Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_10.1698.258ON43843823610.0
Skud_12.1538.258ON43843821420.0
YLR085C (ARP6)8.258ON43843821090.0
Smik_12.1448.258ON43843820830.0
KAFR0B027008.258ON42043816250.0
NDAI0B019608.258ON43944216250.0
NCAS0B049908.258ON42043816210.0
ZYRO0C01738g8.258ON41443816030.0
Kpol_543.368.258ON42743915940.0
KLTH0G13772g8.258ON42043815860.0
TDEL0F038508.258ON41943915850.0
TBLA0H014608.258ON44244615690.0
SAKL0H17138g8.258ON41944015240.0
Kwal_56.238328.258ON41943815100.0
CAGL0L12166g8.258ON42143315050.0
KNAG0G020108.258ON42443714930.0
Ecym_43128.258ON41143414500.0
KLLA0F19063g8.258ON41544213960.0
AGR091W8.258ON41043413880.0
TPHA0A018308.258ON42144013760.0
NCAS0C037008.23ON3754372561e-23
TