1180
            L+ N+  +         +T +E+I   +  ET       ++R          M +DE + 
Sbjct: 1077 LEENK-SLQSFSHSPTPDTKRENIQS-SMLETHLASPSPNERKISIAENNLSMEVDEQAS 1134

Query: 1181 EVSRGIPRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDL 1240
             +  G+P+L + EL  +++E LE DI +L  YID + VDI +L+EYA+RLAE++RR++DL
Sbjct: 1135 VLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDL 1194

Query: 1241 NQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPF 1300
            N+A+ KRDE +   E+LKK+R DEFM GF IIS+TLKEMYQMITMGGNAELELVDSLDPF
Sbjct: 1195 NEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPF 1254

Query: 1301 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1360
            SEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV
Sbjct: 1255 SEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1314

Query: 1361 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILN 1414
            SIVANYIKERTKNAQFIVISLRNNMFELAQ+LVG+YK  N T+STT++N DI+N
Sbjct: 1315 SIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIIN 1368

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
            similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 1290 bits (3338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 697/1367 (50%), Positives = 914/1367 (66%), Gaps = 19/1367 (1%)

Query: 60   TPRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPSRGRDYKAYXXXXXXXXXXXXX 119
            TP KL+  S   ++  SQ ++++T++L  P+LQPP      R    Y             
Sbjct: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSVYSQSPPRSPNRSPA 74

Query: 120  XXLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTS 179
              +EL+QLSP+KNSR+ELQK+YD  Q + +   RL I  L+L NFKSYAG QVVGPFH+S
Sbjct: 75   RRIELIQLSPIKNSRLELQKIYDGKQTTTK---RLSIKNLILNNFKSYAGVQVVGPFHSS 131

Query: 180  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEYV 239
            FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE   NL  CSV + F+YV
Sbjct: 132  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQYV 191

Query: 240  VDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFL 299
            +D+  G +++  +   L + RK F+NN+SKYYINGKES+YT+VT+ L+NEGIDLDHKRFL
Sbjct: 192  MDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFL 251

Query: 300  ILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKEN 359
            ILQGEVE+IAQMK KA+ E DDGLLEYLEDIIGTA YK  I D L +++TLN+IC+EKE 
Sbjct: 252  ILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEKEI 311

Query: 360  RFEIVNREKNSLESGKETALEFLEKEXXXXXXXXXXXXXXXXXXNSKLASTLEKTSSLNK 419
            RFE+V +EK SLE+GKE ALEF+ KE                    KLA TL+K S+  +
Sbjct: 312  RFELVEKEKRSLEAGKEQALEFIAKEKQLTLLKSKQLQWDINKETKKLAVTLDKISAFTE 371

Query: 420  DFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTKN 479
              E+E+ K+ E  KE+ ++      ++++++   +++  L  +K +L+   VS EE+ K+
Sbjct: 372  KLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKLKS 431

Query: 480  LVNKMGKAEKILKSTNHSISXXXXXXXXXXXXXXXXXXXVKDLNQSLEEERRILDDIKLS 539
            L  K  KAEK L+    +I                    + +LN+SL  ER  LD IK+S
Sbjct: 432  LNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELNESLHSERSELDAIKMS 491

Query: 540  LKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQXXXXXXXXXXXTQVKLKKNAEALEEN 599
            L+DKT  IS E+   EK+LEPW  +L+ K SQI+           +++KL++    L ++
Sbjct: 492  LRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKD 551

Query: 600  IAAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAMEA 659
            I + K R +  +  I  L+K   ++    S  + +  +A  KL +M+ +L  HRQR  +A
Sbjct: 552  IESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMTDA 611

Query: 660  RSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVVVD 719
            R +LS  ENK+KVL AL RLQKSGRI+GFHGRLGDLG IDD +D+AIS ACPRLDD+VV+
Sbjct: 612  RVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDIVVE 671

Query: 720  TVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSNAF 779
            TVECAQ CI++LRKNKLGYARFILLD+L++FN+  V TPENVPRLFDL  PK+  F+ A 
Sbjct: 672  TVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFAPAL 731

Query: 780  YSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKNQ 839
            YSVLRDTLVA+DL QAN VAYG RRFRVVT+DGKLIDISGTMSGGG+ VVKGLM+  K +
Sbjct: 732  YSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMK-SKQR 790

Query: 840  SDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRXXXX 899
            S+ M  YT EEV ++E EL++RE NF++A DT  EME  L+K +D++P+++ +I +    
Sbjct: 791  SNDM--YTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHKID 848

Query: 900  XXXXXXXXXXXXXQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKERI 959
                          + E +   + +  D   L  I   L  L  E   L+ E+K K E+I
Sbjct: 849  IDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNEQI 908

Query: 960  KALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAXXXXXXXXXXXXXXDVTKFQKQLKNV 1019
              L+ QIMKIGG  LQ QNSKV+SL+Q++ I+VA              ++ +  KQ    
Sbjct: 909  SELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKLGA 968

Query: 1020 ERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKI 1079
            E DI     EL       E ++  L + +  +  I + K  L ++ E  K+ + +    +
Sbjct: 969  ENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAAYV 1028

Query: 1080 DEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDNNQMDILDK 1139
            ++FKS E+EM   LEKL +L  +IK++I + ++ELN L +RDV   L  LD + + +   
Sbjct: 1029 EKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNLPLESL 1088

Query: 1140 EGEDRQETNQ-----------EDIS-GEAKGETQGEEGDNDDRHCMNIDETSDEVSRGIP 1187
                   +NQ            D++ GEAK  ++     ND +  M++D+ +  +  G+P
Sbjct: 1089 TDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFND-QESMDVDQDASYIGPGLP 1147

Query: 1188 RLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKR 1247
            +L+E EL  ++IE L  +I +L  Y+D    DI +LEEYA RLAE+KRRKLDLN++V+KR
Sbjct: 1148 KLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNESVEKR 1207

Query: 1248 DEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFS 1307
            +E++ + E+LKK R +EFM GF IISMT+KE+YQMITMGGNAELELVDSLDPFSEGV FS
Sbjct: 1208 EEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSEGVLFS 1267

Query: 1308 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1367
            VMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI
Sbjct: 1268 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1327

Query: 1368 KERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILN 1414
            KERTKNAQFIVISLRNNMFELAQQL+G+YK  N TKSTT++NIDILN
Sbjct: 1328 KERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILN 1374

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 1282 bits (3318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 718/1375 (52%), Positives = 936/1375 (68%), Gaps = 43/1375 (3%)

Query: 57   KSHTPRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPSRGRDYKAYXXXX----XX 112
            KS+TP K+++S+  +      P+   +SS   P+LQ P + SRGR  KAY          
Sbjct: 45   KSYTPMKVIISNNHSNSISPLPSQLMSSSTQPPSLQHPSSSSRGRAVKAYSQSPPRSPDR 104

Query: 113  XXXXXXXXXLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQV 172
                     LEL+QLSP+KNSR ELQK+Y S Q   E+  R+ ++KLVL NFKSYAG Q 
Sbjct: 105  SPVRSPTRKLELIQLSPIKNSRSELQKIYSSKQE--EKIERICLNKLVLHNFKSYAGTQT 162

Query: 173  VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSV 232
            +GPFH+SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L+DLIHKSEE+P+L SC+V
Sbjct: 163  IGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAV 222

Query: 233  AVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGID 292
             VHFEY++D P  T++I+  K  L+ITR+AF+N++SKYY+NGKESNY  +T LLK EGID
Sbjct: 223  DVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGID 282

Query: 293  LDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNE 352
            LDH RFLILQGEVENIAQMK KAEKE DDGLLEYLEDIIGT  YK LI+ +  +IE LN+
Sbjct: 283  LDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALND 342

Query: 353  ICLEKENRFEIVNREKNSLESGKETALEFLEKEXXXXXXXXXXXXXXXXXXNSKLASTLE 412
            IC+E+ENRF+I++REK SLES KE+ALE+L KE                  N KL++TLE
Sbjct: 343  ICIERENRFDIIDREKESLESEKESALEYLSKEKEQVIVKSKLIQYKIWQNNIKLSNTLE 402

Query: 413  KTSSLNKDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVS 472
            K + L  ++  EK K  E   ++DE+     + +D + +    EK L   KR L+S  VS
Sbjct: 403  KITKLEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVS 462

Query: 473  LEERTKNLVNKMGKAEKILKSTNHSISXXXXXXXXXXXXXXXXXXXVKDLNQSLEEERRI 532
              E+ KN+  K+ K  K ++    +IS                   + +L+ +L  E ++
Sbjct: 463  NTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQL 522

Query: 533  LDDIKLSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQXXXXXXXXXXXTQVKLKKN 592
            L++IKL LKDKT  +S EI++ EKDLEPW+++L E KS+IQ           ++ KLK N
Sbjct: 523  LENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKAN 582

Query: 593  AEALEENIAAKKA----RKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTI 648
             EALE+++  K      R++E++  +  L+   K +I G ++ +K    A+ KL EMQ I
Sbjct: 583  IEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKK----ANEKLCEMQKI 638

Query: 649  LNAHRQRAMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAIST 708
            L   RQ+A +AR+SLS  EN+SKVL AL +LQKSGRINGFHGRLG+LGVID+ +DVAIST
Sbjct: 639  LIQDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAIST 698

Query: 709  ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLV 768
            ACPRL+D+VVD+VEC Q CI+YLRKN LG+ARFILLD+L +F+++ + TP NVPRLFDL+
Sbjct: 699  ACPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLI 758

Query: 769  KPKDPKFSNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHV 828
            K  D KF  AFYSVLR+TLVA DLK+AN VAYGK R+RVVT+ G LIDISGTMSGGGN  
Sbjct: 759  KVNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQA 818

Query: 829  VKGLMRIGKNQSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPD 888
             KG M++  + S     Y+ EEV +IE ELS REKN++ A +TV EME EL+ +++ EP 
Sbjct: 819  SKGAMQLSNSTSKEKSTYSSEEVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPK 878

Query: 889  MESQILRXXXXXXXXXXXXXXXXXQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDL 948
            +E +I +                 Q+ E   ++    N +A + ++   L  L  +   +
Sbjct: 879  IELEISKLNFEIDSLENECSLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLI 938

Query: 949  QAETKTKKERIKALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAXXXXXXXXXXXXXXD 1008
            +++ K+KK+RIK LQD+IMKIGG  LQ+QNSKV+SL ++  IL+               D
Sbjct: 939  ESQMKSKKDRIKELQDKIMKIGGIKLQMQNSKVDSLQEQKKILIKKQKSEKAGIMKIESD 998

Query: 1009 VTKFQKQLKNVERD--------IELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSD 1060
            V K  K+LK  E D        I L  NELK IEE        L +N+ ++  I + K  
Sbjct: 999  VRKLSKKLKESESDNTKLNEKKIAL-ENELKNIEEL-------LAQNENNMNCIQDKKFT 1050

Query: 1061 LEEQSEQLKEKVAEMEGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIR 1120
            L E+SE    ++ EMEG + EFK+LE+E K K EKL SLL  IK  +K  E++ + LSIR
Sbjct: 1051 LREKSEITMNELTEMEGLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIR 1110

Query: 1121 DVTHTLLILDNNQMDILDKEGEDRQETNQEDISGEAKGETQGEEGDNDDRHCMNIDETSD 1180
            +V + L        D+L+ + ++ Q+   E  +     + Q  +  ND+   M I++ ++
Sbjct: 1111 EVAYDL--------DLLNIKEQEAQKIKTELYADFE--QNQSNDVINDE---MIIEDNNN 1157

Query: 1181 EVSRGIPRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDL 1240
            E+++GIP   E + K+ +I  LE ++ +L  Y +   VD+ +LEEY RR+ E+++RK DL
Sbjct: 1158 EIAKGIPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDL 1217

Query: 1241 NQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPF 1300
            NQ+V++RD+V+++LE LKK RF+EFM  FNIISMTLKEMYQ+ITMGGNAELELVDSLDPF
Sbjct: 1218 NQSVEQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPF 1277

Query: 1301 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1360
            SEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV
Sbjct: 1278 SEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1337

Query: 1361 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILNR 1415
            SIVANYIKERTKNAQFIVISLRNNMFELA+QLVG+YK  N+TKS T+KN DIL R
Sbjct: 1338 SIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDILCR 1392

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 1253 bits (3243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 706/1456 (48%), Positives = 956/1456 (65%), Gaps = 75/1456 (5%)

Query: 1    MYDSPLSKRQK-------------------------RKTAEEPELSINHGNGEQEPKAEK 35
            M DSP+SK+QK                         R   ++ +++I    G+++    +
Sbjct: 1    MPDSPISKKQKITESRDEDKKINNNIIINHNNRDINRSHVDDADITIGPYQGQEKHIQPQ 60

Query: 36   QNDRTEKTPDPDSLSLESSYAKSHTPRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPE 95
              DR               + +S TPRKL++SS ++R+  SQP N  ++    P+LQ P 
Sbjct: 61   SQDR---------------HGRSRTPRKLIVSSADHRFTMSQP-NLLSADSQTPSLQHPS 104

Query: 96   APSRGRDYKAYXXXX----XXXXXXXXXXXLELLQLSPVKNSRIELQKLYDSHQPSGEQQ 151
              S GR++K Y                   LEL+QLSP+KN+R ELQK+Y+  Q + ++ 
Sbjct: 105  V-STGREHKFYSQSPPRSPHRSPVRSPKKALELIQLSPIKNNRAELQKMYELQQ-TQKRT 162

Query: 152  GRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
             RL I++LVL NFKSYAG+QVVGPFHT+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ
Sbjct: 163  IRLVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 222

Query: 212  DRLSDLIHKSEEFPNLQSCSVAVHFEYVVDEPSG-TSRIDEEKPGLVITRKAFRNNSSKY 270
             +L DLIHKSE++P L SCSV +HF+YV+D+P+G  S+IDE K  LV+ RKAF+NNSSKY
Sbjct: 223  GKLKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKY 282

Query: 271  YINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDI 330
            YIN KES++TQVT LLKNEGIDLDHKRFLILQGEVENIAQMK K+EKE DDGLLEYLEDI
Sbjct: 283  YINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDI 342

Query: 331  IGTANYKPLIEDRLSQIETLNEICLEKENRFEIVNREKNSLESGKETALEFLEKEXXXXX 390
            IGT++YK  IE  LS++E LNEIC+EKENRF IV +EK+SL  GK  AL++L  E     
Sbjct: 343  IGTSHYKVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVL 402

Query: 391  XXXXXXXXXXXXXNSKLASTLEKTSSLNKDFESEKKKFQESLKEVDEVESQRKEIKDRMS 450
                         N KL STL K +   ++++ E +K+    KE+  ++ +   +  R++
Sbjct: 403  AKSKKYQHQLYIDNKKLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLN 462

Query: 451  SCASQEKTLALEKRELESTRVSLEERTKNLVNKMGKAEKILKSTNHSISXXXXXXXXXXX 510
                 E+ L   +R+  S  +S +E  KN+  K   AEK++ +T  SI+           
Sbjct: 463  ETKKYEEKLLSNQRKNNSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNN 522

Query: 511  XXXXXXXXVKDLNQSLEEERRILDDIKLSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKS 570
                    +++LN+ L+ E+  L++IK+SLK KT+  S EI+++EK+LEP+ +QLQEK S
Sbjct: 523  QQEDYTKQIEELNEKLKIEKSKLEEIKISLKGKTEQFSNEILKNEKELEPYQIQLQEKMS 582

Query: 571  QIQXXXXXXXXXXXTQVKLKKNAEALEENIAAKKARKQELQGFILDLKKNLKSLIDGRSQ 630
            QIQ            +  L     ++++ I  KK     +   I   K+ L         
Sbjct: 583  QIQLLQSEISLLNENKDNLSNEIISIKKLIEEKKLSVVRMSEKITGWKQQLLEQRKEVES 642

Query: 631  GEKDFSTAHLKLKEMQTILNAHRQRAMEARSSLSKAENKSKVLTALSRLQKSGRINGFHG 690
            G+ +F+    K++EM+  L++HRQ+A ++R+SLS  +NK+ VLTAL +LQKSGRI+GF+G
Sbjct: 643  GDIEFNKFTKKIQEMRDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYG 702

Query: 691  RLGDLGVIDDNFDVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQF 750
            RLGDLGVID+ +DVAISTACPRL+D+VVD+V+C Q CIDYLRKN+LGYARFILLD+LR+F
Sbjct: 703  RLGDLGVIDEKYDVAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKF 762

Query: 751  NLQPVDTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTI 810
            NL  ++TP+N PRLFDL++ ++ KF  AFYSVLRDTLVA +L  AN VAYGKRRFRVVT+
Sbjct: 763  NLNRIETPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTL 822

Query: 811  DGKLIDISGTMSGGGNHVVKGLMRIGKNQSDR-MDDYTPEEVNKIENELSEREKNFRVAN 869
            DGKLIDISGTMSGGGN+V++GLM++G++  +   +  +PEEV K+E EL   EKNF+VA 
Sbjct: 823  DGKLIDISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAY 882

Query: 870  DTVHEMEQELKKVRDQEPDMESQILRXXXXXXXXXXXXXXXXXQVKEAKMAYDKSVNDTA 929
            +++ EM QE+  +++Q P  E  I +                 Q+KE +  +D+  N+  
Sbjct: 883  NSLKEMNQEILHMKEQIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNND 942

Query: 930  QLNKIMKILEHLRGEYDDLQAETKTKKERIKALQDQIMKIGGTNLQIQNSKVESLSQRID 989
            ++      L+ L+ EY  L  +TK  K+ I+ L+ QIM  GG  L++QNSKV SL  ++ 
Sbjct: 943  EIKVADDKLQALKKEYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLK 1002

Query: 990  ILVAXXXXXXXXXXXXXXDVTKFQKQLKNVERD--IELSSNELKVIEEKSEQIKL---DL 1044
            I+ +               + K Q +L N  +D  +E  +N    +E   +++ L   +L
Sbjct: 1003 IVNSKQKNDKSAIKKNNNILKKLQNEL-NTTKDNSLEFKTN----LENSKKKVTLLSEEL 1057

Query: 1045 IKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKIDEFKSLEMEMKNKLEKLNSLLTYIK 1104
             K ++D+    N K ++    +  KEK  E+E     FKS E+E+KNKL+KL  L  +++
Sbjct: 1058 AKLESDINDTQNAKEEILLNIDGNKEKAQELEEDSRNFKSFELEIKNKLDKLKDLSHHLE 1117

Query: 1105 SDIKQQEKELNELSIRDVTHTLLILDNN--QMDILDKEG--EDRQETNQEDISGEAKGET 1160
              I + + ELN L+IR+++  L   D    + DI  K G  ED Q T+           +
Sbjct: 1118 KQIGKLDTELNALTIREISQNLESFDERLEKYDI-SKNGATEDTQHTS-----------S 1165

Query: 1161 QGEEGDNDDRHCMNIDETSDEVSRGIPRLSEDELKELNIELLEGDIGELTCYIDATNVDI 1220
                  N +   M+ID T +E++ GI RLSE E+ EL+IE L+ +I  L   ++ +  +I
Sbjct: 1166 ALNSVSNINTDTMDIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANI 1225

Query: 1221 GVLEEYARRLAEFKRRKLDLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMY 1280
             +LEEY RRL+E+K+RK DL++++ +++  KE+ E+LKKKR +EF TGF+IIS+TLKEMY
Sbjct: 1226 EILEEYVRRLSEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMY 1285

Query: 1281 QMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY 1340
            QMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY
Sbjct: 1286 QMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKY 1345

Query: 1341 KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDN 1400
            KPTPLYVMDEIDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QLVG+YK +N
Sbjct: 1346 KPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSEN 1405

Query: 1401 RTKSTTVKNIDILNRN 1416
             T+S T+ N D+LNR+
Sbjct: 1406 MTQSATLVNNDMLNRD 1421

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 1198 bits (3100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 684/1375 (49%), Positives = 924/1375 (67%), Gaps = 40/1375 (2%)

Query: 54   SYAKSHTPRKLVLSSGENRYAFS--QPTNSATSSLHVPNLQPPEAPS-RGRDY-KAYXXX 109
            S + + TPRKLVL S E +YA S  Q T +A++++  P+LQPP A + RGR+Y ++    
Sbjct: 22   SQSPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQPPTAHAVRGREYSQSPPRS 81

Query: 110  XXXXXXXXXXXXLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAG 169
                        LEL++LSP K++R+ELQK+   H+ + +   RL IDKLVL NFKSYAG
Sbjct: 82   PTRSPTRSPTRKLELIRLSPKKSTRLELQKM---HEANTQTSQRLCIDKLVLNNFKSYAG 138

Query: 170  KQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQS 229
             Q +GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE+FP+L S
Sbjct: 139  IQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPSLAS 198

Query: 230  CSVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNE 289
            CSV +HF YV D  +G ++I      +V+ R+AF+NNSSKYY+NGKESNYT+VT+LLK E
Sbjct: 199  CSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEE 258

Query: 290  GIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIET 349
            GIDLDHKRFLILQGEVE+IAQMK+KAEK++DDGLLEYLEDIIGTA +KP IE  L +IET
Sbjct: 259  GIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIET 318

Query: 350  LNEICLEKENRFEIVNREKNSLESGKETALEFLEKEXXXXXXXXXXXXXXXXXXNSKLAS 409
            LNE+C+EKENRFE+V++EK +LESGKE ALEFL+KE                  N KLA+
Sbjct: 319  LNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDSNRKLAT 378

Query: 410  TLEKTSSLNKDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELEST 469
            + +K S+LN +F+ EK +++   KE + +  +    K   ++  ++ K +  +KR LE  
Sbjct: 379  SCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEKD 438

Query: 470  RVSLEERTKNLVNKMGKAEKILKSTNHSISXXXXXXXXXXXXXXXXXXXVKDLNQSLEEE 529
             ++ +E+ K++  K+  AEK    +  +                     + +LN S+  E
Sbjct: 439  FIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIE 498

Query: 530  RRILDDIKLSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQXXXXXXXXXXXTQVKL 589
            +  L++IK+ L +KTKD+S E+   E+ LEP+  Q+QEK+S+I+           +   L
Sbjct: 499  KEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNL 558

Query: 590  KKNAEALE---ENIAAKKARKQELQGFILDLKKNLKSLIDGR-SQGEKDFSTAHLKLKEM 645
             K    +E   E++  ++ +++E +  +    +N KS ++ R S  +K+   A  +  EM
Sbjct: 559  LKEKATIESKIEDLQLEELKQKETETSL----RNEKSKVEARISTAQKECEEAQKQTNEM 614

Query: 646  QTILNAHRQRAMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVA 705
            + +L   RQ   EA+++L+  +NK++VL AL++LQ SGRI GFHGRLGDLG IDD +D+A
Sbjct: 615  RDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYDIA 674

Query: 706  ISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLF 765
            ISTACPRLDD+VV+TVEC Q CID+LRKNKLGY RFILLD+LR+ NL  + TPENVPRLF
Sbjct: 675  ISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRLF 734

Query: 766  DLVKPKDPKFSNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGG 825
            DL+ P    F  AFYSVLRDTLVARDL+QAN VAYGKRRFRVVT+DGKLIDISGTMSGGG
Sbjct: 735  DLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGGG 794

Query: 826  NHVVKGLMRIGKNQSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQ 885
            +    GLMR   +++     Y+ +EV K+E +LS +E N+R A   VHEME  L+K+ D+
Sbjct: 795  SSPQSGLMR---SKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDR 851

Query: 886  EPDMESQILRXXXXXXXXXXXXXXXXXQVKEAKMAYDKSVNDTAQL-----NKIMKIL-E 939
             P+++ QI +                 ++  +++A + S+N+  Q       K + IL +
Sbjct: 852  LPEIDIQISKIQLEKGSRVAEVESYHQRL--SQLARELSMNEKNQQPLLDEEKKLDILRQ 909

Query: 940  HLRGEYDDLQAETKTKKERIKALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAXXXXXX 999
            HL+   D     +K  +++I  L+D+IM+ GG  L++Q +KV SL Q I+IL        
Sbjct: 910  HLQQTID----ASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEKQKKEK 965

Query: 1000 XXXXXXXXDVTKFQKQLKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKS 1059
                    D+ +  ++      ++ + + ++ ++ E+ E I+L+  + +  V      K+
Sbjct: 966  TRSKKLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNERKA 1025

Query: 1060 DLEEQSEQLKEKVAEMEGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSI 1119
            +L    E+LK+++  +E   +EFK+ E+E  ++LEKL+ L  Y+K  ++  E  L  L I
Sbjct: 1026 ELNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKI 1085

Query: 1120 RDVTHTLLILDNNQMDILDKEGEDRQETNQEDISGEAKGETQGEEGDNDDRHCMNIDETS 1179
            RDV+  L  L++    I++   +   +    DI    + ++  + G+ND       D   
Sbjct: 1086 RDVSKLLSQLNDG---IIESCTDVTAKVMNGDI---VQTQSITDVGNNDAME----DSGE 1135

Query: 1180 DEVSRGIPRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLD 1239
                 G+P L+E EL+ L++E LE ++ +L  Y+D  N DI VLEEYARRLAE++RRKLD
Sbjct: 1136 AATHSGLPSLTETELENLDLETLELELHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLD 1195

Query: 1240 LNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDP 1299
            LNQAV KR+EV+ + E  K +R ++FM GF IISMTLKEMYQMITMGGNAELELVDSLDP
Sbjct: 1196 LNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDP 1255

Query: 1300 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1359
            FSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN
Sbjct: 1256 FSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1315

Query: 1360 VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILN 1414
            VSIVANYIKERTKNAQFIVISLRNNMFELAQ LVG+YK +N TKSTT++NIDIL+
Sbjct: 1316 VSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDILH 1370

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 1195 bits (3092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 689/1439 (47%), Positives = 938/1439 (65%), Gaps = 66/1439 (4%)

Query: 1    MYDSPLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHT 60
            M D P+SKRQK  T E+ E  + H                     P +++ E S  ++ T
Sbjct: 1    MSDRPVSKRQKV-TEEDEEEDVIHT--------------------PKAVTFEQS-PRAIT 38

Query: 61   PRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEA--PSRGRDYKAYXXXXXXXXXXXX 118
            PR L+ S  ENR     PT   + +L +P+L PPE+   +RGRD+K+Y            
Sbjct: 39   PRNLLGS--ENRNVL--PT-GGSQNLQIPSLLPPESLGSARGRDFKSYSQSPPRSPGRSP 93

Query: 119  XXXLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHT 178
               L+L++LSP+KNSR ELQKLY+S +   +++ RLFI +LVL +FKSYAG+QV+GPFHT
Sbjct: 94   TRRLKLIELSPIKNSRAELQKLYESKKLDVKKE-RLFIHQLVLNDFKSYAGRQVIGPFHT 152

Query: 179  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEY 238
            SFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FP+L+SCSV VHF+Y
Sbjct: 153  SFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKY 212

Query: 239  VVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRF 298
            V+D+  G++ IDE K  LV+TRKAF+NN+SKY++NGKESNYT+VT LLK EGIDLDHKRF
Sbjct: 213  VIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRF 272

Query: 299  LILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKE 358
            LILQGEVENIAQMK+KAEKE+DDGLLEYLEDIIGT+ YK  IE    +IE+LNEIC+EKE
Sbjct: 273  LILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKE 332

Query: 359  NRFEIVNREKNSLESGKETALEFLEKEXXXXXXXXXXXXXXXXXXNSKLASTLEKTSSLN 418
            NRF IV REKNSLESGKE AL+FL KE                  N KL   L K +++ 
Sbjct: 333  NRFSIVEREKNSLESGKEEALQFLNKEKELVLEKSKLYQYNLMQDNKKLDDVLNKKTNVQ 392

Query: 419  KDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTK 478
            ++   ++ +F+++   + ++ +    +K  +    ++E  L+  KR LE+ +V  E+   
Sbjct: 393  QEQTKQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVN 452

Query: 479  NLVNKMGKAEKILKSTNHSISXXXXXXXXXXXXXXXXXXXVKDLNQSLEEERRILDDIKL 538
            NL +K  + E+  K     I+                      L+ +L+ E+  L++IKL
Sbjct: 453  NLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNLDIEKEKLENIKL 512

Query: 539  SLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQXXXXXXXXXXXTQVKLKKNAEALEE 598
             L++KT+ ++ +I ++EK+L PW+ Q Q+ K +I+            +  L+ +   LE 
Sbjct: 513  KLREKTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLEN 572

Query: 599  NIAAKK----ARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQ 654
             I ++K     ++QE++  +    K    +I  R  GE++   A   L  ++  + A RQ
Sbjct: 573  AILSQKRDLEVQEQEIKSLLEQKTK----VIQERELGERECKNAQATLANVREKVEALRQ 628

Query: 655  RAMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLD 714
            +A+E RS+ S  EN +KVL+AL RLQKSGR+NGFHGRLGDL VID  +DVAISTACPRL+
Sbjct: 629  KAIEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLN 688

Query: 715  DVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPK 774
            D+VVDTVE  Q CI+YLRKNKLGYARFILLD+L  FN   +DTP+   RLFDL+  K+ +
Sbjct: 689  DLVVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKR 748

Query: 775  FSNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMR 834
            F+NAFYSVLRDTLV ++++QAN VAYGK+R+RVVT+DG LID+SGTM+GGG +V KGLM+
Sbjct: 749  FNNAFYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVSKGLMK 808

Query: 835  IGKNQSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQIL 894
            + K+ S     ++PEEV  IENEL+++E  ++ A D  HEME+EL+++RD+ P++++ + 
Sbjct: 809  LSKSSSKGSAFFSPEEVQAIENELNQKENQYKSALDAYHEMEEELRRLRDRAPEIDNLVS 868

Query: 895  RXXXXXXXXXXXXXXXXXQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKT 954
            +                  ++E +   +   N       ++  L+ L+ + DD+  +TK+
Sbjct: 869  KKEMDIETAHNDINSNINVLEEKRKKLESMKNQNDPSITLLAKLKELKSKLDDIDVQTKS 928

Query: 955  KKERIKALQDQIMKIGGTNLQIQN-------SKVESLSQRIDILVAXXXXXXXXXXXXXX 1007
             K++IK ++D+I+++GG  L+ Q+       +K+   S+R+  + +              
Sbjct: 929  TKDKIKTIKDKIIELGGDELKNQSLLVTDITNKISENSRRLKKIKSNKLKKESLLKKFNK 988

Query: 1008 DVTKFQKQLKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSD---LEEQ 1064
            ++T+  ++L N  ++ E +  E K IE K   IK            I NLK +   LE +
Sbjct: 989  ELTEANEELTNFSKNAENADIESKEIESKLLDIK----------ESIENLKENEVKLEHE 1038

Query: 1065 SEQLKEKVAEMEGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVT- 1123
             E    ++   +  + ++KS+ +E  NKLEKL +    +K  IK+    L+EL+IRDVT 
Sbjct: 1039 IEMKHNELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVTQ 1098

Query: 1124 --HTLLILDNNQMDILDKEGEDRQET-NQEDISGEAKGETQG----EEGDNDDRHCMNID 1176
              +T++  +N  +D  D + E+     N +D    A  E Q     +E D+ D + M ID
Sbjct: 1099 VLNTIMTEENASVDKSDPKLENTSAVINADDDGISAVSENQSFNHNDENDDIDSNKMEID 1158

Query: 1177 ETSDEVSRGIPRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRR 1236
                 ++ GIP LS  EL +++ + +E  I  L  +I ++  ++ VLEEYA R  EF +R
Sbjct: 1159 SQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEEYALRFVEFNKR 1218

Query: 1237 KLDLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDS 1296
            K DLN AVQ RD VK++LE +K+KR+DEFM GF IISMTLKEMYQMIT+GGNAELELVDS
Sbjct: 1219 KNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDS 1278

Query: 1297 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1356
            LDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD
Sbjct: 1279 LDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1338

Query: 1357 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILNR 1415
            FRNVSIVANYIKERTKNAQFIVISLRNNMFEL +QLVG+YK +N TKS  + N D++ R
Sbjct: 1339 FRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLVGR 1397

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score =  178 bits (452), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 198/761 (26%), Positives = 344/761 (45%), Gaps = 112/761 (14%)

Query: 687  GFHGRLGDLGVID-DNFDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
            G  G + DL     + + +A+ST   R  D ++VD +  AQ CI YL+K + G A FI L
Sbjct: 525  GIRGLVSDLCQPKKERYALAVSTILGRNFDSIIVDNLAVAQECIAYLKKQRAGIASFIPL 584

Query: 745  DRLR-QFNLQPVDTPENVPRLFDLVKPKDPKFSNAFYSVLRDTL------VARDLKQANN 797
            D +  + +  P           + ++  DP++  A   V  D++      +ARD+K   N
Sbjct: 585  DTIEVETSTLPASESSGCILAINAIEY-DPEYERAMRYVCSDSIICNTLEIARDMKWKRN 643

Query: 798  VAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKNQSDRMDDYTPEEV----NK 853
            V     R ++VT++G LI  +G M+GG          I K+ S+R D    + +    +K
Sbjct: 644  V-----RSKLVTLEGTLIHRAGLMTGG----------ISKDSSNRWDKEEYQSLMTLKDK 688

Query: 854  IENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRXXXXXXXXXXXXXXXXXQ 913
            I  ++ E   + R  +    E+E  +  +  +   + +QI +                  
Sbjct: 689  ILVQIEEVGSHSRACSIRARELEGNISLIYSEASSIRTQISQLKRALEDTNTDIEYHQNL 748

Query: 914  VKEAKMAYDKSVNDTAQ-LNKIMKILEHLRGEYDDLQAETKTKKERIKALQDQIMKIGGT 972
            +K+    YD  + +  Q L  I    + L  E D LQ +T       K   D   K+G +
Sbjct: 749  IKQ---EYDPKIQELEQKLAIINDSRKQLEEEKDSLQTQT------FKEFTD---KLGFS 796

Query: 973  NLQIQNSKVESLSQRIDILVAXXXXXXXXXXXXXXDVTKFQKQLKNVERDIELSSNELKV 1032
              + +    ++  Q+                    ++ + QKQ+ NVE  +E     L  
Sbjct: 797  MKEYETHSGDAKRQQ------------------SKELQQLQKQILNVENKLEFEKERLTS 838

Query: 1033 IEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKIDEFKSLEMEMKNK 1092
               + E+ + D+ K   ++  +   + D+  Q++++++ + + + K+   K +E E+KNK
Sbjct: 839  TSNRLEKTETDMKKVFIELQSLQKQEEDVGVQTKKVEKAIKDHKIKL---KKVEEELKNK 895

Query: 1093 LEKLN----SLLTYIKS--DIKQQEKELNELSIRDVTHTLLILDN---NQMDILDKEGED 1143
               +N     L+ Y  S   +K++  E+ ++  +     + +L N   + M I      D
Sbjct: 896  QRTMNLNDEQLIEYNSSLQSLKRERDEVKDVIEKGDLERICVLKNCKISNMQIPIVSDVD 955

Query: 1144 RQETNQEDISGEAKGETQGEEGDNDDRHCMNIDETSDEVSRGIPRLSEDELKELNIELLE 1203
             Q    + I  EA   +   E D D       +   + V +G  R    ELK+++ E+L 
Sbjct: 956  LQSLPIDRIDAEAIRTSNEIEIDYDALPAKYKENGGEAVEKGFER----ELKQVD-EIL- 1009

Query: 1204 GDIGELTCYIDATNVDIGVLEEYAR---RLAEFKRRKLDLNQAVQ--KRDE--VKEQLEI 1256
                              VL+  A+   R  E +++   +N   +  K+DE  V  Q   
Sbjct: 1010 -----------------NVLQPNAKATDRFNEAQQKFGSINDETEQLKKDEKKVLAQFIK 1052

Query: 1257 LKKKRFDEFMTGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1307
            +K+KR   F   F  ++  +  +Y+ +T          GG+A L L D  +PF+ G+ + 
Sbjct: 1053 IKRKRKSLFEEAFEYVTEHIDPIYRELTKNPNSTSELAGGSASLTLEDEDEPFNAGIRYH 1112

Query: 1308 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1367
              PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  VA YI
Sbjct: 1113 ATPPLKRFKDMEYLSGGEKTVAALALLFTVNSYQPSPFFVLDEVDAALDTTNVERVATYI 1172

Query: 1368 KER-TKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTV 1407
            +     + QFIVISL+N MFE +  LVGVY++     S  V
Sbjct: 1173 RRHGNPDLQFIVISLKNTMFEKSDALVGVYRQQELNTSKIV 1213

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit of
            the multiprotein cohesin complex, essential protein
            involved in chromosome segregation and in double-strand
            DNA break repair; SMC chromosomal ATPase family member,
            binds DNA with a preference for DNA with secondary
            structure
          Length = 1225

 Score =  178 bits (452), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 190/749 (25%), Positives = 347/749 (46%), Gaps = 106/749 (14%)

Query: 702  FDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPEN 760
            + +A+ST   +  D V+V+ +  AQ CI +L+K + G A FI LD + +  L  +  P++
Sbjct: 544  YGLAVSTILGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLDTI-ETELPTLSLPDS 602

Query: 761  VPRLFDL-VKPKDPKFSNAFYSVLRDTLVARDLKQANNVAYGKR-RFRVVTIDGKLIDIS 818
               +  +     +P++  A   V  D+++   L  A ++ + K  R ++VTI+G LI  +
Sbjct: 603  QDYILSINAIDYEPEYEKAMQYVCGDSIICNTLNIAKDLKWKKGIRGKLVTIEGALIHKA 662

Query: 819  GTMSGGGNHVVKGLMRIGKNQSDRMDDYTPEEVNKIENEL----SEREKNFRVANDTVHE 874
            G M+GG          I  + ++R D    + +  ++++L     E     R  +    E
Sbjct: 663  GLMTGG----------ISGDANNRWDKEEYQSLMSLKDKLLIQIDELSNGQRSNSIRARE 712

Query: 875  MEQELKKVRDQEPDMESQILRXXXXXXXXXXXXXXXXXQVKEAKMAYDKSVNDTAQLNKI 934
            +E  +  +     ++ +Q+ +                  + E ++   K  ND  +    
Sbjct: 713  VENSVSLLNSDIANLRTQVTQQKRS--------------LDENRLEI-KYHNDLIEKEIQ 757

Query: 935  MKILEHLRGEYDDLQAETKTKKERIKALQDQIMK-----IGGTNLQIQNSKVESLSQRID 989
             KI E L+ + DDL+       +  +ALQ+ I K     IG T  + +N   E + Q+  
Sbjct: 758  PKITE-LKKKLDDLENTKDNLVKEKEALQNNIFKEFTSKIGFTIKEYENHSGELMRQQ-- 814

Query: 990  ILVAXXXXXXXXXXXXXXDVTKFQKQLKNVERDIELSSNELKVIEEKSEQIKLDLIKNDT 1049
                              ++ + QKQ+  VE  ++  ++ L   + + E+ + DL     
Sbjct: 815  ----------------SKELQQLQKQILTVENKLQFETDRLSTTQRRYEKAQKDL----- 853

Query: 1050 DVTGILNLKSDLEEQSEQLKEKVAEMEGKIDEFKSLEMEMKNK--------------LEK 1095
                 + +KS LEEQ   ++ K+  +E K++E K+   E++ K              LE 
Sbjct: 854  -ENAQVEMKS-LEEQEYAIEMKIGSIESKLEEHKNHLDELQKKFVTKQSELNSSEDILED 911

Query: 1096 LNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDNNQMDILDKEGEDRQETNQEDISGE 1155
            +NS L  +K +    ++++ +  +  VT     L N ++  ++       ET  +D+   
Sbjct: 912  MNSNLQVLKRERDGIKEDIEKFDLERVT----ALKNCKISNINIPISS--ETTIDDLPIS 965

Query: 1156 AKGETQGEEGDNDDRHCMNIDETSDEVSRGIPRLSEDELKELNIELLEGDIGELTCYIDA 1215
            +            D   + I  + D   +G+P+  ++   +   + LE  I E+   ++ 
Sbjct: 966  ST-----------DNEAITISNSIDINYKGLPKKYKENNTDSARKELEQKIHEVEEILNE 1014

Query: 1216 TNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMT 1275
               +   LE Y      F+    +  Q   +  ++  Q   +KKKR + F   F+ +S  
Sbjct: 1015 LQPNARALERYDEAEGRFEVINNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDH 1074

Query: 1276 LKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEK 1326
            L  +Y+ +T          GGNA L + D  +PF+ G+ +   PP K ++++  LSGGEK
Sbjct: 1075 LDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEK 1134

Query: 1327 TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNAQFIVISLRNNM 1385
            T+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI + R  + QFIVISL+N M
Sbjct: 1135 TVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTM 1194

Query: 1386 FELAQQLVGVYKRDNRTKSTTVKNIDILN 1414
            FE +  LVGVY R  +  S+ +  +D+ N
Sbjct: 1195 FEKSDALVGVY-RQQQENSSKIITLDLSN 1222

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  170 bits (431), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 195/783 (24%), Positives = 350/783 (44%), Gaps = 174/783 (22%)

Query: 702  FDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRL--RQFNLQPVDTP 758
            + +A+S    +  D ++V+ +  A+ CI +L+K + G A FI LD +   Q  L    + 
Sbjct: 542  YGLAVSVMLGKNFDSIIVENLSVARECISFLKKQRAGTASFIPLDTIDSEQPTLSAPPSQ 601

Query: 759  ENVPRL----FDLVKPKDPKFSNAFYSVLRDTL-VARDLKQANNVAYGKRRFRVVTIDGK 813
            E +  +    +DL   +  ++     S++ DTL +ARDLK    V     R ++V++DG 
Sbjct: 602  EYILTINAIEYDLAYERAMQYVCG-DSIICDTLDIARDLKWNRGV-----RSKLVSLDGS 655

Query: 814  LIDISGTMSGGGNHVVKGLMRIGKNQSDRMDDYTPEEVNKIENEL----SEREKNFRVAN 869
            LI  +G M+GG          I K+  +R D    + +  ++++L     E     R A 
Sbjct: 656  LIHKAGLMTGG----------ISKDSKNRWDKEEYQSLMTLKDKLLIQIEEVSTVGRDAA 705

Query: 870  DTVHEMEQELKKVRDQEPDMESQILRXXXXXXXXXXXXXXXXXQVKEAKMAYDKSVNDTA 929
                E+E  L  +  +   + +Q++                     + K + +++ N+  
Sbjct: 706  AKARELESSLSLLNAELSSLRTQLV---------------------QVKRSVEENANEIN 744

Query: 930  QLNKIMKILEHLRGEYDDLQAETKTKKERIKALQDQIMKIGGTNLQIQNSKVESLSQRID 989
              NK++   E    + + LQ       E I+A+++ I  I    + +Q +  + L+ ++ 
Sbjct: 745  YHNKLLT--EQYTPKLESLQ-------EEIQAIENSISSITAEKVSLQETIFKELTDKVG 795

Query: 990  ILVAXXXXXXXXXXXXXXDVTKFQKQLKNVERDIELSSNELKVIEEKSEQIKLDLIKNDT 1049
              +                            +D E  S +L  + E+S++++  L K   
Sbjct: 796  FSI----------------------------QDYERYSGDL--MREQSKELQ-QLQKQ-- 822

Query: 1050 DVTGILNLKSDLEEQSEQLKEKVAEMEGKIDEFKSLEMEMKNKLEKLNSL---LTYIKSD 1106
                ILN+K+ L+ +SE+LK    +    ++  +S +  +++  E+ N        I+  
Sbjct: 823  ----ILNIKNKLQFESERLKTTEGKYHASLESLESAKSNLQSLEEEENECQQKRKQIEQH 878

Query: 1107 IKQQEKELNELSIRDVTHTLLILDNNQMDILDKEGEDRQETNQEDISGEAKGETQG---- 1162
            I + E ELN L          + D  Q+D            N +D+  E   E Q     
Sbjct: 879  ISEDEAELNRLQ--------RVYDARQLDF----------NNLDDVLAEYNNELQSLKHN 920

Query: 1163 -----EEGDNDDRHCMNIDETSDEVSRGIPRLSEDELKELNIELLEGDIGELTCYIDATN 1217
                 E+ +  D   + + +     +  IP LS+  L  L I+ ++ D   ++  ID   
Sbjct: 921  RNQIREDMEKIDLERVGVLKNCKITNMEIPILSDINLSNLPIDKIDEDTIAISNEIDVDY 980

Query: 1218 VDIGVLEEYARRLAEFKRRKLD---------LN------QAVQKRDEVKEQLEI------ 1256
             D+    +Y    A   R +L+         LN      +AV++ D+ +E+ E+      
Sbjct: 981  NDLPA--KYKESSATTIREELENHIRSIEDTLNVLQPNARAVERFDDAQERFEVVEKETE 1038

Query: 1257 ---------------LKKKRFDEFMTGFNIISMTLKEMYQMITM---------GGNAELE 1292
                           +KK+R + F   F+ ++  L  +Y+ +T          GGNA L 
Sbjct: 1039 DLKAREKKALTQFLKIKKRRRELFENAFDFVNEHLDPIYRELTRNPNSSALLSGGNASLT 1098

Query: 1293 LVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1352
            L D  +PF+ G+ +  MPP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+D
Sbjct: 1099 LEDEDEPFNAGIKYHAMPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVD 1158

Query: 1353 AALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNID 1411
            AALD  NV  +A YI+     + QFIVISL+N MFE +  LVGVY R  +  S+ +  +D
Sbjct: 1159 AALDITNVERIAAYIRRHGNPDLQFIVISLKNTMFEKSDALVGVY-RQQQENSSKIVTLD 1217

Query: 1412 ILN 1414
            + N
Sbjct: 1218 LRN 1220

>KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  148 bits (374), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 71/170 (41%), Positives = 113/170 (66%), Gaps = 12/170 (7%)

Query: 1250 VKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPF 1300
            V EQ   +++ R D F + F+ +S  + ++Y+ +T          GGNA L L D  +P+
Sbjct: 1052 VNEQFAKIRRLRKDAFESAFDHVSNAIDDVYRELTRDPHSTAELAGGNASLTLEDEDEPY 1111

Query: 1301 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1360
              G+ +   PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV
Sbjct: 1112 LAGIRYHATPPTKRFKDMEFLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDILNV 1171

Query: 1361 SIVANYIKERT-KNAQFIVISLRNNMFELAQQLVGVYK--RDNRTKSTTV 1407
              +A YI++R   N QFIVISL+N MFE +Q LVGV++  RDN +++ T+
Sbjct: 1172 ERIATYIRQRALSNLQFIVISLKNTMFEKSQALVGVFRQQRDNTSRALTL 1221

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/198 (31%), Positives = 100/198 (50%), Gaps = 28/198 (14%)

Query: 152 GRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    + L NFKSY GK  +G   ++F++V+GPNGSGKSN++D++ FV G ++  +R 
Sbjct: 2   GRLL--GIELYNFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMDAISFVLGMKSIHLRS 59

Query: 212 DRLSDLIHK------------SEEFPNLQSCSVAVHFEYVVDEPSGTSRIDEEKPGLVIT 259
             L+DLI++            SE   N  + S A  +      PSG     +E     +T
Sbjct: 60  HTLADLIYRGTLQDGDADSGYSETHDNENNPSSA--YVKAFYSPSG-----QENDVAELT 112

Query: 260 RKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKES 319
           R    +  S Y +NG+  ++ +    L++E I +  + FL+ QG+VE +A  K +     
Sbjct: 113 RTITLSQESTYKLNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQVASQKPRE---- 168

Query: 320 DDGLLEYLEDIIGTANYK 337
              L    E + G+  YK
Sbjct: 169 ---LTTLFEQVSGSIQYK 183

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (REAL)
          Length = 1264

 Score =  141 bits (356), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 104/161 (64%), Gaps = 10/161 (6%)

Query: 1257 LKKKRFDEFMTGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1307
            +KKKR + F   F+ +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1095 IKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSTVELAGGNASLTIEDEDEPFNAGIKYH 1154

Query: 1308 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1367
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1155 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1214

Query: 1368 -KERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTV 1407
             + R  + QFIVISL+N MFE +  LVGVY++     S TV
Sbjct: 1215 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTV 1255

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
            (REAL)
          Length = 1230

 Score =  140 bits (352), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 104/161 (64%), Gaps = 10/161 (6%)

Query: 1257 LKKKRFDEFMTGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1307
            +K+KR + F   F+ +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1061 IKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYH 1120

Query: 1308 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1367
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1121 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1180

Query: 1368 -KERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTV 1407
             + R  + QFIVISL+N MFE +  LVGVY++     S T+
Sbjct: 1181 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTI 1221

 Score = 96.3 bits (238), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 69/224 (30%), Positives = 107/224 (47%), Gaps = 41/224 (18%)

Query: 152 GRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+N +R 
Sbjct: 2   GRLV--GLELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRS 59

Query: 212 DRLSDLIHKS-------------------EEFPNLQSCSVAVHFEYVVDEPSGTSRIDEE 252
           + L DLI++                        N +S  V   ++       G   ++  
Sbjct: 60  NVLKDLIYRGILNDGNDNDNDDDSASDDDATTSNPKSAYVKAFYQ------KGNKLVE-- 111

Query: 253 KPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMK 312
                + R   RN  + Y I+GK  +Y   +  L+NE I +  K FL+ QG+VE IA   
Sbjct: 112 -----LMRIISRNGDTSYKIDGKSVSYRDYSVFLENENILIKAKNFLVFQGDVEQIAA-- 164

Query: 313 SKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLE 356
                +S   L +  E++ G+  YK   ++   +IE L +   E
Sbjct: 165 -----QSPIELSKMFEEVSGSIQYKKEYDELKEKIEKLGKSATE 203

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
            YFL008W
          Length = 1219

 Score =  139 bits (350), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 107/165 (64%), Gaps = 10/165 (6%)

Query: 1253 QLEILKKKRFDEFMTGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEG 1303
            Q   +KKKR + F   F+ +S  ++ +Y+ +T          GGNA L L D  +PF  G
Sbjct: 1046 QFLAIKKKRREVFEKAFDYVSEHIEPIYRELTKNPNSTAELSGGNASLTLEDEDEPFDAG 1105

Query: 1304 VTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1363
            + +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  N+  +
Sbjct: 1106 IKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFILDEVDAALDVTNIERI 1165

Query: 1364 ANYIKERT-KNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTV 1407
            ANYI++ +  + QFIVISL+N+MFE +  LVG++++     S  V
Sbjct: 1166 ANYIRKHSNSDIQFIVISLKNSMFEKSDALVGIHRQQQENSSRVV 1210

 Score = 92.4 bits (228), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 86/161 (53%), Gaps = 13/161 (8%)

Query: 152 GRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV GF+++ +R 
Sbjct: 2   GRLV--GLELFNFKSYKGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGFQSSNLRS 59

Query: 212 DRLSDLIHKSEEFPNLQSCSVAVHFEYVVD-EPSGTSRIDEEKPGLVI--TRKAFRNNSS 268
             L DL+++          + A   E+  D E S   +   EK G V+   R       S
Sbjct: 60  STLKDLVYR--------DIASADENEFGEDGERSAYVKAFYEKDGTVVELMRAITAGRDS 111

Query: 269 KYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIA 309
            Y I+ K + Y   +  L  E I +  + FL+ QG+VE IA
Sbjct: 112 VYKIDNKTTTYKHYSDFLAAENILIKARNFLVFQGDVEQIA 152

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
            (REAL)
          Length = 1228

 Score =  139 bits (349), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 118/434 (27%), Positives = 211/434 (48%), Gaps = 55/434 (12%)

Query: 1008 DVTKFQKQLKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQ 1067
            ++ + QKQ+  VE  ++  ++ L   + + E+ + DL K   ++       S LEEQ   
Sbjct: 820  ELQQLQKQILTVENKLQFETDRLNTTQRRYEKARKDLEKAQVEM-------SSLEEQEHA 872

Query: 1068 LKEKVAEMEGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLL 1127
            ++ K+  +  K++E        KN L +L   L   +SD+   E  L ++          
Sbjct: 873  IEMKIESIGSKLEE-------NKNHLVELEKKLVTKQSDLNSSEDILEDM---------- 915

Query: 1128 ILDNNQMDILDKE----GEDRQETNQEDISGEAKGETQG------EEGDNDDRHCMNIDE 1177
               N+ + +L +E     ED ++ + E ++     +          +   DD    + D 
Sbjct: 916  ---NSNLQVLKRERDGIKEDVEKNDLEKVTALKNCKISNINLPILSQTTLDDFPISSRDS 972

Query: 1178 TSDEVS-------RGIPRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRL 1230
             +  +S       +G+P+  ++   +     LE  I E+   ++    +   +E Y    
Sbjct: 973  DAITISNSIVVDYKGLPKKYKENNSDSAKRELEQKIREIEEILNELQPNARAVERYDEAE 1032

Query: 1231 AEFKRRKLDLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMIT------ 1284
              F+    +  Q   +  ++  Q   +K+KR + F   F+ +S  L  +Y+ +T      
Sbjct: 1033 GRFEVINNETEQLKTEEKKILNQFLKIKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSN 1092

Query: 1285 ---MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYK 1341
                GGNA L + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+
Sbjct: 1093 VELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQ 1152

Query: 1342 PTPLYVMDEIDAALDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAQQLVGVYKRDN 1400
            P+P +V+DE+DAALD  NV  +A YI + R  + QFIVISL+N MFE +  LVGVY R  
Sbjct: 1153 PSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVY-RQQ 1211

Query: 1401 RTKSTTVKNIDILN 1414
            +  S+ +  +D+ N
Sbjct: 1212 QENSSKIITLDLSN 1225

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  138 bits (348), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 68/172 (39%), Positives = 111/172 (64%), Gaps = 10/172 (5%)

Query: 1246 KRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMIT---------MGGNAELELVDS 1296
            K  +++EQ   +K+ R + F   +N +S  + ++Y+ +T          GG+A L L D 
Sbjct: 1048 KEKKIREQYLKVKQSRREMFEKAYNHVSDHIDQIYRELTKDPHSTAALAGGSASLTLEDE 1107

Query: 1297 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1356
             +P+  G+ +   PP K ++++ +LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD
Sbjct: 1108 DEPYLAGIKYHATPPMKRFKDMEHLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALD 1167

Query: 1357 FRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTV 1407
              NV  +A YIK   + N QFIVISL+N+MFE +Q LVGV+++     S  +
Sbjct: 1168 NTNVEKIATYIKRHASPNFQFIVISLKNSMFEKSQALVGVFRQQQENTSKVI 1219

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 64/195 (32%), Positives = 95/195 (48%), Gaps = 22/195 (11%)

Query: 152 GRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG    +F++++GPNGSGKSN++D++ FV G R++ +R 
Sbjct: 2   GRLL--GLELSNFKSYKGTVKVGFGDANFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRS 59

Query: 212 DRLSDLIHKSEEFPNLQSCSVAVHFE---------YVVDEPSGTSRIDEEKPGLVITRKA 262
             L DL+++     + +                  YV    +   +  EE P +   R  
Sbjct: 60  HLLMDLVYRGRRTGDEEESMEEEPSSSKISSTRSAYV---KAFYLKEGEESP-IEFMRTI 115

Query: 263 FRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDG 322
            R+  S Y +NGK   Y   T +L+ E I +  + FL+ QG+VE IA        +S   
Sbjct: 116 SRSGESAYKVNGKTVGYKDYTDILEKENILIKARNFLVFQGDVEQIAS-------QSAGE 168

Query: 323 LLEYLEDIIGTANYK 337
           L +  E I G+  YK
Sbjct: 169 LTKLFEQISGSVQYK 183

>KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  137 bits (346), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 102/161 (63%), Gaps = 10/161 (6%)

Query: 1257 LKKKRFDEFMTGFNIISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVTFS 1307
            +KK+R + F   F  ++  L  +Y+ +T          GGNA L L D  +PF+ G+ + 
Sbjct: 1054 IKKRRRELFEKAFEHVTNHLDSIYRELTRDPHSSAELSGGNASLTLEDEDEPFNAGIRYH 1113

Query: 1308 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1367
              PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD RNV  +A YI
Sbjct: 1114 ATPPLKRFKDMEYLSGGEKTMAALALLFAINSFQPSPFFVLDEVDAALDVRNVERIAAYI 1173

Query: 1368 KER-TKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTV 1407
            +     N QFIVISL+N MFE +  LVGVY++     S  V
Sbjct: 1174 RRHGNPNLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIV 1214

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
            YFL008W
          Length = 1226

 Score =  133 bits (334), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 121/418 (28%), Positives = 196/418 (46%), Gaps = 90/418 (21%)

Query: 1011 KFQKQLKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKE 1070
            K+  Q+K +E DI   S E                                    +Q++E
Sbjct: 869  KYHTQIKPLEEDI--CSFE------------------------------------KQIEE 890

Query: 1071 KVAEMEGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLI-- 1128
            K  E+EGK       ++E+ NK E LN + + +++  +Q ++   ++   D+    ++  
Sbjct: 891  KETEIEGK-------KLEINNKEESLNEVQSSVEAVKRQHDEISTDIENLDLERIGILRN 943

Query: 1129 --LDNNQMDILDKEGEDRQETNQEDISGEAKGETQGEEGDNDDRHCMNIDETSDEVSRGI 1186
              + N  + IL        ETN  D+       T  E+GD   +    ID   +E+    
Sbjct: 944  CKISNRDLPILS-------ETNLADVPI-----TSNEQGDA-IKMSNEIDIDYEELPTKY 990

Query: 1187 PRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQK 1246
               S  +L++           ELT  I+  N  + +L+  AR +  F   +   N    +
Sbjct: 991  KESSSKQLEK-----------ELTRSIEEVNEMLEILQPNARAVGRFDEAQERFNAIDNE 1039

Query: 1247 RDEVKE-------QLEILKKKRFDEFMTGFNIISMTLKEMYQMIT---------MGGNAE 1290
             + +K        Q    KKKR + F   F+ +S  +  +Y+ +T          GG+A 
Sbjct: 1040 TERLKSEERKIYAQFLKTKKKRKELFDRAFDYVSTHIDGIYRELTKDPNSTAELAGGSAS 1099

Query: 1291 LELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1350
            L L D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE
Sbjct: 1100 LTLEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDE 1159

Query: 1351 IDAALDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTV 1407
            IDAALD +NV  +A YI K    + QFIVISL+N+MFE +  LVGVY+R     S  V
Sbjct: 1160 IDAALDIKNVERIAAYIRKHGNPSLQFIVISLKNSMFEKSDALVGVYRRQQENSSRLV 1217

 Score = 99.0 bits (245), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 66/203 (32%), Positives = 109/203 (53%), Gaps = 20/203 (9%)

Query: 152 GRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R++ +R 
Sbjct: 2   GRLL--GLELYNFKSYRGVVKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSYLRS 59

Query: 212 DRLSDLIHKS----EEFPNLQSCSVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNS 267
             ++DLI++     EE           H  YV    S       ++  + + R   +N  
Sbjct: 60  SAVADLIYRGVVPEEEDDGEGEGDGDAHRAYV----SAFYSKGPQESTVELKRTISKNGD 115

Query: 268 SKYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYL 327
           S Y I+ ++  Y Q ++ L+++ I +  K FL+ QG+VE +A        +S   L +  
Sbjct: 116 STYQIDRRQVTYKQYSEFLESQNILIKAKNFLVFQGDVEQVAS-------QSPLQLTKLF 168

Query: 328 EDIIGTANYKP---LIEDRLSQI 347
           E++ G+A YK    L++D+L Q+
Sbjct: 169 EEVSGSAQYKKEYDLLKDQLEQL 191

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
            Anc_8.68 YFL008W
          Length = 1232

 Score =  133 bits (334), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/163 (41%), Positives = 109/163 (66%), Gaps = 12/163 (7%)

Query: 1257 LKKKRFDEFMTGFNIISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVTFS 1307
            +KKKR + F + F+ ++  ++ +Y+ +T          GG A L L D  +PF+ GV + 
Sbjct: 1063 IKKKRKELFESCFDFVNEHIEPIYKELTKDPNSTTELGGGQATLTLEDEDEPFNGGVKYH 1122

Query: 1308 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1367
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1123 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDHTNVERIAAYI 1182

Query: 1368 -KERTKNAQFIVISLRNNMFELAQQLVGVYKR--DNRTKSTTV 1407
             K   K+ QFI+ISL+N MFE +  LVGV+++  +N +K+ T+
Sbjct: 1183 RKHGNKDLQFIIISLKNTMFEKSDALVGVFRQQTENSSKALTL 1225

 Score = 98.6 bits (244), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 105/205 (51%), Gaps = 24/205 (11%)

Query: 152 GRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R+N +R 
Sbjct: 2   GRLV--GLELSNFKSYKGTVKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSNDLRS 59

Query: 212 DRLSDLIHKS---EEFPNLQSCSVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSS 268
             + DLIH+S    +  N    S  V   Y V + S  +          + R    +  +
Sbjct: 60  SGMKDLIHRSVRDSQSSNDDPTSAYVKAFYKVTDASEITE---------LMRIVNLSGET 110

Query: 269 KYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLE 328
            Y INGK +++   +  L  E I +  K FL+ QG+VE IA        +S   L +  E
Sbjct: 111 IYKINGKTTSFKNYSDWLAKENILIKAKNFLVFQGDVETIAS-------QSSLELTKLFE 163

Query: 329 DIIGTANYKP---LIEDRLSQIETL 350
            + G+  YK    L+++ L++I  L
Sbjct: 164 QVSGSIQYKKEYDLLKEDLNKINRL 188

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1243

 Score =  132 bits (332), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 111/180 (61%), Gaps = 14/180 (7%)

Query: 1246 KRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMIT---------MGGNAELELVDS 1296
            K  + KE+   +K KR + F   F  +   + ++Y+ +T          GGNA L + + 
Sbjct: 1062 KERKAKEKFLEVKAKRKELFEACFKHVDKHIDQIYRALTKNPHDKSELAGGNASLTVENE 1121

Query: 1297 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1356
             +P+  G+ +   PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD
Sbjct: 1122 DEPYLGGIKYFATPPLKRFKDMEYLSGGEKTMAALALLFTINSYQPSPFFVLDEVDAALD 1181

Query: 1357 FRNVSIVANYIKERTK-NAQFIVISLRNNMFELAQQLVGVYK--RDN--RTKSTTVKNID 1411
              NV  +A+YIK     NAQFIVISL+N MFE +Q LVG+++   DN  R  S  ++N D
Sbjct: 1182 ITNVERIAHYIKRNANPNAQFIVISLKNAMFEKSQSLVGIFREQEDNSSRMVSLNLENYD 1241

 Score = 64.3 bits (155), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 94/200 (47%), Gaps = 20/200 (10%)

Query: 702 FDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTP-E 759
           + +A+ST   +  D ++VD++  A  CI YL+K + G A FI LD +   ++ P   P  
Sbjct: 562 YAIAVSTILGKNFDSIIVDSIATAHECITYLKKQRAGSASFIPLDTI---DVNPPSLPVS 618

Query: 760 NVPRLFDLVKP--KDPKFSNAFYSVLRDTLVARDLKQANNVAYGKR-RFRVVTIDGKLID 816
           NV      +     +     A   V  D+++  +L  A  + + +  + ++VT++G LI 
Sbjct: 619 NVQGCLLTINAIEYEGYLEKAMQYVCSDSIICDNLDLAKELKWSRNVKAKLVTLNGALIH 678

Query: 817 ISGTMSGGGNHVVKGLMRIGKNQSD-RMDDYTPEEV--NKIENELSEREKNFRVANDTVH 873
            +G M+GG            KNQ+    D+Y    V  ++I  EL+     FR  N    
Sbjct: 679 KAGQMTGGTAQ---------KNQNRWNKDEYQGLMVLKDQITEELTALSDKFRADNMKSR 729

Query: 874 EMEQELKKVRDQEPDMESQI 893
           E+E E+  + ++   + +QI
Sbjct: 730 ELENEISLLNNEISSLRTQI 749

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
            chromosome segregation protein
          Length = 1223

 Score =  129 bits (324), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 71/192 (36%), Positives = 110/192 (57%), Gaps = 24/192 (12%)

Query: 1240 LNQAVQKRDEVKEQLEILK---KKRFDEFM-----------TGFNIISMTLKEMYQMITM 1285
             + A  + DEV ++ E LK   +K FDEF+             F  I+  L  +Y  +T 
Sbjct: 1023 FDDAKSRFDEVDKETEGLKTEERKVFDEFLKVKQKRKELFENAFEKINEHLDAIYSELTR 1082

Query: 1286 ---------GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFA 1336
                     GG+A + + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA
Sbjct: 1083 NVNSTSILGGGSASMTIEDEDEPFNAGIRYHATPPMKRFKDMEYLSGGEKTVAALALLFA 1142

Query: 1337 LHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGV 1395
            ++ Y P+P +++DE+DAALD  NV  +A YI+     + QFIVISL+N MFE +  LVGV
Sbjct: 1143 INSYNPSPFFILDEVDAALDISNVQRIAAYIRRHGNPDLQFIVISLKNTMFEKSDALVGV 1202

Query: 1396 YKRDNRTKSTTV 1407
            +++     S  V
Sbjct: 1203 FRQQQENSSKIV 1214

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1217

 Score =  129 bits (323), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 99/161 (61%), Gaps = 10/161 (6%)

Query: 1257 LKKKRFDEFMTGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1307
            +KKKR   F   F   S  +  +Y+ +T          GG+A L L D  +PF+ G+ + 
Sbjct: 1048 IKKKRKALFERAFEYASEHIDPIYRELTKNPGSTNELAGGSASLTLEDEDEPFNAGIRYH 1107

Query: 1308 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1367
              PP K ++++  LSGGEKT+++LAL+F ++ ++P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1108 ATPPFKRFKDMEYLSGGEKTVAALALLFTINSFQPSPFFVLDEVDAALDSTNVDRIAAYI 1167

Query: 1368 -KERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTV 1407
             +   ++ QFIVISL+N MFE +  LVGVY++     S  V
Sbjct: 1168 SRHGNRDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIV 1208

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 64/209 (30%), Positives = 108/209 (51%), Gaps = 24/209 (11%)

Query: 152 GRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG   ++F +++GPNGSGKSN++D++ FV G +++ +R 
Sbjct: 2   GRLV--GLELYNFKSYRGTVRVGFGDSNFISIIGPNGSGKSNMMDAISFVLGVKSSHLRS 59

Query: 212 DRLSDLIHKS----EEFPNLQSCSVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNS 267
             L DLI++     E+  + +  +  V   Y+  + +           + ++R   RN  
Sbjct: 60  QILKDLIYRGVEGEEDEEDGEGRTAYVKAFYLKSDST-----------VELSRSISRNGD 108

Query: 268 SKYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYL 327
           ++Y +NGK   Y Q  + L+ E I +  + FL+ QG+V  IA        +S   L +  
Sbjct: 109 TQYKMNGKNCGYKQYAEFLEEENILIKAQNFLVFQGDVVQIAS-------QSATDLTKLF 161

Query: 328 EDIIGTANYKPLIEDRLSQIETLNEICLE 356
           E+I G+  YK   +    ++++LN+   E
Sbjct: 162 EEISGSIQYKKEYDSLKGKVDSLNQSAAE 190

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
            YFR031C
          Length = 1170

 Score =  108 bits (269), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 161/723 (22%), Positives = 302/723 (41%), Gaps = 117/723 (16%)

Query: 685  INGFHGRLGDLGVIDDNFDVAIS---TACPRLDDVVVDTVECAQHCIDYLRKNKLGYARF 741
            + G   +L  L   +DN+D A +    A  RL +VVVD    A   ++  R  K      
Sbjct: 523  VKGVAAQLFTLA--EDNYDSATALQVCAGGRLYNVVVDNERTASQLLEKGRLRK--RVTI 578

Query: 742  ILLDRL--RQFNLQPVD-----TPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARDLKQ 794
            I L+R+  R  N Q +       P  V    +LV  ++ + S A   +  ++L+ +D + 
Sbjct: 579  IPLNRIAARALNSQTLQLAQKTAPGKVELALNLVGYEE-EVSRAMEFIFGNSLICKDAET 637

Query: 795  ANNVAYGKR-RFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKNQSDRMDDYTPEEVNK 853
            A  + +  + R R +T+ G + D  GT+SGG  +          N S  + D   ++ NK
Sbjct: 638  AKKITFHPQIRTRSITLQGDVYDPEGTLSGGSRN----------NTSSLLIDV--QKYNK 685

Query: 854  IENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRXXXXXXXXXXXXXXXXXQ 913
                + E E   +     + E E +L+K R    D+                        
Sbjct: 686  TAKRIEELELKLKSITRDLEEQESKLQKTRSVRNDL-----------------------N 722

Query: 914  VKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKERIKALQDQIMKIGGTN 973
            +   K+   +   ++ Q   I++  E L  E D+ Q E  +K+  I   + +I +I    
Sbjct: 723  LATHKLTLAQRSLESNQAAHIIRKNEELIKEIDESQKEIASKRSSISDCEKEIQRIQTDI 782

Query: 974  LQIQNSKVESLSQRIDILVAXXXXXXXXXXXXXXDVTKFQKQLKNVERDIELSSNELKVI 1033
             +    K   L Q  D                  +V+K  K++  +E  +E   +  +  
Sbjct: 783  QEFSTDKGSKLKQLKD------------------EVSKLFKEIGILETKVESKYDSYQTF 824

Query: 1034 EEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKID----EFKSLEMEM 1089
            +  +EQ+  ++   +  V  +  L+  LE +   L+E +   + ++D    E K+ +  +
Sbjct: 825  QLDTEQLAGEIASGNDTVKQLSELQQTLEGERRSLEENLGMNQTELDNVQVELKAEQSRL 884

Query: 1090 KNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDNNQMDILDKEGEDRQETNQ 1149
             +  E+L  L T IK+  K + K   EL ++ +++ L    NN   I +K     QE + 
Sbjct: 885  VDINEELKELDTVIKT--KTEAKNNYELELQKLSNDLNKFKNNSSSIYEKISSLEQEHDW 942

Query: 1150 EDISGEAKGETQGEEGDNDDRHCMNIDETSDEVSRGIPRLSEDELKELN------IELLE 1203
                    G  Q + G+      +N+++    V   + +  +D  +++N      IE +E
Sbjct: 943  LKDGALVAGIIQ-QSGE------VNLEQMKKRVEH-LQKQFQDMRRKVNPNIMSMIESVE 994

Query: 1204 GDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKEQLEILKKKRFD 1263
                 L   ID    D   ++E   +L E+K+                           D
Sbjct: 995  KKEAALKAMIDTIEKDKVKIQETIHKLNEYKK---------------------------D 1027

Query: 1264 EFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSG 1323
              +  +  +++   +++  +     A+L  ++     +EG+ F V        ++  LSG
Sbjct: 1028 TLIKTWKKVTVDFGQVFADLLPNSFAKLVPLEG-KEVTEGLEFKVRLGSIWKESLVELSG 1086

Query: 1324 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN 1383
            G+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K +QFIV+SL+ 
Sbjct: 1087 GQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKE 1146

Query: 1384 NMF 1386
             MF
Sbjct: 1147 GMF 1149

 Score = 99.4 bits (246), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 61/191 (31%), Positives = 102/191 (53%), Gaps = 19/191 (9%)

Query: 156 IDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           I++L+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  A   +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISAMTTVRASSL 62

Query: 215 SDLIHKSEEFPNLQSCSVAVHFEYV--VDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYI 272
            DLI+K  +   +   SV V F+     + P G +        + +TR+     SSKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTVVFDNSDKSNSPIGFTN----SAKISVTRQVMLGGSSKYLI 117

Query: 273 NGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIG 332
           NG  +    V +L ++  +++++  FLI+QG++  +  MK K        +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEAAG 170

Query: 333 TANYKPLIEDR 343
           T     + EDR
Sbjct: 171 T----KMFEDR 177

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score =  107 bits (267), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 112/213 (52%), Gaps = 18/213 (8%)

Query: 152 GRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R++ +R 
Sbjct: 2   GRL--SGLELNNFKSYKGITKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRS 59

Query: 212 DRLSDLIHK--------SEEFPNLQSCSVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAF 263
           + + DLI++        + E   + S  V   +E    +       D+E+P + + R   
Sbjct: 60  NIVKDLIYRGVINDNGDTNEHGKVTSAYVKAFYEKNTADDGDNDDDDDERP-VELMRAIS 118

Query: 264 RNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGL 323
            N  + Y INGK   Y + ++ L+ E I +  K FL+ QG+VE IA        +S   L
Sbjct: 119 TNGDTTYKINGKTVTYKEYSEFLERENILIKAKNFLVFQGDVEQIAS-------QSPMDL 171

Query: 324 LEYLEDIIGTANYKPLIEDRLSQIETLNEICLE 356
            +  E++ G+  YK   ++   QIE LN+   E
Sbjct: 172 SKLFEEVSGSIQYKKEYDELKEQIEKLNQSAAE 204

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score =  100 bits (250), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 105/194 (54%), Gaps = 15/194 (7%)

Query: 156 IDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           I++L+++ FKSYA + V+  +   F+A+ G NGSGKSNV+D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNVLDAICFVLGIASMSTVRASSL 62

Query: 215 SDLIHKSEEFPNLQSCSVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYING 274
            DLI+K  +   +   SV + F  +  +P  +    E  P L +TR+     +SKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFSNL--DPKCSPIGFENSPKLSVTRQIILGGTSKYLING 119

Query: 275 KESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTA 334
             +    V +L ++  +++++  FLI+QG++  +  MK          +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGT- 171

Query: 335 NYKPLIEDRLSQIE 348
               + EDR  + E
Sbjct: 172 ---KMFEDRKGKAE 182

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1315 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1373
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1374 AQFIVISLRNNMFELAQQL 1392
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
           (SMC1) - SMC chromosomal ATPase family member [contig 7]
           FULL
          Length = 1225

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 70/229 (30%), Positives = 113/229 (49%), Gaps = 38/229 (16%)

Query: 152 GRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY GK  +G   ++F++++GPNGSGKSN++D++ FV G ++  +R 
Sbjct: 2   GRLI--GLELNNFKSYKGKVSIGFRDSNFTSIIGPNGSGKSNLMDAISFVLGVKSVHLRS 59

Query: 212 DRLSDLIHK--------------SEEFPNLQSCSVAVHFEYVVDEPSGTSRIDEEKPGLV 257
             L+DLI++              SE  PN  S  V   +      PS     + E   + 
Sbjct: 60  HLLADLIYRGTLSEEEASSADFESENHPN--SAYVKAFY-----SPS-----NNEDDVVE 107

Query: 258 ITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEK 317
           ++R   R+  S Y I+GK   Y + ++ L++E I +  + FL+ QG+VE +A  K +   
Sbjct: 108 LSRTVTRSQESTYRIDGKTVGYKKYSQFLESENILIKARNFLVFQGDVEQVAAQKPQE-- 165

Query: 318 ESDDGLLEYLEDIIGTANYKP---LIEDRLSQIETLNEICLEKENRFEI 363
                L +  E + G+  YK     I + L +  +    C++   R  I
Sbjct: 166 -----LTDLFEQVSGSLQYKQDYDRIREELERARSETSDCIQSRKRAHI 209

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
           chromosome segregation protein
          Length = 1170

 Score = 99.8 bits (247), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 103/191 (53%), Gaps = 19/191 (9%)

Query: 156 IDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           +++L+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 215 SDLIHKSEEFPNLQSCSVAVHFEYV--VDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYI 272
            DLI+K  +   +   SV + F+     + P G S    E P + +TR+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNTDKSNTPIGFS----EYPKISVTRQIVLGGTSKYLI 117

Query: 273 NGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIG 332
           NG  +    V +L ++  +++++  FLI+QG++  I  MK          +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSE-------ILSLIEEAAG 170

Query: 333 TANYKPLIEDR 343
           T     + EDR
Sbjct: 171 T----KMFEDR 177

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1315 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1373
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1374 AQFIVISLRNNMF 1386
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 98.6 bits (244), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 59/191 (30%), Positives = 103/191 (53%), Gaps = 19/191 (9%)

Query: 156 IDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           I++L+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYAARTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 215 SDLIHKSEEFPNLQSCSVAVHFEYV--VDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYI 272
            DLI+K  +   +   SV V F+     + P G +      P + +TR+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTVVFDNSDRDNSPIGFTN----SPKISVTRQVVLGGTSKYLI 117

Query: 273 NGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIG 332
           NG  +    V +L ++  +++++  FLI+QG++  +  MK          +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 333 TANYKPLIEDR 343
           T     + EDR
Sbjct: 171 T----KMFEDR 177

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1315 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1373
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1374 AQFIVISLRNNMF 1386
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 97.4 bits (241), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 59/191 (30%), Positives = 100/191 (52%), Gaps = 19/191 (9%)

Query: 156 IDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRAN-KMRQDRL 214
           +++L+++ FKSYA + V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRASNL 62

Query: 215 SDLIHKSEEFPNLQSCSVAVHFEYV--VDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYI 272
            DLI+K  +   +   SV + F+       P G     E  P + +TR+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNTDKSSSPIGF----ESYPKISVTRQIILGGTSKYLI 117

Query: 273 NGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIG 332
           NG  +    V  L ++  +++++  FLI+QG++  +  MK          +L  +E+  G
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 333 TANYKPLIEDR 343
           T     + EDR
Sbjct: 171 TR----MFEDR 177

 Score = 68.2 bits (165), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 81/140 (57%), Gaps = 1/140 (0%)

Query: 1247 RDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1306
            + +++E +E L + + D  +  +  +S+    ++  +     A+L   +  D  +EG+  
Sbjct: 1011 KTKIQETIEKLNEYKRDTLLKTWEKVSVDFGNIFGDLLPNSFAKLVPCEGKD-VTEGLEV 1069

Query: 1307 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1366
             V        ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + 
Sbjct: 1070 KVKLGSIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHL 1129

Query: 1367 IKERTKNAQFIVISLRNNMF 1386
            IK R K +QFIV+SL+  MF
Sbjct: 1130 IKTRFKGSQFIVVSLKEGMF 1149

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 97.4 bits (241), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/191 (29%), Positives = 102/191 (53%), Gaps = 19/191 (9%)

Query: 156 IDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           +++L+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMTTVRASSL 62

Query: 215 SDLIHKSEEFPNLQSCSVAVHFEYV--VDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYI 272
            DLI+K  +   +   SV + F+     + P G +      P + +TR+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNTDKSNSPIGFTN----SPQISVTRQVVLGGTSKYLI 117

Query: 273 NGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIG 332
           NG  +    V +L ++  +++++  FLI+QG++  +  MK          +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 333 TANYKPLIEDR 343
           T     + EDR
Sbjct: 171 T----KMFEDR 177

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1315 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1373
            W++ +  LSGG+++L +LAL+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALALIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1374 AQFIVISLRNNMF 1386
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 109/235 (46%), Gaps = 33/235 (14%)

Query: 684 RINGFHGRLGDLGVIDDN---FDVAIST-ACPRLDDVVVDTVECAQHCIDYLRKNKLGYA 739
           + N  +G +G L  +DD+   +  A+ T A  RL +VVV   + A   ++  R  K    
Sbjct: 519 KANLVYGVVGQLFELDDDKIRYSTALQTCAGGRLFNVVVQDSQTATQLLERGRLRK---- 574

Query: 740 RFILLDRLRQFNLQPVD----------TPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVA 789
           R  ++  L + + +P+            P  V    +L+K  D   + A   +  ++L+ 
Sbjct: 575 RVTIIP-LNKISTRPISPQVLELAKKIAPGKVELAINLIKF-DKSVTKAMEFIFGNSLIC 632

Query: 790 RDLKQANNVAYG-KRRFRVVTIDGKLIDISGTMSGGGNHVVKGLM-RIGK-NQSDRMDDY 846
            D + A  + +  K R R +T+ G + D  GT+SGG  +    L+  I K NQ  R  + 
Sbjct: 633 EDPETAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSDSLLVDIQKYNQIQRKIEI 692

Query: 847 TPEEVNKIENELSER----EKNFRVAND---TVHEMEQELKKVRDQEPDMESQIL 894
              ++N +  EL ++    +K   + ND   ++H++  +L K R+ E +  SQI+
Sbjct: 693 IQADLNHVTEELQKQYTTSQKTKTIQNDLNASLHKL--DLAK-RNLEVNPSSQIM 744

 Score = 33.9 bits (76), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 67/120 (55%), Gaps = 8/120 (6%)

Query: 1014 KQLKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILN-LKSDLEEQSEQLKEKV 1072
            +++   E +I++   +L+   ++   I+ D+ + D D    LN LK++L+  ++ L+E+ 
Sbjct: 752  REIGECENEIKIRQMDLERCRQEVSSIEKDMKEYDNDKGSKLNELKNELKSLAKNLEEQE 811

Query: 1073 AEMEGKIDEFKSLEMEMKNKLEKLNS----LLTYIKS--DIKQQEKELNELSIRDVTHTL 1126
            +E EGK D F++LE+E +    +L+S    L  Y+KS   +K +  EL E  IR +   L
Sbjct: 812  SESEGKYDLFQNLELETEQLSSELDSNKTLLQNYLKSIESLKSENTELEE-KIRSIEDNL 870

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
           Component of the condensin complex essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase Smc2p/Smc4p complex
           binds DNA possibly in the cleft formed by the
           coiled-coil of the folded dimer
          Length = 1170

 Score = 97.4 bits (241), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 106/198 (53%), Gaps = 16/198 (8%)

Query: 156 IDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           +++L+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 215 SDLIHKSEEFPNLQSCSVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYING 274
            DLI+K  +   +   SV + F    D+ + +    E  P + +TR+     +SKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF--TNDDKANSPIGFESYPKISVTRQIVLGGTSKYLING 119

Query: 275 KESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTA 334
             +    V  L ++  +++++  FLI+QG++  +  MK          +L  +E+  GT 
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGT- 171

Query: 335 NYKPLIEDRLSQIE-TLN 351
               + EDR  + E T+N
Sbjct: 172 ---KMFEDRREKAERTMN 186

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1315 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1373
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1374 AQFIVISLRNNMF 1386
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 97.1 bits (240), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/191 (29%), Positives = 103/191 (53%), Gaps = 19/191 (9%)

Query: 156 IDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           +++L+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 215 SDLIHKSEEFPNLQSCSVAVHFEYV--VDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYI 272
            DLI+K  +   +   SV + F     ++ P G +      P + +TR+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFNNTDKLNSPIGFTN----SPQISVTRQVVLGGTSKYLI 117

Query: 273 NGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIG 332
           NG  +    V +L ++  +++++  FLI+QG++  +  MK          +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 333 TANYKPLIEDR 343
           T     + EDR
Sbjct: 171 T----KMFEDR 177

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1315 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1373
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1374 AQFIVISLRNNMFELAQQL 1392
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
           SMC2Subunit of the condensin complex; essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase; Smc2p/Smc4p
           complex binds DNA; required for clustering of tRNA genes
           at the nucleolus
          Length = 1170

 Score = 97.1 bits (240), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/191 (29%), Positives = 103/191 (53%), Gaps = 19/191 (9%)

Query: 156 IDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           +++L+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 215 SDLIHKSEEFPNLQSCSVAVHFEYV--VDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYI 272
            DLI+K  +   +   SV + F+     + P G +      P + +TR+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNTDKSNSPIGFTN----SPQISVTRQVVLGGTSKYLI 117

Query: 273 NGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIG 332
           NG  +    V +L ++  +++++  FLI+QG++  +  MK          +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 333 TANYKPLIEDR 343
           T     + EDR
Sbjct: 171 T----KMFEDR 177

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1315 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1373
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1374 AQFIVISLRNNMFELAQQL 1392
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFANANRV 1155

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 74/157 (47%), Gaps = 15/157 (9%)

Query: 689 HGRLGDLGVIDDN---FDVAIST-ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
           HG +G L  ID++   +  A+ T A  RL +VVV   + A   ++  R  K      I L
Sbjct: 524 HGVVGQLFQIDNDNIRYATALQTCAGGRLFNVVVQDSQTATQLLERGRLRK--RVTIIPL 581

Query: 745 DRL--RQFNLQPVD-----TPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARDLKQANN 797
           D++  R  + Q +D      P  V    +L++  D   + A   +  ++L+  D + A  
Sbjct: 582 DKIYTRPISSQVLDLAKKIAPGKVELAINLIRF-DESITKAMEFIFGNSLICEDPETAKK 640

Query: 798 VAYG-KRRFRVVTIDGKLIDISGTMSGGGNHVVKGLM 833
           + +  K R R +T+ G + D  GT+SGG  +  + L+
Sbjct: 641 ITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSESLL 677

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
           YFR031C
          Length = 1171

 Score = 97.1 bits (240), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/191 (29%), Positives = 102/191 (53%), Gaps = 19/191 (9%)

Query: 156 IDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           +++L+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGITSMTTVRASNL 62

Query: 215 SDLIHKSEEFPNLQSCSVAVHFEYV--VDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYI 272
            DLI+K  +   +   SV + F+     + P G +        + +TR+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGITKASVTIVFDNTDKTNSPIGFNN----SAKISVTRQVVLGGTSKYLI 117

Query: 273 NGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIG 332
           NG  +    V +L ++  +++++  FLI+QG++  +  MK K        +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEAAG 170

Query: 333 TANYKPLIEDR 343
           T     + EDR
Sbjct: 171 T----KMFEDR 177

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1315 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1373
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1078 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1137

Query: 1374 AQFIVISLRNNMFELAQQL 1392
            +QFIV+SL+  MF  A ++
Sbjct: 1138 SQFIVVSLKEGMFSNANRV 1156

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
           (SMC2) - SMC chromosomal ATPase family member [contig
           149] FULL
          Length = 1170

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 61/199 (30%), Positives = 106/199 (53%), Gaps = 18/199 (9%)

Query: 156 IDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           +++L+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 215 SDLIHKSEEFPNLQSCSVAVHFEYVVDEPSGTSRID-EEKPGLVITRKAFRNNSSKYYIN 273
            DLI+K  +   +   SV + F    +     S I  E  P + +TR+     +SKY IN
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF---ANSDKNNSPIGFESYPKISVTRQIVLGGTSKYLIN 118

Query: 274 GKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGT 333
           G  +    V  L ++  +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 119 GHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGT 171

Query: 334 ANYKPLIEDRLSQIE-TLN 351
                + EDR  + E T+N
Sbjct: 172 ----KMFEDRREKAERTMN 186

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1315 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1373
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1374 AQFIVISLRNNMF 1386
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON}
           (46233..49748) [3516 nt, 1172 aa]
          Length = 1171

 Score = 96.3 bits (238), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 101/191 (52%), Gaps = 19/191 (9%)

Query: 156 IDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           +++L+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 215 SDLIHKSEEFPNLQSCSVAVHFEYV--VDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYI 272
            DLI+K  +   +   SV + F+     + P G     E  P + +TR+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNSDKSNAPIGF----ESSPTISVTRQVALGGTSKYLI 117

Query: 273 NGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIG 332
           NG  +    V  L ++  +++++  FLI+QG++  +  MK          +L  +E+  G
Sbjct: 118 NGHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 333 TANYKPLIEDR 343
           T     + EDR
Sbjct: 171 T----KMFEDR 177

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1315 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1373
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1374 AQFIVISLRNNMF 1386
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score = 95.9 bits (237), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 96/193 (49%), Gaps = 24/193 (12%)

Query: 152 GRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L ++NFKSY G   VG    +F ++VGPNGSGKSN++D++ FV G R++ +R 
Sbjct: 2   GRLI--GLEVKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRS 59

Query: 212 DRLSDLIHK-------SEEFPNLQSCSVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAFR 264
             L DLI++       S    N +S  V     YV  + SG  R  E       TR    
Sbjct: 60  SALVDLIYRGRMEEGGSAHENNPKSAYVTAF--YVKQDASGAERRME------FTRVIHN 111

Query: 265 NNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLL 324
              S Y ++GK   Y +   +L+ E I +  + FL+ QG+VE IA        +S   L 
Sbjct: 112 TGDSTYKLDGKTVGYKEYVDVLEGERILVKARNFLVFQGDVEQIAS-------QSGVDLT 164

Query: 325 EYLEDIIGTANYK 337
           +  E + G+  Y+
Sbjct: 165 KLFEQVSGSVQYQ 177

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 99/184 (53%), Gaps = 15/184 (8%)

Query: 156 IDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 214
           +++L+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +  + R   L
Sbjct: 3   VEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRASNL 62

Query: 215 SDLIHKSEEFPNLQSCSVAVHFEYV--VDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYI 272
            DLI+K  +   +   SV + F+     + P G +        + +TR+     +SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNSDKTNSPIGFNN----SSKISVTRQIILGGTSKYLI 117

Query: 273 NGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIG 332
           NG  +    V +L ++  +++++  FLI+QG++  +  MK        + +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP-------NEILSLIEEAAG 170

Query: 333 TANY 336
           T  +
Sbjct: 171 TKMF 174

 Score = 82.0 bits (201), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1315 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1373
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLVELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1374 AQFIVISLRNNMFELAQQL 1392
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 63/137 (45%), Gaps = 14/137 (10%)

Query: 700 DNFDVAIS---TACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRL--RQFNLQP 754
           D+FD A +    A  RL +VVVD  + A   ++  R  K      I L+++  R  N + 
Sbjct: 536 DHFDAASALQVCAGGRLYNVVVDNEKTASLLLEKGRLRK--RVTIIPLNKIAARTLNART 593

Query: 755 VD-----TPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARDLKQANNVAYGKR-RFRVV 808
           +       P  V    +L+   D + S A   +   +LV +D   A  V +  + R R +
Sbjct: 594 LQMAKDIAPGKVELALNLI-GYDDEVSRAMEFIFGGSLVCQDANTAKKVTFHPQIRTRSI 652

Query: 809 TIDGKLIDISGTMSGGG 825
           T+DG + D  GT+SGG 
Sbjct: 653 TLDGDVYDPEGTLSGGS 669

>KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 100/191 (52%), Gaps = 19/191 (9%)

Query: 156 IDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           +++L+++ FKSYA + V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQNL 62

Query: 215 SDLIHKSEEFPNLQSCSVAVHFEY--VVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYI 272
            DLI+K  +   +   SV + F      + P G     E    + ITR+      SKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFNNSDTSNSPIGF----ESHAKISITRQIILGGVSKYLI 117

Query: 273 NGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIG 332
           NG  +    V +L ++  +++++  FLI+QG++  +  MK +        +L  +E+  G
Sbjct: 118 NGHRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQE-------ILSLIEEAAG 170

Query: 333 TANYKPLIEDR 343
           T     + EDR
Sbjct: 171 TR----MFEDR 177

 Score = 70.1 bits (170), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 83/140 (59%), Gaps = 1/140 (0%)

Query: 1247 RDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1306
            + +++E +E L + + +  +  +  +S+    ++  +     A+LE  +  D  +EG+  
Sbjct: 1011 KQKIQETIEKLNEYKRETLIKTWEKVSVDFGNIFGDLLPNSFAKLEPSEGKD-VTEGLEV 1069

Query: 1307 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1366
             V   K    ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + 
Sbjct: 1070 KVKLGKIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHL 1129

Query: 1367 IKERTKNAQFIVISLRNNMF 1386
            IK R K +QFIV+SL+  MF
Sbjct: 1130 IKTRFKGSQFIVVSLKEGMF 1149

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
           complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score = 91.3 bits (225), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 58/168 (34%), Positives = 87/168 (51%), Gaps = 25/168 (14%)

Query: 152 GRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G +++ +R 
Sbjct: 2   GRLL--GLELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLRS 59

Query: 212 DRLSDLIHK----------SEEFPNLQSCSVAVHFEYVVDEPSGTSRIDEEKPGLVITRK 261
           + L DLI++          + E  N  S  V   ++             +E     + R 
Sbjct: 60  NVLKDLIYRGFLSGDDEDNNNEDVNPNSAYVKAFYQ-------------KEDVTHELMRS 106

Query: 262 AFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIA 309
              +  S Y IN K  +Y Q T  L++E I +  K FL+ QG+VE IA
Sbjct: 107 ISNSGDSTYKINNKTVSYKQYTSFLEDENILIKAKNFLVFQGDVEQIA 154

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 91.3 bits (225), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 119/243 (48%), Gaps = 41/243 (16%)

Query: 1207 GELTCYIDATNVDIGVLEEYARRLAE----FKRRKLDLNQAVQKRDEVKEQLE----ILK 1258
            GEL   +++ N DI  L    +R  E    F  ++ +L +  ++ DE K  ++     LK
Sbjct: 971  GELLQRLNSVNEDISGLSNVNKRAFENFKKFGEKRTELEERAEELDESKSSIQNLITRLK 1030

Query: 1259 KKRFDEFMTGFNIISMTLKEMYQMITMGGNAELEL------------------------- 1293
            +++ +   + FN +S    ++++ +   G A+L +                         
Sbjct: 1031 RQKVNAVDSTFNKVSENFSKVFEKLVPRGTAKLIIHRNTDIQEDPNDDEDVNMSDGDEND 1090

Query: 1294 ---VDSLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVM 1348
                 S++    GV+ SV     K   +++  LSGG+KT+ ++AL+ A+   +P P Y+ 
Sbjct: 1091 ESRSKSVEAMYSGVSISVSFNSKKNEQQHVEQLSGGQKTVCAVALILAIQMVEPAPFYLF 1150

Query: 1349 DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVK 1408
            DEIDAALD +  + VA+ IKE ++NAQFI  + R++M E+A +    Y+     K +TV 
Sbjct: 1151 DEIDAALDKQYRTAVASTIKELSENAQFICTTFRSDMLEVADKF---YRVKYENKISTVI 1207

Query: 1409 NID 1411
             +D
Sbjct: 1208 EVD 1210

 Score = 63.2 bits (152), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 87/186 (46%), Gaps = 15/186 (8%)

Query: 154 LFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++V++ FK+Y  + ++  F    + V+G NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIRRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSNDYANLKREE 60

Query: 214 LSDLIHKSEEFPNLQSCSVAVHFE---YVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKY 270
              LIH+     ++ S SV + F    + +  PSG   I   +   V  R+        Y
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFHDPSHRIILPSG---IPPRENDEVFVRRTVGLKKDDY 115

Query: 271 YINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDI 330
            +N +    + V ++L++ G  + +   ++ QG +  +   K       D   L  LE++
Sbjct: 116 QLNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIVALTNAK-------DRERLHLLEEV 168

Query: 331 IGTANY 336
           +G  ++
Sbjct: 169 VGAKSF 174

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
           Ashbya gossypii AGL023W
          Length = 1222

 Score = 90.5 bits (223), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 93/186 (50%), Gaps = 22/186 (11%)

Query: 159 LVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 218
           L L NFKSY G   VG  +  F ++VGPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELNNFKSYKGTHNVGFGNKHFISIVGPNGSGKSNMMDAISFVLGIRSNHLRSNALVDLI 66

Query: 219 HKS-------EEFPNLQSCSVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYY 271
           ++        E   + +S  V     Y+ D+        E+   +   R       S Y 
Sbjct: 67  YRGRMDDRSDEHVASPKSAYVKAF--YLKDDNG------EQGTKIEFMRIIQNTGDSVYR 118

Query: 272 INGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDII 331
           I+GK  ++ +  + L+ E I +  + FL+ QG+VE IA        +S   L +  E + 
Sbjct: 119 IDGKTVSFKRYVEYLEGESILVKARNFLVFQGDVEQIAS-------QSGIELTKLFEQVS 171

Query: 332 GTANYK 337
           G+  Y+
Sbjct: 172 GSVQYQ 177

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1227

 Score = 85.5 bits (210), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 119/437 (27%), Positives = 206/437 (47%), Gaps = 79/437 (18%)

Query: 1013 QKQL-KNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILN--LKSDLEEQSEQLK 1069
            QKQL + +   I   SN+L V  E  E I        T     LN  L S L  Q + ++
Sbjct: 805  QKQLLETISASISKISNDLTVTSEALESI--------TTTINTLNAELNSKLIPQQQDIE 856

Query: 1070 EKVAEMEGK------IDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVT 1123
             K++E+ G       ++E +SLE +     E+L+S     K+DI   + E++ L+  + T
Sbjct: 857  SKISEIGGGSIAQDLVEELRSLESQR----ERLDSEQEEAKNDIYTIQNEIDGLN-GEKT 911

Query: 1124 HTLLILD--NNQMDILDKEGEDRQETNQEDISGEAKGETQGEEGDNDDRHCMNIDETSDE 1181
            +   IL+  N+Q  +L K+ E+ Q++ ++ +  +    ++              DE   +
Sbjct: 912  NNEKILEKANSQQRLLLKKIENYQKSVEKTLIKKTTLASRR-------------DELQQK 958

Query: 1182 VSRGIPRLSEDELKELNI----ELLEGDIGELTCYIDA-TNVDIGVLEEYARRLAEF--- 1233
            + R I  L+ED L + N     +LLE  + E    I    NV+    E + RR  E    
Sbjct: 959  I-REIGLLAEDALNDFNSLSSEDLLEK-LNEANSEISKLVNVNKRAFENF-RRFGEKQTE 1015

Query: 1234 ---KRRKLDLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAE 1290
               + R+L+L++       ++E +E LK+++ +     F  +S    ++++ +   G  +
Sbjct: 1016 LVERSRELELSKI-----SIQELIEKLKEQKINAVDKTFRKVSENFVKVFETLVPRGTGK 1070

Query: 1291 LEL----------------VDSLD----PFSEGVTFSVMPPKKS--WRNITNLSGGEKTL 1328
            L +                 + +D    P   GV+ SV    K+    ++  LSGG+KT+
Sbjct: 1071 LVIHRTNQENSATPDLEDETNDMDIDAQPMYTGVSISVSFNSKNDEQLHVEQLSGGQKTV 1130

Query: 1329 SSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL 1388
             ++AL+ A+    P P Y+ DEIDAALD +  + VAN +KE +KNAQFI  + R +M ++
Sbjct: 1131 CAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANTLKELSKNAQFICTTFRTDMLQV 1190

Query: 1389 AQQLVGVYKRDNRTKST 1405
            A +   V K +N+  S 
Sbjct: 1191 ADKFFRV-KYENKISSV 1206

 Score = 70.1 bits (170), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 96/201 (47%), Gaps = 18/201 (8%)

Query: 154 LFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I +++++ FK+Y  + ++  F    + ++G NGSGKSN+  ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHHNIIIGSNGSGKSNLFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHK-SEEFPNLQSCSVAVHFE------YVVDEPSGTSRIDEEKPGLVITRKAFRNN 266
              LIH+ +    ++ SCSV + F        +    S   R + E    V  R+     
Sbjct: 61  RQGLIHQGTSGGSSVMSCSVEIVFHDPDNRMILASNASIVPRPNNE----VFIRRTVGLK 116

Query: 267 SSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEY 326
              Y IN +    + + ++L+  G  + +   ++ QG++  +   K K         L+ 
Sbjct: 117 KDDYQINDRNVTKSDIVRILETAGFSMSNPYNIVPQGKIIALTNAKDKER-------LQL 169

Query: 327 LEDIIGTANYKPLIEDRLSQI 347
           LED++G  +++  + D L +I
Sbjct: 170 LEDVVGAKSFEIKLNDSLKKI 190

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1223

 Score = 84.3 bits (207), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 113/238 (47%), Gaps = 37/238 (15%)

Query: 1208 ELTCYIDATNVDIGVLEEYARRLAE----FKRRKLDLNQAVQKRDEVKEQLE----ILKK 1259
            EL   ++A N DI  L+   ++  E    F  +KL+L    ++ DE K  ++     LK+
Sbjct: 972  ELLRKLNAVNEDISGLKNVNKKAFENFKKFHEKKLELEDRSKELDESKTSIQNLIVKLKQ 1031

Query: 1260 KRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDP-------------------- 1299
            ++     + F  +S    E+++ +   G A+L +  S D                     
Sbjct: 1032 QKVAAVDSTFENVSRNFTEVFEQLVPRGKAKLVIHRSSDARDDDVDAENDTAMTGDDDGT 1091

Query: 1300 ----FSEGVTFSVMPPKKSWR--NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1353
                   GV+ SV    K  R  ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDA
Sbjct: 1092 QTESMYTGVSISVSFNSKKTRQLHVEQLSGGQKTVCAVALILAIQMVDPAPFYLFDEIDA 1151

Query: 1354 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNID 1411
            ALD +  + VA  IK  + NAQFI  + R +M ++A +   V K +N  K +TV  +D
Sbjct: 1152 ALDKQYRTAVAGIIKALSANAQFICTTFRTDMLQVADKFFRV-KYEN--KISTVVEVD 1206

 Score = 70.5 bits (171), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 100/199 (50%), Gaps = 17/199 (8%)

Query: 154 LFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I +++++ FK+Y  + V+  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIRRVIIKGFKTYRNETVIDDFSPHHNIVIGSNGSGKSNFFAAIRFVLSGDYSNLKREE 60

Query: 214 LSDLIHKSEEFPNLQSCSVAVHF---EYVVDEPSGTS-RIDEEKPGLVITRKAFRNNSSK 269
              LIH+     ++ S SV + F   ++ +  PSG + R ++E    V+ R+        
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFHDPDHRIILPSGVAPRSNDE----VLVRRTVGLKKDD 114

Query: 270 YYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLED 329
           Y +N +      V ++L++ G  +++   ++ QG +  +   K K         L+ LED
Sbjct: 115 YQLNDRNVTKGDVVRMLESAGFSMNNPYNIVPQGRIIALTNAKDKER-------LQLLED 167

Query: 330 IIGTANYKPLIEDRLSQIE 348
           ++G  +++  +   L ++E
Sbjct: 168 VVGAKSFEVKLRASLKKME 186

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 84/184 (45%), Gaps = 11/184 (5%)

Query: 645 MQTILNAHRQRAMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDV 704
           + T+ N+ R  +     SL+      + +T   RL + GR+    G LG+L  +++ + +
Sbjct: 496 LDTVKNSERSVSETMAKSLANGIASVREITEKLRLPE-GRV---FGTLGELIKVNEKYKM 551

Query: 705 AISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENV-P 762
                    L  +VVDT E A   I  L + + G   F+ L+R+  +N   +  P N   
Sbjct: 552 CAEVVGGNSLFHIVVDTDETASLMIQELYRMRGGRVTFMPLNRI--YNDPNITYPPNAQS 609

Query: 763 RLFDLVKPK--DPKFSNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGT 820
               L+K    D +F +   +V   T+V RDL   + +A    +   +T+DG   D SG 
Sbjct: 610 SCTPLIKKIKFDAQFESVVKNVFGKTIVVRDLAAGSKIA-KHYKLDAITLDGDRADKSGL 668

Query: 821 MSGG 824
           ++GG
Sbjct: 669 LTGG 672

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
            complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 111/217 (51%), Gaps = 24/217 (11%)

Query: 1213 IDATNVDIGVLEEYARRLAE----FKRRKLDLNQAVQKRDE----VKEQLEILKKKRFDE 1264
            +++ N ++  L    +R +E    F  +K++LN+   + D+    ++  +E LK+++   
Sbjct: 977  LNSVNEEMSSLTNVNKRASENFRKFNEKKIELNERAAELDDSKVSIQNLIEKLKQQKVTA 1036

Query: 1265 FMTGFNIISMTLKEMYQMITMGGNAELEL------------VDSLDPFSEGVTFSVM--P 1310
              + F  +S     +++ +   G A+L +             +S +    G++ SV    
Sbjct: 1037 VDSTFKKVSENFSTVFEKLVPRGTAKLIIHRQEENKTRSKDKNSTESIYSGISISVSFNS 1096

Query: 1311 PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1370
             K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA+ IK  
Sbjct: 1097 KKNEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRAAVADVIKSL 1156

Query: 1371 TKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTV 1407
            + NAQFI  + R +M ++A +   V K +N+  ST V
Sbjct: 1157 SGNAQFICTTFRTDMLQVADKFFRV-KYENKI-STVV 1191

>Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {ON}
            YJL074C (SMC3) - SMC chromosomal ATPase family member
            [contig 224] FULL
          Length = 1247

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 86/177 (48%), Gaps = 26/177 (14%)

Query: 1245 QKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELEL----------- 1293
            Q ++ +++ +E LKK++ +     F+ ++     +++ +   G   L +           
Sbjct: 1041 QSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVPAGIGRLIIHRTTEKSNRGT 1100

Query: 1294 -------------VDSLDPFSEGVTFSVMPPKKSWRN--ITNLSGGEKTLSSLALVFALH 1338
                          D+LD    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+ 
Sbjct: 1101 GQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQ 1160

Query: 1339 KYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1395
               P P Y+ DEIDAALD +  + VAN IKE + +AQFI  + R +M ++A     V
Sbjct: 1161 MVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVADSFYRV 1217

 Score = 72.0 bits (175), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 94/198 (47%), Gaps = 9/198 (4%)

Query: 154 LFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  ++++ FK+Y     V  F   F+ V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 25  MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84

Query: 214 LSDLIHKSEEFPNLQSCSVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYIN 273
              LIH+     ++ S  V + F    D+   TS I   +  +V  R+       +Y +N
Sbjct: 85  RQGLIHQGT--GSIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKDEYSVN 142

Query: 274 GKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGT 333
           GK  + + ++++ ++ G    +   ++ QG +  +   K K         L  LED++G 
Sbjct: 143 GKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKER-------LLLLEDVVGA 195

Query: 334 ANYKPLIEDRLSQIETLN 351
            +++  + +   ++E  N
Sbjct: 196 RSFEIKLRESSKKMEATN 213

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1174

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1315 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1373
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1081 WKESLVELSGGQRSLVALSLILALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1140

Query: 1374 AQFIVISLRNNMFELAQQL 1392
            AQFIV+SL+  MF  A ++
Sbjct: 1141 AQFIVVSLKEGMFTNANRV 1159

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 69/155 (44%), Gaps = 21/155 (13%)

Query: 686 NGFHGRLGDLGVIDDNFDVAISTA-----CP--RLDDVVVDTVECAQHCIDYLRKNKLGY 738
           N   G    L  I+DN   AI +A     C   RL +VVVD    A   ++  R  K   
Sbjct: 525 NSVKGVAATLFTINDN---AIESASALQVCAGGRLYNVVVDNETTASQLLEKGRLRK--R 579

Query: 739 ARFILLDRL--RQFNLQPVD-----TPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARD 791
              I L+++  R+ N   V+      P  V    +L+   D + S A   +   +L+ +D
Sbjct: 580 VTIIPLNKIASRRLNENTVNFAKQLAPGKVDLALNLIGYSD-ELSRAMEFIFGTSLICKD 638

Query: 792 LKQANNVAYGKR-RFRVVTIDGKLIDISGTMSGGG 825
            + A  V + +  R R +T++G + D  GT+SGG 
Sbjct: 639 SETAKKVTFHQNIRQRSITLEGDVYDPEGTLSGGS 673

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1170

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 58/81 (71%), Gaps = 1/81 (1%)

Query: 1313 KSWR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1371
            K W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 KLWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1372 KNAQFIVISLRNNMFELAQQL 1392
            K +QFIV+SL+  MF  A ++
Sbjct: 1135 KGSQFIVVSLKEGMFNNANRV 1155

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
            YFR031C (REAL)
          Length = 1170

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1315 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1373
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1374 AQFIVISLRNNMFELAQQL 1392
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

 Score = 41.2 bits (95), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 70/161 (43%), Gaps = 12/161 (7%)

Query: 682 SGRINGFHGRLGDLGVIDDNFDVAIST-ACPRLDDVVVDTVECAQHCIDYLRKNKLGYAR 740
           +  + G  GRL  L   +  +  A+ T A  RL +VVV   + A   ++  R  K     
Sbjct: 520 TSSVYGVVGRLFQLDNDNIRYSSALQTCAGGRLFNVVVRDSQTATQLLEGGRLRK--RVT 577

Query: 741 FILLDRLRQFNLQP-------VDTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARDLK 793
            I LD++    + P          P  V    +L++   P  + A   +  ++L+  D +
Sbjct: 578 IIPLDKIYTRPITPQVLELAKSIAPGKVELAINLIRFDKP-VTKAMEFIFGNSLICDDPE 636

Query: 794 QANNVAYG-KRRFRVVTIDGKLIDISGTMSGGGNHVVKGLM 833
            A  + +  K R R +T+ G + D  GT+SGG  +  + L+
Sbjct: 637 TAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSQSLL 677

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1170

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1315 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1373
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1374 AQFIVISLRNNMF 1386
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 104/467 (22%), Positives = 192/467 (41%), Gaps = 86/467 (18%)

Query: 686  NGFHGRLGDLGVIDD-NFDVAIS---TACPRLDDVVVDTVECAQHCIDYLRKNKLGYARF 741
            N   G    L  +D+ NF  A +    A  RL +VVVD    A   ++  R  K   A  
Sbjct: 521  NSVKGIAAQLFSLDEQNFYSATALQVCAGGRLFNVVVDNENTAAQLLERGRLRK--RATI 578

Query: 742  ILLDRL--RQFNLQPVD-----TPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARDLKQ 794
            I L+++  R  N   V+      P  V    +L+  ++ +   A   +   +LV +D + 
Sbjct: 579  IPLNKIAARTLNDNIVNMAKSVAPGRVELALNLIGYEE-EVRRAMEFIFGSSLVCKDAEA 637

Query: 795  ANNVAYG-KRRFRVVTIDGKLIDISGTMSGGGNHVVKGLM----------RIGKNQSDRM 843
            A  V +  K R R +T+DG + D  GT+SGG  +    L+           + K    ++
Sbjct: 638  AKMVTFNPKIRTRSITLDGDVYDPEGTLSGGSRNNTSSLLIDIQRYNNNCNLVKELETKL 697

Query: 844  DDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRXXXXXXXX 903
            +D   +    I+ E+S + KN +       E+E    K++  E +++S            
Sbjct: 698  NDIAKKIA--IQFEISNKTKNLQ------KELELAQHKLKLSERNLQS------------ 737

Query: 904  XXXXXXXXXQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKERIKALQ 963
                                  N  AQL   ++  E L  E    + E K K  +IK L+
Sbjct: 738  ----------------------NTAAQL---IRKNEELESEIAQCKEEIKDKTSQIKQLK 772

Query: 964  DQIMKIGGTNLQI---QNSKVESLSQRIDILVAXXXXXXXXXXXXXXDVTKFQKQLKNVE 1020
             QI KI     +    + SK++ L + ++ +                    FQ +++ + 
Sbjct: 773  KQIAKIEKDADEFSHDKGSKLDELRREVESMSVQISEEEQRCETQYDAYQNFQLEIEQLG 832

Query: 1021 RDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKID 1080
             DI+ S + L+  E   ++++ ++ ++D ++    +L   L+++  +L+E+   + G  D
Sbjct: 833  GDIDSSKDTLEQAELTVKKLQTEVSEHDMNLR---DLNQALQDKQVELEEERNRLMGIDD 889

Query: 1081 EFKSLEMEMKNK----------LEKLNSLLTYIKSDIKQQEKELNEL 1117
            E K +E  +K+K          ++K+N  L  ++S     E EL +L
Sbjct: 890  ELKEIEALIKSKTDIKNNAELDIQKINHELNKLRSTSNSFESELAQL 936

>KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1224

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 62/103 (60%), Gaps = 2/103 (1%)

Query: 1295 DSLDPFSEGVTFSVMPPKKSWRN--ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1352
            DS++    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1092 DSIETMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1151

Query: 1353 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1395
            AALD +  + VAN IKE + +AQFI  + R++M ++A     V
Sbjct: 1152 AALDKQYRTSVANVIKELSVHAQFICTTFRSDMLQVADSFYRV 1194

 Score = 69.7 bits (169), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 94/202 (46%), Gaps = 17/202 (8%)

Query: 154 LFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  +V++ FK+Y     V      F+ ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKSVVIQGFKTYKNTTSVEGLSPRFNVIIGGNGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEEFPNLQSCSVAVHFEYVVDEPSG----TSRIDEEKPGLVITRKAFRNNSSK 269
              LIH+           ++ + E +  +PSG    TS I   +  +V  R+       +
Sbjct: 61  RQGLIHQG------TGSVMSAYVEIIFHDPSGQMMITSGIPMTEEHIVRVRRTIGLKKDE 114

Query: 270 YYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLED 329
           Y +NGK  + + ++++ ++ G    +   ++ QG +  +   K       D   L  LE+
Sbjct: 115 YSVNGKTCHKSDISRMFESVGFSAVNPYNIVPQGRIVAVTNAK-------DRERLALLEE 167

Query: 330 IIGTANYKPLIEDRLSQIETLN 351
           ++G  +++  + +   ++E  N
Sbjct: 168 VVGAKSFEIKLRESAKKMEATN 189

>SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1229

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 58/94 (61%), Gaps = 2/94 (2%)

Query: 1298 DPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1355
            D    GV+ SV     +    ++  LSGG+KT+ ++AL+ A+ K  P P Y+ DEIDAAL
Sbjct: 1098 DIVYTGVSISVSFNSRQDEQLHVEQLSGGQKTVCAIALILAIQKVDPAPFYLFDEIDAAL 1157

Query: 1356 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1389
            D +  + VAN IKE + NAQFI  + R++M  +A
Sbjct: 1158 DKQYRTSVANTIKELSANAQFICTTFRSDMLRVA 1191

 Score = 71.2 bits (173), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 94/202 (46%), Gaps = 18/202 (8%)

Query: 154 LFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++ ++ FK+Y    ++  F    + V+G NGSGKSN   ++ FV     N ++++ 
Sbjct: 1   MYIKRVTIQGFKTYKNTTLIDNFSPHHNVVIGSNGSGKSNFFAAIRFVLSDDYNNLKREE 60

Query: 214 LSDLIHKSEEFPNLQSCSV-AVHFEYVVDEPSG---TSRIDEEKPGLVITRKAFRNNSSK 269
              LIH+        S SV + + E V D   G    +      P  V+ R+       +
Sbjct: 61  RQGLIHQG-------SGSVMSAYVEIVFDNSDGRLLNAAASPSSPDEVVIRRTIGLKKDE 113

Query: 270 YYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLED 329
           Y +N K  +  ++  LL++ G    +  +++ QG +  +   K       D   L+ L++
Sbjct: 114 YSLNSKSCSKIEIKNLLESAGFSTANPYYIVPQGRIVALTNAK-------DYERLQLLKE 166

Query: 330 IIGTANYKPLIEDRLSQIETLN 351
           + G  +++  + D L++++  N
Sbjct: 167 VTGANSFEKKLRDSLNKMDATN 188

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_1.295
            YJL074C
          Length = 1227

 Score = 80.1 bits (196), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 46/122 (37%), Positives = 73/122 (59%), Gaps = 5/122 (4%)

Query: 1292 ELVDSLDPFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1349
            E++++ +    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ D
Sbjct: 1092 EVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFD 1151

Query: 1350 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKN 1409
            EIDAALD +  + VAN IK+ + NAQFI  + R +M ++A +   V K +N  K +TV  
Sbjct: 1152 EIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRV-KYEN--KISTVIE 1208

Query: 1410 ID 1411
            +D
Sbjct: 1209 VD 1210

 Score = 70.5 bits (171), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 98/198 (49%), Gaps = 13/198 (6%)

Query: 154 LFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++V++ FK+Y  + V+  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEEFPNLQSCSVAVHF---EYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKY 270
              LIH+     ++ S SV + F   E+ +  PSG   +  E    +  R+        Y
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPEHKMILPSGV--VPRENNDEICIRRTVGLKKDDY 117

Query: 271 YINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDI 330
            +N +      V ++L++ G  + +   ++ QG++ ++   K K         L+ LED+
Sbjct: 118 QLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKER-------LQLLEDV 170

Query: 331 IGTANYKPLIEDRLSQIE 348
           +G  +++  ++  L ++E
Sbjct: 171 VGAKSFEVKLKASLKKME 188

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 66/143 (46%), Gaps = 7/143 (4%)

Query: 686 NGFHGRLGDLGVIDDNFDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
           +   G LG+L  +++ + +         L  +VVDT E A   +  L K K G   FI L
Sbjct: 535 DSVFGTLGELINVNEKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPL 594

Query: 745 DRLR-QFNLQ--PVDTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARDLKQANNVAYG 801
           +R+    N+Q  P D     P L + +K  D +F  A   +   T+V +DL     ++  
Sbjct: 595 NRIYLDANIQYPPNDQTSFTP-LINKIKY-DQRFDKAVRHIFGKTIVVKDLTTGLRIS-K 651

Query: 802 KRRFRVVTIDGKLIDISGTMSGG 824
           K +   +T+DG   D  G ++GG
Sbjct: 652 KFKLNSITLDGDRADKRGVLTGG 674

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1225

 Score = 79.7 bits (195), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 59/101 (58%), Gaps = 2/101 (1%)

Query: 1297 LDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1354
            L+    GV+ SV     K     +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1095 LESVYTGVSISVSFSSKKNEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1154

Query: 1355 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1395
            LD +  + VAN IK+ +KNAQFI  + R +M  +A +   V
Sbjct: 1155 LDKQYRTSVANAIKKLSKNAQFICTTFRTDMLAVADRFYRV 1195

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 89/187 (47%), Gaps = 17/187 (9%)

Query: 154 LFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++V++ FK+Y  + ++  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEEFPNLQSCSVAVHF---EYVVDEPSGT-SRIDEEKPGLVITRKAFRNNSSK 269
              LIH+     ++ S SV + F   ++ +   SG   R ++E    V  R+        
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFHDPDHRIILSSGVIPRPNDE----VFVRRTVGLKKDD 114

Query: 270 YYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLED 329
           Y IN +    + + ++L++ G  +     ++ QG +  +   K K         L  LED
Sbjct: 115 YQINDRNVTKSDLVRMLESAGFSMGSPYNIVPQGRIIALTNAKDKER-------LLLLED 167

Query: 330 IIGTANY 336
           +IG  ++
Sbjct: 168 VIGAKSF 174

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 60/143 (41%), Gaps = 6/143 (4%)

Query: 686 NGFHGRLGDLGVIDDNF-DVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
           +   G LG+L  + + +   A       L  VVVDT + A   +  L K K G   F+ L
Sbjct: 533 DAVFGTLGELLKVSEKYKTCAEVVGGNSLFHVVVDTDKTASLLMRELYKMKGGRVTFMPL 592

Query: 745 DRLRQ---FNLQPVDTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARDLKQANNVAYG 801
           +RL +       P D       L   +K  D KF  A   V   T+V RDL     +A  
Sbjct: 593 NRLHEDSGVTFPPQDQSAACTPLLKKIKY-DAKFEKAVKHVFGKTIVVRDLTTGVKMAKS 651

Query: 802 KRRFRVVTIDGKLIDISGTMSGG 824
             +   +T+DG   D  G ++GG
Sbjct: 652 -YQLNAITLDGDRADNRGVLTGG 673

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1229

 Score = 78.6 bits (192), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 68/117 (58%), Gaps = 5/117 (4%)

Query: 1297 LDPFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1354
            ++P   GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1099 IEPIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1158

Query: 1355 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNID 1411
            LD +  + VA  I++ + NAQFI  + R +M E+A     V K +N  K +TV  ID
Sbjct: 1159 LDKQYRTSVAKLIEKLSANAQFICTTFRTDMLEVADTFFRV-KYEN--KISTVIEID 1212

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 90/187 (48%), Gaps = 16/187 (8%)

Query: 154 LFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++V++ FK+Y  + ++  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEEFPNLQSCSVAVHFE---YVVDEPSG-TSRIDEEKPGLVITRKAFRNNSSK 269
              LIH+      + S SV + F    + +  PSG   R ++E    V  R+        
Sbjct: 61  RQGLIHQGSGGA-VMSASVEIVFHDPNHKIILPSGVVPRENDE----VYIRRTVGLKKDD 115

Query: 270 YYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLED 329
           Y +N +      V ++L++ G  +++   ++ QG++  +   K K         L  LED
Sbjct: 116 YQLNDRNVTKGDVVRMLESTGFSMNNPYNIVPQGKIIALTNAKDKER-------LNLLED 168

Query: 330 IIGTANY 336
           ++G  ++
Sbjct: 169 VVGAKSF 175

 Score = 36.6 bits (83), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 97/421 (23%), Positives = 164/421 (38%), Gaps = 89/421 (21%)

Query: 418 NKDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERT 477
           N+   S+K   +   KE++    +  +I  R     ++E    L+         +L+ER 
Sbjct: 328 NEQTNSDKSNLELINKEIESRRLKLSKISPRFQQLTNEESRFKLQSN-------TLKERQ 380

Query: 478 KNLVNKMGKAEKILKSTNHSISXXXXXXXXXXXXXXXXXXXVKDLNQSLEEERRILDDIK 537
           ++L+ K G+  +      H+                      ++ N+ +E E + L+ ++
Sbjct: 381 RDLLLKKGRYSRF-----HT---------------------AQERNEWIENEIKELNQLQ 414

Query: 538 LSLKD-KTKDISAEIIQHEKD-----LEPWDLQLQEKKSQIQXXXXXXXXXXXTQVKLKK 591
            SL D KTK+      + EKD     +   D ++QE    IQ                  
Sbjct: 415 QSLNDTKTKN------KIEKDEVAERINTIDEEIQELNDSIQGPSI-------------- 454

Query: 592 NAEALEENIAAKKARKQELQGFILDLKKNLKSLIDGRSQ---GEKDFSTAHLKLKEMQTI 648
           NAE             ++L+  I D+K+   S ID R +    E+   T       +QTI
Sbjct: 455 NAEL------------EDLESNIDDIKQQYNSSIDQRKELWRNEQKLETV------LQTI 496

Query: 649 LNAHR--QRAMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAI 706
           L+  +  +RA+      S A     V     +L+     +   G LG+L  ++  +    
Sbjct: 497 LDNVKDSERAVGETMDRSLANGLKSVKEIAEKLKLPE--DSVFGTLGELVSVNSKYKTCA 554

Query: 707 ST-ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLF 765
                  L  V+VDT E A   +  L + K G   FI L+++  F+      PE+     
Sbjct: 555 EVIGGNSLFHVIVDTEETASKIMKELYRMKGGRVTFIPLNKVY-FDNSITFPPEDQSSYT 613

Query: 766 DLVK--PKDPKFSNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSG 823
            L+K    D KF  A   V   T+V +DL     +A  K +   +T+DG   D  G ++G
Sbjct: 614 PLIKKIKYDEKFDKAVKHVFGKTIVVKDLSTGLKLA-KKYKLSAITLDGDRADKRGVLTG 672

Query: 824 G 824
           G
Sbjct: 673 G 673

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] {ON}
            YJL074C (REAL)
          Length = 1229

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 104/215 (48%), Gaps = 36/215 (16%)

Query: 1217 NVDIGVLEEYARRLAE----FKRRKLDLNQAVQKRDEVKEQLE----ILKKKRFDEFMTG 1268
            N +I  L+   +R  E    F  ++ DL++   + DE K+ ++     LK+++ +   + 
Sbjct: 985  NTEISGLKNVNKRAFENFKKFDEKRKDLSERASELDESKDSIQDLIVKLKQQKVNAVDST 1044

Query: 1269 FNIISMTLKEMYQMITMGGNAELEL---------VDSLDP-----------------FSE 1302
            F  +S   + +++ +   G A+L +         +DS+D                     
Sbjct: 1045 FQKVSENFEAVFERLVPRGIAKLVIHRRDDTKDQMDSIDDDMDVASSERTSSKDGDIMYT 1104

Query: 1303 GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1360
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1105 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1164

Query: 1361 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1395
            + VA  IKE +KNAQFI  + R +M ++A +   V
Sbjct: 1165 TAVATLIKELSKNAQFICTTFRTDMLQVADKFFRV 1199

 Score = 68.9 bits (167), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 100/199 (50%), Gaps = 16/199 (8%)

Query: 154 LFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I +++++ FK+Y  + ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEEFPNLQSCSVAVHF---EYVVDEPSGT-SRIDEEKPGLVITRKAFRNNSSK 269
              LIH+     ++ S SV + F   ++ +  PSG  SR D+E    V  R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 270 YYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLED 329
           Y +N +      + ++L+  G  +++   ++ QG++  +   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 330 IIGTANYKPLIEDRLSQIE 348
           ++G  +++  ++  L ++E
Sbjct: 169 VVGAKSFEVKLKASLKKME 187

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 76.6 bits (187), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 82/152 (53%), Gaps = 5/152 (3%)

Query: 1257 LKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKS-- 1314
            LK+++ +     FN +S    ++++ +   G  EL +      +S GV+  V    K+  
Sbjct: 955  LKEQKVNAVERTFNQVSENFSDIFEQLVPRGTGELVIGRQGQEYS-GVSIQVSFNSKNDE 1013

Query: 1315 WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA 1374
               I  LSGG+KT+ ++AL+ A+ +  P P Y+ DEIDAALD      V+  IK  ++N 
Sbjct: 1014 QLQIEQLSGGQKTVCAIALILAIQQVDPAPFYLFDEIDAALDKEYRKSVSQVIKRLSQNG 1073

Query: 1375 -QFIVISLRNNMFELAQQLVGVYKRDNRTKST 1405
             QFI+ + R++M E+A  ++ + K  N+  S 
Sbjct: 1074 TQFILTTFRSDMIEIA-DMIYMVKYHNKVSSV 1104

 Score = 57.0 bits (136), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 69/141 (48%), Gaps = 5/141 (3%)

Query: 687 GFHGRLGDLGVIDDNFDVAIST-ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLD 745
             +G LG+L  + + +   +   A   L +++VDT E A   ++ L + + G   FI L+
Sbjct: 460 SIYGTLGELIKVSEKYKRCVEIIAGNSLFNIIVDTDETASQIMNELIRMQNGRVTFIPLN 519

Query: 746 RLRQ-FNLQ-PVDTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARDLKQANNVAYGKR 803
           R+    N+  P +   N   L   +K  D KF     +V   T+V +DL+  N +   + 
Sbjct: 520 RIENGVNINYPSNEESNCTALIKKIKY-DKKFEKVIRNVFGKTIVVKDLQLGNRLC-KEF 577

Query: 804 RFRVVTIDGKLIDISGTMSGG 824
           + + +T+DG  ID  G +SGG
Sbjct: 578 KLQAITLDGDRIDSKGVVSGG 598

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 75.9 bits (185), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 60/216 (27%), Positives = 102/216 (47%), Gaps = 37/216 (17%)

Query: 1217 NVDIGVLEEYARRLAE----FKRRKLDLNQAVQKRDEVKEQLE----ILKKKRFDEFMTG 1268
            N +I  L+   +R  E    F  ++ DL+    + DE K+ ++     LK+++     + 
Sbjct: 985  NTEISSLKNVNKRAFENFKKFNEKRKDLSGRASELDESKDSIQDLIVKLKQQKVSAVDST 1044

Query: 1269 FNIISMTLKEMYQMITMGGNAELELV----DSLDPFSE---------------------- 1302
            F  +S   K +++ +   G A+L +     DS+D  ++                      
Sbjct: 1045 FQKVSENFKTVFERLVPRGTAKLVIHRRNEDSIDQANDVDVDMDTGNNEDTINKEGETVY 1104

Query: 1303 -GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1359
             GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD + 
Sbjct: 1105 TGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQY 1164

Query: 1360 VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1395
             + VA  IKE + NAQFI  + R +M ++A +   V
Sbjct: 1165 RTAVATMIKELSTNAQFICTTFRTDMLQVADKFFRV 1200

 Score = 70.1 bits (170), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 110/224 (49%), Gaps = 23/224 (10%)

Query: 154 LFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++V++ FK+Y  + ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEEFPNLQSCSVAVHF---EYVVDEPSGT-SRIDEEKPGLVITRKAFRNNSSK 269
              LIH+     ++ S SV + F   ++ +  PSG  SR D+E    V  R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 270 YYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLED 329
           Y +N +      + ++L+  G  +++   ++ QG++  +   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 330 IIGTANYKPLIEDRLSQIETLNEICLEKENRFEIVNREKNSLES 373
           ++G  +++  ++  L ++E       E E +   +N+E + L S
Sbjct: 169 VVGAKSFEVKLKASLKKME-------ETEQKKTQINKEMDELNS 205

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 65/142 (45%), Gaps = 11/142 (7%)

Query: 690 GRLGDLGVIDDNFDVAIST-ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLR 748
           G LG+L  ++D +           L  +VVDT E A   ++ L + K G   FI L++L 
Sbjct: 538 GTLGELIKVNDKYKACAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNKL- 596

Query: 749 QFNLQP-VDTPENVP---RLFDLVKP--KDPKFSNAFYSVLRDTLVARDLKQANNVAYGK 802
             +L   V  P N     +   L+K     P+F  A   V   T+V +DL Q   +A  K
Sbjct: 597 --SLDADVKFPSNSTTQIQFTPLIKKIKYQPRFEKAVKHVFGKTIVVKDLGQGLKLA-KK 653

Query: 803 RRFRVVTIDGKLIDISGTMSGG 824
            +   +T+DG   D  G ++GG
Sbjct: 654 HKLNAITLDGDRADKRGVLTGG 675

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1216

 Score = 75.9 bits (185), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 87/168 (51%), Gaps = 19/168 (11%)

Query: 1247 RDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELEL-------VDSLDP 1299
            ++ ++E +  LK+++     T F  +S    ++++ +   G A L +       + S+D 
Sbjct: 1019 KNSIQELITQLKEQKITAVDTTFKKVSENFTKVFEKLVPRGTANLIIHRRSDDSLASMDI 1078

Query: 1300 FSE----------GVTFSVMPPKK--SWRNITNLSGGEKTLSSLALVFALHKYKPTPLYV 1347
             ++          GV+ SV    K     ++  LSGG+KT+ ++A++ A+    P P Y+
Sbjct: 1079 NTDSQNISELVYTGVSISVSFNSKRDEQLHVEQLSGGQKTVCAIAMILAIQMVDPAPFYL 1138

Query: 1348 MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1395
             DEIDAALD +  + VA+ IK  + NAQFI  + R +M ++A +   V
Sbjct: 1139 FDEIDAALDKQYRTAVADVIKSLSSNAQFICTTFRTDMLQVADKFFRV 1186

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/198 (21%), Positives = 94/198 (47%), Gaps = 15/198 (7%)

Query: 154 LFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I K++++ FK+Y  + ++  F   ++ ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIQKVIIKGFKTYRNETIIDDFSPHYNIIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEEFPNLQSCSVAVHFEYVVDE---PSGTSRIDEEKPGLVITRKAFRNNSSKY 270
              LIH+     ++ S SV + F    +    PSG +         V  R+        Y
Sbjct: 61  RQGLIHQGS--GSVMSASVEIQFYDPGNSMILPSGVAV---NPDSTVSIRRTVGLKKDDY 115

Query: 271 YINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDI 330
            IN +    + + +++++ G  + +   ++ QG +  +   K K         L+ LED+
Sbjct: 116 QINDRNVTKSDIVRMMESTGFSMSNPYNIVPQGRIVALTNAKDKER-------LQILEDV 168

Query: 331 IGTANYKPLIEDRLSQIE 348
           +G  +++  +   L ++E
Sbjct: 169 VGAKSFEAKLTASLKKME 186

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 69/141 (48%), Gaps = 11/141 (7%)

Query: 690 GRLGDLGVIDDNFD-VAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLR 748
           G LG+L  + + +   A       L ++VVDT E A   +D L + K G   F+ L+R+R
Sbjct: 537 GTLGELIKVSEKYKRCAEVIGGNSLFNIVVDTDETASLIMDELYRMKGGRVTFMPLNRIR 596

Query: 749 ---QFNLQPVDTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARDLKQANNVAYGKRRF 805
               F   P D     P L   +K  D ++  A   V   T+V +DL + + +A   +RF
Sbjct: 597 MDSNFTYPPNDQASCTP-LIKKIKF-DVRYEKAVMHVFGKTIVVKDLGEGSKLA---KRF 651

Query: 806 RV--VTIDGKLIDISGTMSGG 824
           ++  +T+DG   D  G ++GG
Sbjct: 652 KMNAITLDGDRADKRGELTGG 672

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
            SMC3Subunit of the multiprotein cohesin complex required
            for sister chromatid cohesion in mitotic cells; also
            required, with Rec8p, for cohesion and recombination
            during meiosis; phylogenetically conserved SMC
            chromosomal ATPase family member
          Length = 1230

 Score = 75.5 bits (184), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 57/95 (60%), Gaps = 2/95 (2%)

Query: 1303 GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1360
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1361 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1395
            + VA  +KE +KNAQFI  + R +M ++A +   V
Sbjct: 1166 TAVATLLKELSKNAQFICTTFRTDMLQVADKFFRV 1200

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074c SMC3 required for structural maintenance of
            chromosomes
          Length = 1219

 Score = 75.1 bits (183), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 63/109 (57%), Gaps = 4/109 (3%)

Query: 1299 PFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1356
            P+ EGV+ SV    K      +  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDAALD
Sbjct: 1092 PY-EGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALD 1150

Query: 1357 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKST 1405
             +    VA  I + + NAQFI  + R++M + A +   V K +N+  S 
Sbjct: 1151 KQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRV-KYENKQSSV 1198

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 69/140 (49%), Gaps = 8/140 (5%)

Query: 690 GRLGDLGVIDDNFDVAIST-ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLR 748
           G +G+L  +++ + V         L  VVVDT E A   ++ L + K G   F+ L++L+
Sbjct: 539 GTVGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLK 598

Query: 749 QFNLQPVDTPE--NVPRLFDLVKPK-DPKFSNAFYSVLRDTLVARDLKQANNVAYGKR-R 804
             N Q +D P   N+P    + K K D +F      V    LV +DL   N ++  K+ +
Sbjct: 599 NGN-QNIDYPSDPNIPCTPLIKKIKYDMQFDCVVKQVFGRALVVKDL--TNGLSISKQYK 655

Query: 805 FRVVTIDGKLIDISGTMSGG 824
              +T+DG  +D  G ++GG
Sbjct: 656 LSCITLDGDRVDGKGVLTGG 675

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score = 73.2 bits (178), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 62/114 (54%), Gaps = 5/114 (4%)

Query: 1296 SLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1353
            S D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDA
Sbjct: 1099 SQDSIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDA 1158

Query: 1354 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTV 1407
            ALD +  + VA  +K+ +  AQFI  + R +M  +A +    Y+ +   K +TV
Sbjct: 1159 ALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVADRF---YRVNFENKISTV 1209

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 72.4 bits (176), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 56/95 (58%), Gaps = 2/95 (2%)

Query: 1303 GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1360
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1361 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1395
            + VA  IKE + +AQFI  + R +M ++A +   V
Sbjct: 1166 TAVATLIKELSNDAQFICTTFRTDMLQVADKFFRV 1200

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 99/199 (49%), Gaps = 16/199 (8%)

Query: 154 LFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++V++ FK+Y  + ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEEFPNLQSCSVAVHF---EYVVDEPSGT-SRIDEEKPGLVITRKAFRNNSSK 269
              LIH+     ++ S SV + F   ++ +  PSG  SR D+E    V  R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 270 YYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLED 329
           Y +N +      + ++L+  G  + +   ++ QG++  +   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMTNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 330 IIGTANYKPLIEDRLSQIE 348
           ++G  +++  ++  L ++E
Sbjct: 169 VVGAKSFEVKLKASLKKME 187

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 65/141 (46%), Gaps = 9/141 (6%)

Query: 690 GRLGDLGVIDDNFD-VAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLR 748
           G LG+L  ++D +   A       L  +VVDT E A   ++ L + K G   FI L+RL 
Sbjct: 538 GTLGELIKVNDKYKACAEVVGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRL- 596

Query: 749 QFNLQPVDTPENVP---RLFDLVKP--KDPKFSNAFYSVLRDTLVARDLKQANNVAYGKR 803
            F    V  P N     +   L+K     P+F  A   V   T+V ++L Q   +A  K 
Sbjct: 597 -FLDSDVKFPSNTTTQIQFTPLIKKIKYQPRFEKAVKHVFGKTIVVKELGQGLKLA-KKH 654

Query: 804 RFRVVTIDGKLIDISGTMSGG 824
           +   +T+DG   D  G ++GG
Sbjct: 655 KLNAITLDGDRADKRGLLTGG 675

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 69.7 bits (169), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 1318 ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1377
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1117 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1176

Query: 1378 VISLRNNMFELAQQLVGVYKRDNRTKSTT 1406
              + R +M  +A     V K +N+  + T
Sbjct: 1177 CTTFRTDMINVADTFFRV-KFENKVSTVT 1204

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 90/201 (44%), Gaps = 22/201 (10%)

Query: 154 LFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFG-FRANKMRQD 212
           + I  +++  FK+Y  + VV  F    + VVG NGSGKSN   ++ FV     +N  R+D
Sbjct: 2   VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKRED 61

Query: 213 RLSDLIHKSEEFPNLQSCSVAVHFEYVVDEPS----GTSRIDEEKPGLVITRKAFRNNSS 268
           R   +   + +        ++   E + D+P        R D    G V  R+       
Sbjct: 62  RKGFIYQGAGQV-------MSAFVEIIFDDPENLMLAPLRND---TGEVRIRRTVGLKKD 111

Query: 269 KYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLE 328
           +Y IN K S    V ++L+N G    +   ++ QG + ++   K       D   L  LE
Sbjct: 112 EYMINDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAK-------DLERLHLLE 164

Query: 329 DIIGTANYKPLIEDRLSQIET 349
           D++G  +++  +++ L ++E 
Sbjct: 165 DVVGAKSFENKLKESLKKMEA 185

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 100/434 (23%), Positives = 177/434 (40%), Gaps = 80/434 (18%)

Query: 690  GRLGDLGVIDDNFDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLR 748
            G +G+L  + D + +         L +VVVD  E A   I  L   K G   FI L++L 
Sbjct: 534  GPVGELIKVSDKYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKLH 593

Query: 749  QFNLQPVDT----PENVPR--LFDLVKP--KDPKFSNAFYSVLRDTLVARDLKQANNVAY 800
                  VDT    P N+ +     L+K    D KF      V   TLV + L    ++A 
Sbjct: 594  ------VDTNFTYPNNLEKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLA- 646

Query: 801  GKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKNQSDRMDDY--TPEEVNKIENEL 858
             + +   +T+DG   D  G +SGG       L +   N+ D + D+  +  E  KI+ EL
Sbjct: 647  KEYKLNAITLDGDRADSKGVLSGGY------LDQYKSNRLDTLRDFKQSKREYKKIQVEL 700

Query: 859  SEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRXXXXXXXXXXXXXXXXXQVKEAK 918
                           E++Q L+ + +QE D  + +++                    +AK
Sbjct: 701  --------------QEIKQALQSI-EQEIDGLNNVVKDAAAERDAYEAGIEKARSQLKAK 745

Query: 919  MAYDKSVNDT-----AQLNKIMKILEHLRGEYDDLQAETKT---------KKERIKALQD 964
            ++   +++D+     A+LNKI   LE  R   +   A+            +K  + A+ +
Sbjct: 746  LSQKITIDDSIKALKARLNKIDTELEQCRERTNAFAADISKPFVNELDADEKAELLAISN 805

Query: 965  QIMKIGGTNLQIQNSKVESLSQRIDILVAXXXXXXXXXXXXXXDVTKFQKQLKNVERDIE 1024
             I +   T+L    S +  LS ++D L A                +K   +L  +ER   
Sbjct: 806  SI-QTKETSLNFNLSTLNELSSKLDELNAELN-------------SKLLPKLHELERKPS 851

Query: 1025 LSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKIDEFKS 1084
             SS+ L+ I + + Q++L L++  T           +    EQ++ +++ ++  I   + 
Sbjct: 852  -SSHSLQ-ISQINNQMELVLMEKQT-----------VTRTKEQVESELSVLDSSIKSLRG 898

Query: 1085 LEMEMKNKLEKLNS 1098
             +  ++  L+K NS
Sbjct: 899  EKATLQKDLDKANS 912

>Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar to
            Ashbya gossypii AGR236W
          Length = 1170

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 62/94 (65%), Gaps = 1/94 (1%)

Query: 1315 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1373
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLNHTQNIGHLIKTRFKG 1136

Query: 1374 AQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTV 1407
            +QFIV+SL+  MF  A ++     +D  +  + +
Sbjct: 1137 SQFIVVSLKEGMFNNANRVFKTRFQDGTSAVSVI 1170

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 94/207 (45%), Gaps = 22/207 (10%)

Query: 685 INGFHGRLGDLGVIDDNFDVAIS---TACPRLDDVVVDTVECAQHCID--YLRKNKLGYA 739
           + G   ++  LG   DNFD A +    A  RL +++VD  + A   ++   LRK      
Sbjct: 523 VKGVAAQVFTLG--KDNFDSANALQVCAGGRLFNIIVDNEKTASQLLEKGMLRKR----V 576

Query: 740 RFILLDRL-------RQFNLQPVDTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARDL 792
             I L+++           L     P  V    +L+  ++   S A   +   +L+  D 
Sbjct: 577 TIIPLNKISTRVLSDESLALAKKIAPGKVELALNLIGYEED-VSKAMQYIFGGSLICADA 635

Query: 793 KQANNVAYGKR-RFRVVTIDGKLIDISGTMSGGGNHVVKGLMR-IGK-NQSDRMDDYTPE 849
           + A  + +  + R R +T+DG + D  GT+SGG ++    L++ I K N++ R       
Sbjct: 636 ETAKKITFHPQIRARSITLDGDIYDPEGTLSGGSSNNTNSLLKDIQKYNEASRRSKSFES 695

Query: 850 EVNKIENELSEREKNFRVANDTVHEME 876
           E++ I+ ++ E E+  ++     +E++
Sbjct: 696 ELSLIQQQIMECERASQLTKSLQNELD 722

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1315 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1373
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1374 AQFIVISLRNNMF 1386
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar to
           Ashbya gossypii AAL182W
          Length = 1232

 Score = 63.5 bits (153), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 94/196 (47%), Gaps = 12/196 (6%)

Query: 154 LFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I K+++  FK+Y  K  +  F    + VVG NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIRKVIISGFKTYKNKTEIDNFSAHHNVVVGLNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 214 LSDLIHKSEEFPNLQSCSVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYIN 273
              LI++     ++ S  V + F    D  + T     +  G +  R+       +Y IN
Sbjct: 61  RRSLIYQGT--SSVMSGYVEIVFH---DAENRTLLGIPDSNGAIRIRRTVGLKKDEYMIN 115

Query: 274 GKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGT 333
            K S+ + V +LL++ G    +   ++ QG + ++   K       D   L+ LE+++G 
Sbjct: 116 NKNSSRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAK-------DRERLQLLEEVVGA 168

Query: 334 ANYKPLIEDRLSQIET 349
            +++  +++ L +++ 
Sbjct: 169 KSFERKLKESLQRMDA 184

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 66/140 (47%), Gaps = 9/140 (6%)

Query: 690 GRLGDLGVIDDNF-DVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLR 748
           G LG+L  + + +   A       L  VVVDT   A   +  L  +K G   F+ L+R+ 
Sbjct: 534 GPLGELIKVSEKYKTCAEVVGGNSLFHVVVDTENTASLIMQELYNSKGGRVTFMPLNRIY 593

Query: 749 -QFNLQ-PVDTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARDLKQANNVAYGKRRFR 806
              N+Q P +   N   L   +K  D KF  A   V   T+V +DL Q + +A   ++F 
Sbjct: 594 VDPNIQYPSNEEYNCTPLIKKIKF-DGKFEKAVKHVFGKTIVVKDLLQGSKLA---KQFN 649

Query: 807 V--VTIDGKLIDISGTMSGG 824
           +  VT+DG   D  G ++GG
Sbjct: 650 LNSVTLDGDKADNKGVLTGG 669

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1099

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 84/185 (45%), Gaps = 22/185 (11%)

Query: 134 RIELQKL-YDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFH--TSFSAVVGPNGSG 190
           R++L K+ Y   QP         I K+ L+NF +YA    +  FH   S + ++GPNGSG
Sbjct: 32  RLKLSKVNYTDFQPGS-------IIKIRLKNFVTYA----LTEFHLSPSLNMIIGPNGSG 80

Query: 191 KSNVIDSMLFVFGFRANKM-RQDRLSDLIHKSEEFPNLQSCSVAVHFEYVVDEPSGTSRI 249
           KS  + ++      R   + R  R+ D I   E+      C + +  +    +  G + +
Sbjct: 81  KSTFVCAICLGLAGRPEYIGRSKRVEDFIKNGED-----ECEIEITLKN-NSKIQGIANV 134

Query: 250 DEEKPGLVITRKAFRNN-SSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENI 308
                 + ITR   R+   S Y+IN + ++   V  ++    I LD+    + Q  VE  
Sbjct: 135 LSSDDVIKITRVLIRHRKKSDYFINDRPASEGVVKSMILQLNIQLDNLCQFLSQERVEEF 194

Query: 309 AQMKS 313
           A++KS
Sbjct: 195 ARLKS 199

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 66/144 (45%), Gaps = 20/144 (13%)

Query: 1247 RDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDP--FSEGV 1304
            RD VKE+ ++L+  R DE +     +S     ++  +   G   LE      P  FSE  
Sbjct: 922  RDSVKEKRDVLEP-RLDEVVQR---VSQRFARLFVGVGSAGAVNLE-----KPTLFSEW- 971

Query: 1305 TFSVMPPKKSWRNITNL-----SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1359
               +M   +    +  L     SGGE+ +S++  + AL ++   P  V+DEI+  +D RN
Sbjct: 972  KLEIMVKFRDNATLKRLDSHTQSGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDTRN 1031

Query: 1360 VSIVANYIKERT---KNAQFIVIS 1380
              IV   + E       +Q+ +I+
Sbjct: 1032 ERIVHKAMVENACAENTSQYFLIT 1055

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1095

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 114/258 (44%), Gaps = 40/258 (15%)

Query: 139 KLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDS 197
           + YD  QP         I K+ L+NF +Y   +  + P   S + ++GPNGSGKS  + +
Sbjct: 28  RTYDQFQPGS-------IVKIKLQNFVTYRLTEFNLSP---SLNMIIGPNGSGKSTFVCA 77

Query: 198 MLFVFGFRANKM-RQDRLSDLIHKSEEFPNLQSCSVAVHFEYVVDEPSGTSRIDEE---- 252
           +      +   + R  R+ D I   E+     +  + +  +   D     S ++ +    
Sbjct: 78  VCLGLAGKPEFIGRAKRVDDFIKNGED-----TSRIEIFLKNYEDPTELQSSLNLKFNLA 132

Query: 253 -KPGLVITRKAFRNNS---SKYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENI 308
            K  L +TR   R+ +   S Y+IN K      +  L+K   I LD+    + Q  VE  
Sbjct: 133 GKDLLKVTRLIQRDGNKCKSDYFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEF 192

Query: 309 AQMKS-----KAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKENRFEI 363
           A++KS     +  +  D  LL+ L+D+  + N +  +E         NE+ + K+ RF  
Sbjct: 193 ARLKSDKLLVETVRSIDAQLLQILDDLKSSQNDETTLE---------NEVDI-KQKRFNE 242

Query: 364 VNREKNSLESGKETALEF 381
           +  ++N LE+   +  EF
Sbjct: 243 LETDRNKLEASVRSLKEF 260

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1322 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1378
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTSQYFL 1049

Query: 1379 IS 1380
            I+
Sbjct: 1050 IT 1051

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1119

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 70/260 (26%), Positives = 113/260 (43%), Gaps = 39/260 (15%)

Query: 141 YDSHQPSGEQQGRLFIDKLVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSML 199
           YD  QP+        I K+ LENF +Y   +  + P   S + ++GPNGSGKS  + +  
Sbjct: 44  YDKFQPAS-------IVKIKLENFVTYKLTEFNLSP---SLNMIIGPNGSGKSTFVCAAC 93

Query: 200 FVFGFRANKM-RQDRLSDLIHKSEE-------FPNLQSCSVAVHFEYVVDEPSGTSRIDE 251
                +   + R  R+ D I   E+         N++S     +F    ++ +      +
Sbjct: 94  LGLAGKPEYIGRSKRVDDYIKNGEDRSKIEIFLKNVESMDKLKNFNNNNNKNNNNGAQVD 153

Query: 252 EKPG----LVITRKAFRNNS-SKYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVE 306
            K G    +  TR   R+   S YYIN K  +   V  L+K   I LD+    + Q  VE
Sbjct: 154 LKCGQLDLIKFTRIIHRDKKKSDYYINDKPVSELTVKNLVKALSIQLDNLCQFLSQERVE 213

Query: 307 NIAQMKS-----KAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKENRF 361
             A++KS     +  +  D  LL+ LE++    N +  +ED L       EI   K+ R+
Sbjct: 214 EFARLKSDKLLVETVRSIDPNLLDILEELKVLQNEEQTVEDEL-------EI---KQKRY 263

Query: 362 EIVNREKNSLESGKETALEF 381
             +  E+  LE+  ++  EF
Sbjct: 264 TELCNERTKLEASVQSLKEF 283

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1322 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1378
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1014 SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1073

Query: 1379 IS 1380
            I+
Sbjct: 1074 IT 1075

>KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1108

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 79/160 (49%), Gaps = 20/160 (12%)

Query: 156 IDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLS 215
           + +L L NF +Y+  +    F  S + VVGPNGSGKS ++ ++      R   + + + S
Sbjct: 57  VVRLRLHNFVTYSLAEF--EFSPSLNMVVGPNGSGKSTLVCALCLGLAGRTEYLGRMKRS 114

Query: 216 DLIHKSEEFPNLQSCSVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNN--SSKYYIN 273
           D   K+       S  + V   ++  E  GT+        L ++R   RN+  +S YY++
Sbjct: 115 DSFIKN----GADSARIDV---WLAGEDPGTT--------LKVSRVLTRNHKKASLYYVD 159

Query: 274 GKESNYTQVTKLLKNE-GIDLDHKRFLILQGEVENIAQMK 312
           G E++  +V +L+  +  I LD+    + Q  V+  A+++
Sbjct: 160 GVETSEQRVRQLVATQHNIQLDNLCQFLSQERVQEFARLR 199

 Score = 46.2 bits (108), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 80/191 (41%), Gaps = 45/191 (23%)

Query: 1196 ELNIELLEGDIGELTCYIDATNVD---IGVLEEYARRLAEFKRR------KLDLNQAVQK 1246
            + N E +   +  L   I   N D   I +L+E  R+LA+ K R      KLD   A   
Sbjct: 876  DFNTEYIGEQVERLESEIRMINHDESSIAILQEVERKLADVKARLPAMVRKLDAATASMS 935

Query: 1247 --RDEVKEQLEILKKK---RFDEFMTGFN---IISMTLKEMYQ------MITMGGNAELE 1292
              + E++ +L+ + +K   RF    T       I ++   +YQ      M+    NA L+
Sbjct: 936  TMQAELEPRLDTIVEKISERFTNLFTNVGSAGAIQLSKPHLYQEWEMKIMVKFRDNAPLK 995

Query: 1293 LVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1352
             +DS                         SGGE+ +S++  + AL ++   P  V+DEI+
Sbjct: 996  RLDS----------------------HTQSGGERAVSTVLYIIALQEFTSAPFRVVDEIN 1033

Query: 1353 AALDFRNVSIV 1363
              +D RN  IV
Sbjct: 1034 QGMDQRNERIV 1044

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1088

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 85/183 (46%), Gaps = 21/183 (11%)

Query: 156 IDKLVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I K+ LENF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  R
Sbjct: 36  IVKMRLENFVTYTLTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIKRSKR 92

Query: 214 LSDLIHKSEEFPNLQSCSVAVHFEYVVDEPS--GTSRIDEEKPGLVITRKAFRNNS-SKY 270
           + D I   E+       S+ +  +   + P   G   +D E   + ITR+  ++ S S+Y
Sbjct: 93  VEDFIKNGED-----RGSIEITLK---NSPKVEGMPGVDSEADTIKITRELIKSKSKSRY 144

Query: 271 YINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKS-----KAEKESDDGLLE 325
            IN +  +   V  L+    I LD+    + Q  VE  A++KS     +  +  D  LL+
Sbjct: 145 MINDRVVSEEDVRLLVSKLNIQLDNLCQFLSQERVEEFARLKSDKLLAETTRSIDAKLLD 204

Query: 326 YLE 328
            LE
Sbjct: 205 VLE 207

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 1322 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1376
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN      S+V N   E T  +Q+
Sbjct: 981  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDSRNERIVHKSMVENACAENT--SQY 1038

Query: 1377 IVIS 1380
             +I+
Sbjct: 1039 FLIT 1042

>TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1106

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 3/85 (3%)

Query: 1299 PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1358
            P  + + +++ P     RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  
Sbjct: 987  PAKQLMIYTLTPNDNRPRNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQV 1046

Query: 1359 NVSIVANYIKERTKN---AQFIVIS 1380
            N  +    I E+ KN    Q I+I+
Sbjct: 1047 NRKMGTRLILEKLKNNSRTQTIIIT 1071

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1080

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 85/204 (41%), Gaps = 46/204 (22%)

Query: 141 YDSHQPSGEQQGRLFIDKLVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSML 199
           Y   QP         I KL L+N  +Y+  +  + P   S + +VGPNGSGKS  + ++ 
Sbjct: 29  YSKFQPGN-------IVKLRLQNVMTYSITEFNLSP---SLNMLVGPNGSGKSTFVCAVC 78

Query: 200 FVFGFRANKM-RQDRLSDLIHKSEEFPNLQSCSVAVHFEYVVDEPSGTSRIDEEKPG--- 255
                +   + R  ++ + I   E                       T++ID    G   
Sbjct: 79  LGLAGKPEYIGRSKKIDNFIKNGE----------------------NTAQIDTFLRGHMP 116

Query: 256 ---LVITRKAFRNNS-SKYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQM 311
              + ITR   RN   S+YYI+   S  T V KL     I LD+    + Q  VE+ A++
Sbjct: 117 NEVIKITRIMTRNKKKSEYYIDDSPSTETAVRKLASELNIQLDNLCQFLSQEHVEDFAKL 176

Query: 312 KS-----KAEKESDDGLLEYLEDI 330
           KS     +  +  +  LLE LED+
Sbjct: 177 KSDKLLIETIRSINPSLLETLEDL 200

 Score = 40.8 bits (94), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1322 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1378
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 975  SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDQRNERIVHRAMVENACAENTSQYFL 1034

Query: 1379 IS 1380
            I+
Sbjct: 1035 IT 1036

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] {ON}
            similar to uniprot|Q08204 YOL034W Saccharomyces
            cerevisiae YOL034W SMC5 Structural maintenance of
            chromosomes (SMC) protein, interacts with Rhc18p and
            Nse1p to form a large complex
          Length = 1119

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 78/184 (42%), Gaps = 33/184 (17%)

Query: 1216 TNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMT 1275
            TN DI +LE+    L    R KL  N   Q   E++  LE     R D+ +     IS  
Sbjct: 920  TNEDISILEKTLPHL----RAKLASN--AQTILEIRNSLE----PRLDDIVKQ---ISKK 966

Query: 1276 LKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNL--------SGGEKT 1327
               ++  +   G  EL+  DS + +        +  K  +R+ + L        SGGE+ 
Sbjct: 967  FSHLFAYVGSAGQVELKKPDSFNDW-------CIEIKVKFRDNSELQQLNPHVQSGGERA 1019

Query: 1328 LSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA-----NYIKERTKNAQFIVISLR 1382
            +S++  + AL ++  +P  V+DEI+  +D  N  IV      N   E T     I   L 
Sbjct: 1020 VSTVLYMIALQQFTSSPFRVVDEINQGMDQTNERIVHRIMVENACAENTSQYFLITPKLL 1079

Query: 1383 NNMF 1386
             N+F
Sbjct: 1080 TNLF 1083

 Score = 40.4 bits (93), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 84/186 (45%), Gaps = 25/186 (13%)

Query: 158 KLVLENFKSYAGKQVVGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 214
           KL L NF +YA    +  FH   S + ++GPNGSGKS  + ++      +   + R  ++
Sbjct: 62  KLKLTNFVTYA----LTEFHLSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRSKKV 117

Query: 215 SDLIHKSEEFP----NLQSCSVAVHFEYVVDEPSGTSRIDEEKPGLVITRK-AFRNNSSK 269
            + I    +       L++ S  +H ++        + I+ +   + + R  +     SK
Sbjct: 118 EEYIKNGTDEGVIEITLKNSSALLHSDF--------NMINTDDDVVHVKRVLSMEKKKSK 169

Query: 270 YYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMK-----SKAEKESDDGLL 324
           YYIN K      V  +++   I LD+    + Q  VE  A++K     ++  +  + GLL
Sbjct: 170 YYINNKVVTEEVVKSMVRVLNIQLDNLCQFLSQERVEEFARLKPDTLLNETIRSIEAGLL 229

Query: 325 EYLEDI 330
           E L ++
Sbjct: 230 EKLSEL 235

>Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {ON}
           YOL034W - Protein required for cell viability [contig
           47] FULL
          Length = 1117

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 70/160 (43%), Gaps = 13/160 (8%)

Query: 156 IDKLVLENFKSYAGKQVVGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           I KL LENF +Y+    +  FH   S + ++GPNGSGKS  + ++      +   + + +
Sbjct: 69  IVKLRLENFVTYS----LTEFHLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRGK 124

Query: 214 LSDLIHKSEEFPNLQSCSVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYIN 273
             D   K+ E   L   ++         +P  T           ++R  +    S+YY+N
Sbjct: 125 RVDSFIKNGENRGLIEVTLK-------RDPGRTGSFVAVDGTTKVSRVLWVGKKSEYYLN 177

Query: 274 GKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKS 313
            +  +   V  L+    I LD+    + Q  VE  A++KS
Sbjct: 178 DEPVSELTVKNLMGELNIQLDNLCQFLSQERVEEFARLKS 217

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 37/62 (59%), Gaps = 3/62 (4%)

Query: 1322 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1378
            SGGE+ +S++  + AL ++   P  ++DEI+  +D RN  IV   + E     K +Q+I+
Sbjct: 1012 SGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVENACAEKTSQYIL 1071

Query: 1379 IS 1380
            ++
Sbjct: 1072 VT 1073

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar
           to Ashbya gossypii AEL337
          Length = 1097

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 70/161 (43%), Gaps = 12/161 (7%)

Query: 156 IDKLVLENFKSYAGKQVVGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           I KL L NF +Y+    +  FH   S + ++GPNGSGKS+ + ++      +   + R  
Sbjct: 46  IIKLRLVNFVTYS----LTEFHLSPSLNMIIGPNGSGKSSFVCAICLGLAGKPEYIGRAK 101

Query: 213 RLSDLIHKSEEFPNLQSCSVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYI 272
           ++ D I    E   ++   + V     V   S     DE      +  KA       YYI
Sbjct: 102 KVEDFIKNGTEESVIE---LTVKNSKAVSGYSMIGGSDEVINIKTVIMKA--KKKCIYYI 156

Query: 273 NGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKS 313
           NG+     QV  L+    I LD+    + Q  VE  A++KS
Sbjct: 157 NGQSVGENQVKALVCLLNIQLDNLCQFLSQERVEEFARLKS 197

 Score = 40.4 bits (93), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 90/189 (47%), Gaps = 24/189 (12%)

Query: 1206 IGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKEQLEILKKK---RF 1262
            I +L   I   N D   ++   + L++ K  +  L   V++   ++ ++  ++ +   R 
Sbjct: 875  IAKLETEIQIINHDESAIKILKQTLSDIKYLQEKLPGQVKRLSSIRRKMWSIRSELEPRL 934

Query: 1263 DEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNL- 1321
            DE +     IS   ++++  + +G   E+ LV   D +SE      +  K  +R++  L 
Sbjct: 935  DEIVEN---ISTRFRKLF--LNVGSAGEVCLVKP-DLYSEWK----IEIKVKFRDVAELK 984

Query: 1322 -------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER--TK 1372
                   SGGE+ +S++  + +L ++   P  V+DEI+  +D RN  IV   + E    K
Sbjct: 985  KLDSHIQSGGERAVSTVLYMISLQEFTNAPFRVVDEINQGMDARNERIVHKAMVENACAK 1044

Query: 1373 N-AQFIVIS 1380
            N +Q+ +I+
Sbjct: 1045 NTSQYFLIT 1053

>ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1109

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 1306 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1365
            F + P  +  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I   
Sbjct: 997  FILTPNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRQIGTK 1056

Query: 1366 YIKERTKN---AQFIVIS 1380
             I  + K+    Q I+I+
Sbjct: 1057 LILNKLKDIARTQTIIIT 1074

 Score = 38.9 bits (89), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 41/75 (54%), Gaps = 11/75 (14%)

Query: 146 PSGEQQGRLFIDKLVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGF 204
           P+G      +I K+VL NF  +   ++ +GP     + +VG NGSGKS ++ ++    G 
Sbjct: 71  PAG------YIKKVVLWNFMCHEHFELELGP---RLNFIVGNNGSGKSAILTAITVGLGA 121

Query: 205 RA-NKMRQDRLSDLI 218
           RA +  R + L DLI
Sbjct: 122 RAMDTNRGNSLKDLI 136

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL034W
           (SMC5)
          Length = 1097

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 79/186 (42%), Gaps = 23/186 (12%)

Query: 156 IDKLVLENFKSYAGKQVVGPFHTS--FSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           I  + L NF +Y+    +  FH S   + ++GPNGSGKS  + ++      +   + R  
Sbjct: 46  IVSIRLTNFVTYS----LAEFHMSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRAK 101

Query: 213 RLSDLIHKSEEFPNLQSCSVAVHFEYVVDEPSGTSRIDEEKPGL---VITRKAFRNNSSK 269
           R+ D I            ++ +      +  SG   I  E   +    +  KA R  +  
Sbjct: 102 RVEDFIKNG-----TAESTIEIQLRNSRN-VSGLPMISAEDEAINVRTVLMKARRKCA-- 153

Query: 270 YYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKS-----KAEKESDDGLL 324
           YYING+  +  Q+  L+    I LD+    + Q  VE  A++K+     +  +  D  LL
Sbjct: 154 YYINGEPVSENQMRALVSMLNIQLDNLCQFLSQERVEEFARLKADKLLEQTVRSVDASLL 213

Query: 325 EYLEDI 330
             LE +
Sbjct: 214 GLLEQL 219

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 1322 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR-----NVSIVANYIKERTKNAQF 1376
            SGGE+ +S++  + AL  +   P  V+DEI+  +D R     + ++V N   E T     
Sbjct: 992  SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVENACAENTSQYFL 1051

Query: 1377 IVISLRNNM 1385
            I   L  N+
Sbjct: 1052 ITPKLLTNL 1060

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1089

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 68/159 (42%), Gaps = 14/159 (8%)

Query: 156 IDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 214
           I K+ L NF +Y+  +       S + ++GPNGSGKS  + ++      +   + R  +L
Sbjct: 44  IIKIKLWNFVTYSLAEFT--LSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSSKL 101

Query: 215 SDLIHKSEEFPNLQSCSVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYING 274
            D I   E+    QS  V V  + V +    T  I      L+ T         +Y ING
Sbjct: 102 EDYIKNGED----QSV-VEVTLKNVPESDFNTDTI------LIKTTINRGKKKPEYAING 150

Query: 275 KESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKS 313
                T +   +K   I LD+    + Q  VE  A++KS
Sbjct: 151 STVTETYIRAFVKKLNIQLDNLCQFLSQERVEEFARLKS 189

 Score = 40.4 bits (93), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1322 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1378
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  I+   + E       +Q+ +
Sbjct: 984  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIIHKAMVENACAENTSQYFL 1043

Query: 1379 IS 1380
            I+
Sbjct: 1044 IT 1045

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4.237
          Length = 1096

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1316 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1373
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 992  RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLA 1051

Query: 1374 -AQFIVIS 1380
              Q I+I+
Sbjct: 1052 RTQTIIIT 1059

>KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] {ON}
            similar to uniprot|Q08204 Saccharomyces cerevisiae
            YOL034W SMC5 Structural maintenance of chromosomes (SMC)
            protein interacts with Rhc18p and Nse1p to form a large
            complex S. pombe homolog forms a heterodimer with S.
            pombe Rad18p that is involved in DNA repair
          Length = 1094

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1322 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1378
            SGGE+ +S++  + AL      P  V+DEI+  +D RN  IV   + E      N+Q+I+
Sbjct: 989  SGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL 1048

Query: 1379 IS 1380
            ++
Sbjct: 1049 VT 1050

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1119

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1316 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1373
            R I NLSGGEK+ + +AL+ A  K   + +  +DE D  +D  N  I    + ++ KN  
Sbjct: 1019 RTIDNLSGGEKSFAQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTGLLVKKLKNQT 1078

Query: 1374 -AQFIVIS 1380
              Q I+I+
Sbjct: 1079 RTQTIIIT 1086

 Score = 37.7 bits (86), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 39/79 (49%), Gaps = 9/79 (11%)

Query: 141 YDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLF 200
           Y    PSG      +I K+ L NF  +   ++   F    + +VG NGSGKS V+ ++  
Sbjct: 76  YIEESPSG------YIKKIKLRNFMCHENFEM--EFGPRLNFIVGNNGSGKSAVLTAITI 127

Query: 201 VFGFRANKM-RQDRLSDLI 218
             G +A+   R + L DLI
Sbjct: 128 GLGAKASDTNRGNSLKDLI 146

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 1308 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1367
            + P    +R ++  SGGEK+ S +AL+ A  +   + +  +DE D  +D  N  I +  I
Sbjct: 1007 LTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALDEFDVFMDQVNRKIGSKLI 1066

Query: 1368 KERTK---NAQFIVIS 1380
             ++ K   N Q I+I+
Sbjct: 1067 VKKLKDIPNTQTIIIT 1082

 Score = 39.3 bits (90), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 155 FIDKLVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           +I KL L NF  +    V +GP     + +VG NGSGKS ++ ++    G +A++  R  
Sbjct: 79  YIKKLTLHNFMCHRNFDVELGP---GLNFIVGKNGSGKSAILTAITIGLGAKASETNRGS 135

Query: 213 RLSDLI 218
            L DLI
Sbjct: 136 SLKDLI 141

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}
           SMC5Component of the SMC5-SMC6 complex; this complex
           plays a key role in the removal of X-shaped DNA
           structures that arise between sister chromatids during
           DNA replication and repair; binds single-stranded DNA
           and has ATPase activity; S. pombe homolog forms a
           heterodimer with S. pombe Rad18p that is involved in DNA
           repair
          Length = 1093

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 74/166 (44%), Gaps = 22/166 (13%)

Query: 156 IDKLVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I K+ L++F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 214 LSDLIHKSEEFP----NLQSCSVAVHFEYV--VDEPSGTSRIDEEKPGLVITRKAFRNNS 267
           + D I   ++       L++       EY+   DE    +RI        ITR   R   
Sbjct: 99  VEDFIKNGQDVSKIEITLKNSPNVTDIEYIDARDETIKITRI--------ITRSKRR--- 147

Query: 268 SKYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKS 313
           S Y IN  + + + V  L+    I LD+    + Q  VE  A++KS
Sbjct: 148 SDYLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKS 193

 Score = 40.8 bits (94), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1322 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1378
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1379 IS 1380
            I+
Sbjct: 1047 IT 1048

>Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR383W
            (REAL)
          Length = 1120

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1316 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1373
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1020 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1079

Query: 1374 -AQFIVIS 1380
              Q I+I+
Sbjct: 1080 RTQTIIIT 1087

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 45/93 (48%), Gaps = 14/93 (15%)

Query: 146 PSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFR 205
           PSG      +I K++L NF  +   ++     +  + +VG NGSGKS ++ ++    G +
Sbjct: 84  PSG------YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAK 135

Query: 206 ANKM-RQDRLSDLIHKSEEFPNLQSCSVAVHFE 237
           A++  R   L DLI +        S  + +H E
Sbjct: 136 ASETNRGSSLKDLIREG-----CYSAKITLHLE 163

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
            (REAL)
          Length = 1092

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 90/203 (44%), Gaps = 30/203 (14%)

Query: 1195 KELNIELLEGDIGELTCYIDATNVD---IGVLEEYARRLAEFKR------RKLDLNQAVQ 1245
            +  N+  ++  I +L   I   N D   I +L++    L E ++      + L++ +A  
Sbjct: 859  RNFNLPFIQDVIDKLESEIAMVNHDESAITILDQVVTELRELEQIVPQQTKDLEITKA-- 916

Query: 1246 KRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEG-- 1303
               ++KE   IL+ K  DE ++    IS     ++  +   G   LE       ++E   
Sbjct: 917  ---KLKEDHAILEPK-LDEIVSK---ISTRFARLFNNVGSAGAVHLE---KPKDYAEWKI 966

Query: 1304 ---VTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1360
               V F    P K   + T  SGGE+ +S++  + AL ++   P  V+DEI+  +D RN 
Sbjct: 967  EVMVKFRDNAPLKKLDSHTQ-SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNE 1025

Query: 1361 SIVANYIKERT---KNAQFIVIS 1380
             IV   + E       +Q+ +I+
Sbjct: 1026 RIVHKAMVENACAENTSQYFLIT 1048

 Score = 40.8 bits (94), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 85/189 (44%), Gaps = 27/189 (14%)

Query: 156 IDKLVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I K+ L++F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 214 LSDLIHKSEEFPNLQSC---SVAVH---FEYVVDEPSGTSRIDEEKPGLVITRKAFRNNS 267
           + D I   ++   ++     S  +H   F    DE    +RI        ITR   R   
Sbjct: 99  VEDFIKNGQDTSRIEITLKNSPKIHDIEFINTHDETIKVTRI--------ITRSKRR--- 147

Query: 268 SKYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKS-----KAEKESDDG 322
           S Y IN ++ +   V  L+    I LD+    + Q  VE  A++KS     +  +  D  
Sbjct: 148 SDYLINDEQVSENVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLVETIRSIDAS 207

Query: 323 LLEYLEDII 331
           LL+ L++++
Sbjct: 208 LLDVLDELM 216

>Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR383W
            (REAL)
          Length = 1115

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1316 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1373
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1015 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1074

Query: 1374 -AQFIVIS 1380
              Q I+I+
Sbjct: 1075 RTQTIIIT 1082

 Score = 36.6 bits (83), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 45/93 (48%), Gaps = 14/93 (15%)

Query: 146 PSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFR 205
           PSG      +I K++L NF  +   ++     +  + +VG NGSGKS ++ ++    G +
Sbjct: 79  PSG------YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAK 130

Query: 206 ANKM-RQDRLSDLIHKSEEFPNLQSCSVAVHFE 237
           A++  R   L DLI +        S  + +H +
Sbjct: 131 ASETNRGSSLKDLIREG-----CYSAKITLHLD 158

>YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; homologous to S. pombe rad18
          Length = 1114

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1316 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1373
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1374 -AQFIVIS 1380
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 36.6 bits (83), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 9/74 (12%)

Query: 146 PSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFR 205
           PSG      +I K++L NF  +   ++     +  + +VG NGSGKS ++ ++    G +
Sbjct: 78  PSG------YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAK 129

Query: 206 ANKM-RQDRLSDLI 218
           A++  R   L DLI
Sbjct: 130 ASETNRGSSLKDLI 143

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1316 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1373
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1374 -AQFIVIS 1380
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 36.6 bits (83), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 45/93 (48%), Gaps = 14/93 (15%)

Query: 146 PSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFR 205
           PSG      +I K++L NF  +   ++     +  + +VG NGSGKS ++ ++    G +
Sbjct: 78  PSG------YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAK 129

Query: 206 ANKM-RQDRLSDLIHKSEEFPNLQSCSVAVHFE 237
           A++  R   L DLI +        S  + +H +
Sbjct: 130 ASETNRGSSLKDLIREG-----CYSAKITLHLD 157

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
            YLR383W
          Length = 1098

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 84/181 (46%), Gaps = 26/181 (14%)

Query: 1223 LEEYARRLAEFKRRKLDLNQAVQKRDEVKEQLE---ILKKKRFDEFMTGFNIISMTLKEM 1279
            LE+ +R++   KR + D+  + +K  E+ EQ     +  K+++ E     +I++ ++K  
Sbjct: 888  LEDISRKI---KRNESDIGVSYEKALELYEQTMSKFLSAKEKYIEMDNALSILNHSIKSR 944

Query: 1280 -----YQMITMGGNAELELVDSLD--PFSEGVTFS--------VMPPK--KSWRNITNLS 1322
                 YQ  +   +A+ +  +SL    F   + F            P+  K  RN+  LS
Sbjct: 945  TVNFGYQKTSTFADADFDFRNSLRIRKFKGKLDFGKTKETLNVYTGPQTDKEPRNVDTLS 1004

Query: 1323 GGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN---AQFIVI 1379
            GGEK+ S +AL+ A  K   + +  +DE D  +D  N       I ++ K+    Q I+I
Sbjct: 1005 GGEKSFSQIALLLATWKPMRSRIIALDEYDVFMDQVNRKTSTQLIVQKLKDDSRTQTIII 1064

Query: 1380 S 1380
            +
Sbjct: 1065 T 1065

 Score = 36.6 bits (83), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 155 FIDKLVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           +I K+ L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +AN   R +
Sbjct: 70  YIKKIKLVNFMCHEHFELTLGP---RLNFIVGNNGSGKSAILTAITIGLGAKANSTNRGN 126

Query: 213 RLSDLI 218
            L DLI
Sbjct: 127 SLKDLI 132

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4.237
            YLR383W
          Length = 1108

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 51/107 (47%), Gaps = 15/107 (14%)

Query: 1289 AELELVDSLD--PFSEGVTFSVMPPK----------KSWRNITNLSGGEKTLSSLALVFA 1336
            A+L+   SL    F+  +TF +   K          +  RN+  LSGGEK+ S LAL+ A
Sbjct: 969  ADLDFRASLKVRKFTGNLTFQIAERKLDMLILTANDEKARNVDTLSGGEKSFSQLALLLA 1028

Query: 1337 LHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN---AQFIVIS 1380
              K   + +  +DE D  +D  N  I    + ++ K+    Q I+I+
Sbjct: 1029 TWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLLRTQTIIIT 1075

 Score = 37.0 bits (84), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 155 FIDKLVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           +I K++L NF  +   ++ +GP     + +VG NGSGKS V+ ++    G +A+   R +
Sbjct: 75  YIKKVILRNFMCHEHFELDLGP---RLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRGN 131

Query: 213 RLSDLI 218
            + DLI
Sbjct: 132 AMKDLI 137

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
           (REAL)
          Length = 1093

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 82/178 (46%), Gaps = 17/178 (9%)

Query: 161 LENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLI 218
           L++F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  R+ D I
Sbjct: 47  LQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKRVEDFI 103

Query: 219 HKSEEFPNLQSCSVAVHFEYVVDEPSGTSRIDEE-KPGLVITRKAFRNNSSKYYINGKES 277
              ++   ++   + +     V++    +  DE  K   +ITR   R   S Y IN  E 
Sbjct: 104 KNGQDVSRIE---ITLKNSPKVNDIENVNAHDETIKITRIITRSKRR---SDYLINDCEV 157

Query: 278 NYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKS-----KAEKESDDGLLEYLEDI 330
           + + V  L+    I LD+    + Q  VE  A++KS     +  +  D  LL+ L+++
Sbjct: 158 SESVVKALVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLVETIRSIDSSLLDVLDEL 215

 Score = 41.2 bits (95), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1322 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1378
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1379 IS 1380
            I+
Sbjct: 1047 IT 1048

>Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 41.2 bits (95), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1322 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1378
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1379 IS 1380
            I+
Sbjct: 1047 IT 1048

 Score = 40.0 bits (92), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 73/163 (44%), Gaps = 16/163 (9%)

Query: 156 IDKLVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I K+ L++F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  ITKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 214 LSDLIHKSEEFPNLQSC---SVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKY 270
           + D I   ++   ++     S  VH    ++    T +I       +ITR   R   S Y
Sbjct: 99  VEDFIKNGQDVSRIEITLKNSPKVHDIENINAHDETIKITR-----IITRSKRR---SDY 150

Query: 271 YINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKS 313
            IN  + +   V  L+    I LD+    + Q  VE  A++KS
Sbjct: 151 LINDGQVSENTVKTLVTQLNIQLDNLCQFLSQERVEEFARLKS 193

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 41.2 bits (95), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1316 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1373
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KN  
Sbjct: 1014 RDVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTALIVKKLKNES 1073

Query: 1374 -AQFIVIS 1380
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 39.3 bits (90), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 64/135 (47%), Gaps = 19/135 (14%)

Query: 146 PSGEQQGRLFIDKLVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGF 204
           P+G      +I K+VL+NF  +   ++ +GP     + +VG NGSGKS ++ ++    G 
Sbjct: 78  PAG------YIKKVVLKNFMCHEHFEMDLGP---KLNFIVGNNGSGKSAILTAITVGLGA 128

Query: 205 RANKM-RQDRLSDLIHKSEEFPNLQSCSVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAF 263
           +A +  R + L DLI +           +A+  E   +E  G  + D     ++I R   
Sbjct: 129 KAAETNRGNSLKDLIKEG-----CHRAKIAITLE---NESYGAYQPDVFGSEIIIERTIK 180

Query: 264 RNNSSKYYINGKESN 278
           R+ ++ + +  +  N
Sbjct: 181 RDGTATFSLRTETRN 195

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
            complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 1322 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1378
            SGGEK +S+   + +L  +   P  V+DEI+  +D RN  I+   + E       +Q+I+
Sbjct: 995  SGGEKAVSTALYIISLQNFTKAPFRVVDEINQGMDSRNEKIIHRIMVENACEDNTSQYIL 1054

Query: 1379 IS 1380
            ++
Sbjct: 1055 VT 1056

 Score = 39.3 bits (90), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 18/74 (24%)

Query: 125 LQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVV 184
           ++LSP++         YD +Q          I K+ ++NF +Y    V      SF+ ++
Sbjct: 36  IKLSPIQ---------YDDYQAGS-------IIKIKMKNFMTYG--LVEYQLCPSFNMII 77

Query: 185 GPNGSGKSNVIDSM 198
           GPNGSGKS V+ ++
Sbjct: 78  GPNGSGKSTVVCAL 91

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
            YOL034W
          Length = 1103

 Score = 40.8 bits (94), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 7/64 (10%)

Query: 1322 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1376
            SGGE+ +S++  + AL +Y   P  ++DEI+  +D  N      S+V N   E T  +Q+
Sbjct: 998  SGGERAVSTVLYMIALQQYTTAPFRIVDEINQGMDSHNERIVHKSMVINACAENT--SQY 1055

Query: 1377 IVIS 1380
             +I+
Sbjct: 1056 FLIT 1059

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 39/86 (45%), Gaps = 14/86 (16%)

Query: 141 YDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPF--HTSFSAVVGPNGSGKSNVIDSM 198
           YD  +P         + KL +ENF +Y     V  F    S + ++GPNGSGKS  + ++
Sbjct: 38  YDDFRPGA-------LIKLRMENFVTYK----VAEFDLSPSLNMIIGPNGSGKSTFVCAV 86

Query: 199 LFVFGFRANKM-RQDRLSDLIHKSEE 223
                 +   + R  +L D I   EE
Sbjct: 87  CIGLAGKPRFIGRSSKLEDFIKNGEE 112

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1117

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1322 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1378
            SGGEK +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1012 SGGEKAVSTVFYMIALQEFTIAPFRVVDEINQGMDPRNEKIVHQSMVENACADNTSQYFL 1071

Query: 1379 IS 1380
            I+
Sbjct: 1072 IT 1073

 Score = 39.7 bits (91), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 73/164 (44%), Gaps = 18/164 (10%)

Query: 156 IDKLVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR- 213
           I K+ L NF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + + R 
Sbjct: 66  IIKIKLHNFVTYEFTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSRN 122

Query: 214 LSDLIHKSEEFPNLQSC---SVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRN-NSSK 269
           + D I   EE   ++     S A+H    V E S T         + ITR   R+   S+
Sbjct: 123 VDDYIKNDEEHGEIEITLKNSEAIHDVEGVLEGSDT---------ITITRILTRSKKKSE 173

Query: 270 YYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEVENIAQMKS 313
           Y IN        V +L+    I LD+    + Q  VE  A++KS
Sbjct: 174 YKINDSLVTEATVKELVSLLNIQLDNLCQFLSQERVEEFARLKS 217

>KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1098

 Score = 40.0 bits (92), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 1316 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-----KER 1370
            RN+  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I  N I     K+ 
Sbjct: 997  RNVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDV 1056

Query: 1371 TKNAQFIVIS 1380
              + Q I+I+
Sbjct: 1057 KSDTQTIIIT 1066

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
            YLR188W
          Length = 707

 Score = 39.7 bits (91), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 5/63 (7%)

Query: 1319 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1378
            T LSGG+K   +LA  F L   +PT L V+DE  +ALD R+ SIVA  +K+R     F  
Sbjct: 600  TQLSGGQKQRVALARAFLL---EPT-LLVLDEATSALDPRSESIVAQTLKQRCAKG-FTT 654

Query: 1379 ISL 1381
            IS+
Sbjct: 655  ISI 657

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
           Ashbya gossypii AER044W
          Length = 1102

 Score = 39.3 bits (90), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 10/63 (15%)

Query: 146 PSGEQQGRLFIDKLVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGF 204
           P+G      +I ++ L+NF  +   ++  GP     + +VG NGSGKS ++ ++  VFG 
Sbjct: 58  PAG------YIKRITLKNFMCHEHFELEFGPM---LNFIVGSNGSGKSAILTAITIVFGA 108

Query: 205 RAN 207
           +A+
Sbjct: 109 KAS 111

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
           (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 39.3 bits (90), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 8/84 (9%)

Query: 155 FIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           +I K++L NF  +    V    + +F  +VG NGSGKS ++ +++   G +A++  R   
Sbjct: 72  YIRKVILRNFMCHENFSVELTPNLNF--IVGNNGSGKSAILTAIIVALGVKASETSRGSS 129

Query: 214 LSDLIHKSEEFPNLQSCSVAVHFE 237
           L +LI K        S  V +H +
Sbjct: 130 LKELIRKG-----CNSSKVTLHLD 148

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1316 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1362
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N ++
Sbjct: 1018 RSVDTLSGGEKSFSQMALLLATWKPMKSRIIALDEFDVFMDQVNRTV 1064

>Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR383W
            (RHC18) - involved in recombination repair [contig 72]
            FULL
          Length = 1102

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 68/157 (43%), Gaps = 23/157 (14%)

Query: 1228 RRLAEFKRRKLDLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGG 1287
            ++ A+  R  + LN++++KR      L+ L   + D  +T         KE  +     G
Sbjct: 929  KKYADVDRAIIQLNESLRKR------LQSLNYAKTDTCVTA----DTDFKESLRFRNFSG 978

Query: 1288 NAELELVDSLDPFSEG-VTFSVMPPKKSW-RNITNLSGGEKTLSSLALVFALHKYKPTPL 1345
                +       FS+G +T  V  P     RN+  LSGGEK+ S  +L+ A  +   + +
Sbjct: 979  GLNFD-------FSKGALTMLVKTPNDDQPRNVDTLSGGEKSFSQTSLLLATWRPMRSRI 1031

Query: 1346 YVMDEIDAALDFRNVSI----VANYIKERTKNAQFIV 1378
              +DE D  +D  N  I    + N + + T+    I+
Sbjct: 1032 IALDEFDVFMDQVNRQIGTKLIMNKLSKETRTQTIII 1068

>CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] {ON}
            similar to uniprot|Q08204 Saccharomyces cerevisiae
            YOL034w SMC5
          Length = 1105

 Score = 38.1 bits (87), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 107/226 (47%), Gaps = 31/226 (13%)

Query: 1174 NIDETSDEVSRGIPRLSE---DELKELNIELLEGDIGELTCYIDATNVD---IGVLEEYA 1227
            +ID  + E  + +  L+E   DE K  N+  +E  + +L   I  +N D   + +LE+  
Sbjct: 848  DIDAYNQETKQVLNDLAEKYRDEDK-FNLIYVEQIVNKLESKIQLSNHDRSAVALLEQTK 906

Query: 1228 RRLAEFKRRKLDLNQAVQKRDEVKEQLEILKK---KRFDEFMTGFNIISMTLKEMYQMIT 1284
             ++A+ + +   L   V+K + +++++   +K    R +  ++G   I     E+++ + 
Sbjct: 907  AKIADLEDK---LPTQVRKCNTIRKEMSDKQKVLEPRLESIVSG---IGRKFSELFKDVG 960

Query: 1285 MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNL-----SGGEKTLSSLALVFALHK 1339
              G   L     L  FS+     +M   +    ++ L     SGGE+ +S++  + AL K
Sbjct: 961  TAGGVTLNRKSKL--FSDW-KLEIMVQFRDEGKLSGLDSHTQSGGERAVSTVLYMIALQK 1017

Query: 1340 YKPTPLYVMDEIDAALD-----FRNVSIVANYIKERTKNAQFIVIS 1380
            +   P  V+DEI+  +D       + ++V N  +E T  +Q+ +I+
Sbjct: 1018 FTQAPFRVVDEINQGMDTNFERLVHKAMVQNACEEGT--SQYFLIT 1061

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 97/228 (42%), Gaps = 29/228 (12%)

Query: 141 YDSHQPSGEQQGRLFIDKLVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSML 199
           YD  +P         I K+ LENF +Y   +  + P   S + ++GPNGSGKS  + ++ 
Sbjct: 30  YDVFKPGS-------IVKIRLENFVTYNYTEFNLSP---SLNMIIGPNGSGKSTYVCAVC 79

Query: 200 FVFGFRANKM-RQDRLSDLIHKSEEFPNLQSC---SVAVHFEYVVDEPSGTSRIDEEKPG 255
                +   + R  ++ D I   ++   ++        +  E++             K  
Sbjct: 80  LGLAGKPEYIGRSKQVEDFIKNGQDTSKIEIVLKDDPNIDIEFLGSSFHRIRNNGNYKGL 139

Query: 256 LVITR------KAFRN----NSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLILQGEV 305
           L ITR      K  RN     + +Y ING  +  + V  L+    I LD+    + Q  V
Sbjct: 140 LTITRNLEKRTKIGRNLEKRRTQEYSINGLPTTESNVRNLVSKFHIQLDNLCQFLSQERV 199

Query: 306 ENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEI 353
           E  A++  + EK  D+ +     +++    ++ L + +L +IE  NEI
Sbjct: 200 EEFAKL--RPEKLLDETIRAIDSELLSM--FEVLKKLQLQEIEMSNEI 243

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa]
           {ON} similar to uniprot|Q12749 Saccharomyces cerevisiae
           YLR383W RHC18 Protein involved in structural maintenance
           of chromosomes required for interchromosomal and sister
           chromatid recombination
          Length = 1111

 Score = 37.7 bits (86), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 11/79 (13%)

Query: 142 DSHQPSGEQQGRLFIDKLVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLF 200
           D+  P G      +I K++L+NF  +   ++ +GP     + +VG NGSGKS V+ ++  
Sbjct: 67  DNSPPPG------YIKKVILKNFMCHEHFELELGP---RLNFIVGNNGSGKSAVLTAITI 117

Query: 201 VFGFRANKM-RQDRLSDLI 218
             G +A    R   L DLI
Sbjct: 118 GLGAKATDTNRGSSLKDLI 136

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1316 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1362
            RN+  LSGGEK+ S ++L+ A  +   + +  +DE D  +D  N +I
Sbjct: 1010 RNVDTLSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRTI 1056

>TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2.351
            YDL102W
          Length = 1094

 Score = 37.4 bits (85), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 9/71 (12%)

Query: 1344 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG 1394
            PLYV++   +ID+     N      +SI+A  I E+  NA F+V S++ N  E+   L+G
Sbjct: 939  PLYVLEHNIQIDSRYYLTNQLQNPLISIIAPIIGEKQANAMFVVKSIKINTGEMKGGLMG 998

Query: 1395 VYKRDNRTKST 1405
              K+ +  KS 
Sbjct: 999  FIKKVDSCKSC 1009

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 37.4 bits (85), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 10/63 (15%)

Query: 146 PSGEQQGRLFIDKLVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGF 204
           P+G      ++ ++ L+NF  +   ++  GP     + +VG NGSGKS ++ ++  VFG 
Sbjct: 58  PAG------YMKRITLKNFMCHEHFELEFGP---RLNFIVGSNGSGKSAILTAITVVFGA 108

Query: 205 RAN 207
           +A+
Sbjct: 109 KAS 111

 Score = 35.8 bits (81), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 80/203 (39%), Gaps = 21/203 (10%)

Query: 1169 DRHCMNIDETSDEVSRG--IPRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEY 1226
            +RHC      S+EV+ G  IP   E    E+ +E+   D      +I      +G+ +E 
Sbjct: 868  ERHC------SEEVAYGSEIPNTEE----EVRMEMRIAD-----RHIKQAEKSVGMTQEE 912

Query: 1227 ARRLAEFKRRKLDLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMG 1286
              RL E  R K     A +K   V   L  L +      +T  N I  T +E        
Sbjct: 913  VARLLESTREKF--YDAQEKYSAVDRALWSLHESLEQRRITLMNNIKSTCREADSDFRTT 970

Query: 1287 GNAELELVDSLDPFSEGVTFSVMPPK--KSWRNITNLSGGEKTLSSLALVFALHKYKPTP 1344
                     +L+  + G    ++     ++ RN+  LSGGEK+ S + L+ +        
Sbjct: 971  IRVRNGFSGALNFDTPGALMVLVKTANDETPRNVDTLSGGEKSFSQITLLLSTWSTMRAR 1030

Query: 1345 LYVMDEIDAALDFRNVSIVANYI 1367
            +  +DE D  +D  N +I    I
Sbjct: 1031 IIALDEFDVFMDQVNRTIGTRMI 1053

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score = 36.2 bits (82), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 36/72 (50%), Gaps = 10/72 (13%)

Query: 1300 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1359
            F EGV   V P        T LSGG+K   +LA  F LH      L ++DE  +ALD ++
Sbjct: 572  FPEGVNTLVGPRG------TQLSGGQKQRIALARAFLLHP----ALLILDEATSALDSQS 621

Query: 1360 VSIVANYIKERT 1371
              IVA  + ER 
Sbjct: 622  EEIVAKNLSERV 633

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} similar
            to uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1102

 Score = 36.2 bits (82), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 10/73 (13%)

Query: 1300 FSEGVTFSV----------MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1349
            FS G+ F+            P  +  RN+   SGGEK+ S ++L+ A  +   + +  +D
Sbjct: 976  FSGGLNFNFSKETLNMLVKTPNDEKPRNVDTFSGGEKSFSQISLLLATWRPMRSRIIALD 1035

Query: 1350 EIDAALDFRNVSI 1362
            E D  +D  N  I
Sbjct: 1036 EFDVFMDQVNRQI 1048

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1102

 Score = 36.2 bits (82), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 1316 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1373
            R++  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I    I +  K+  
Sbjct: 1002 RDVDTLSGGEKSFSQMALLLATWAPMRSRITALDEFDVFMDQVNRKIGTGLIVKTLKDNA 1061

Query: 1374 -AQFIVIS 1380
              Q I+I+
Sbjct: 1062 RTQTIIIT 1069

 Score = 35.8 bits (81), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 61/133 (45%), Gaps = 19/133 (14%)

Query: 146 PSGEQQGRLFIDKLVLENFKSYAGKQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGF 204
           PSG       + K++L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G 
Sbjct: 68  PSGS------LKKVILRNFMCHENFEMELGP---RLNFIVGNNGSGKSAILTAIAVGLGV 118

Query: 205 RANKM-RQDRLSDLIHKSEEFPNLQSCSVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAF 263
           +A++  R   L DLI +        S S  +   Y+ +   G+ + D     ++I R   
Sbjct: 119 KASETNRGVSLKDLIREG-------SYSAKITL-YLDNSRIGSYKSDVYGDTIIIERTLK 170

Query: 264 RNNSSKYYINGKE 276
           R+    + +  KE
Sbjct: 171 RDGPPSFSLKTKE 183

>YLL057C Chr12 complement(25756..26994) [1239 bp, 412 aa] {ON}
           JLP1Fe(II)-dependent sulfonate/alpha-ketoglutarate
           dioxygenase, involved in sulfonate catabolism for use as
           a sulfur source; contains sequence that resembles a J
           domain (typified by the E. coli DnaJ protein); induced
           by sulphur starvation
          Length = 412

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 6/82 (7%)

Query: 145 QPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGF 204
           +P  E+  R+F D      + +    ++  P +T FS V GP+G G +   D+   +  F
Sbjct: 198 RPDAEEFARVFDDSTSSGGWHTDVSYELQPPSYTFFSVVEGPDGGGDTLFADT---IEAF 254

Query: 205 -RANKMRQDRLSDL--IHKSEE 223
            R +K  QD LS L  IH S+E
Sbjct: 255 DRLSKPLQDFLSTLHVIHSSKE 276

>Suva_10.12 Chr10 complement(21728..22966) [1239 bp, 412 aa] {ON}
           YLL057C (REAL)
          Length = 412

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 4/81 (4%)

Query: 145 QPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGF 204
           +P  ++  R+F D      + +    ++  P +T F+ V GP+G G +   D++   F  
Sbjct: 198 RPDADEFARVFKDSTTSRGWHTDVSYELQPPSYTFFTVVEGPDGGGDTLFADTIE-AFN- 255

Query: 205 RANKMRQDRLSDL--IHKSEE 223
           R +K  QD LS L  IH S+E
Sbjct: 256 RLSKPLQDFLSTLHVIHSSKE 276

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa] {ON}
            similar to uniprot|P33310 Saccharomyces cerevisiae
            YLR188W MDL1 Half-type ATP-binding cassette (ABC)
            transporter of the inner mitochondrial membrane mediates
            export of peptides generated upon proteolysis of
            mitochondrial proteins plays a role in the regulation of
            cellular resistance to oxidative stress
          Length = 714

 Score = 33.1 bits (74), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 41/81 (50%), Gaps = 6/81 (7%)

Query: 1321 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS 1380
            LSGG+K   +LA  F L       L V+DE  +ALD ++  IVA  ++ER +      IS
Sbjct: 590  LSGGQKQRVALARAFLLDP----ALLVLDEATSALDSQSEEIVARTLQERVRRG-LTTIS 644

Query: 1381 LRNNMFELAQQL-VGVYKRDN 1400
            + + +  +A    V V  RD 
Sbjct: 645  IAHRISTIAHSTRVVVLGRDG 665

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR188W
            (MDL1)
          Length = 677

 Score = 32.7 bits (73), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 11/82 (13%)

Query: 1300 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1359
            F EG+  +V P        T LSGG+K   +LA  F     +   + ++DE  +ALD ++
Sbjct: 555  FPEGLQTAVGPRG------TQLSGGQKQRVALARAF----LQDPAILILDEATSALDSKS 604

Query: 1360 VSIVANYIKERTKNAQFIVISL 1381
              IVA+ + +R + A+ I IS+
Sbjct: 605  EDIVASTLLQRCQEAK-ITISI 625

>KLTH0G15532g Chr7 (1358507..1359757) [1251 bp, 416 aa] {ON} conserved
            hypothetical protein
          Length = 416

 Score = 32.3 bits (72), Expect = 8.6,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 10/67 (14%)

Query: 1135 DILDKEGEDRQETNQEDISGEAKGETQGEEGDNDDRHCMNIDETSDEVSRGIPRLSEDEL 1194
            D  +   EDR E + ED +          E   +DRH  N  +   E  RG+ RLS D +
Sbjct: 285  DYAEDRAEDRAEDHAEDHA----------EDHAEDRHVKNHPKAQPEEQRGVARLSPDGV 334

Query: 1195 KELNIEL 1201
            +++ + L
Sbjct: 335  RQIGVAL 341

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.130    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 140,861,752
Number of extensions: 6416259
Number of successful extensions: 45155
Number of sequences better than 10.0: 1523
Number of HSP's gapped: 42738
Number of HSP's successfully gapped: 3005
Length of query: 1416
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1294
Effective length of database: 39,492,147
Effective search space: 51102838218
Effective search space used: 51102838218
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 72 (32.3 bits)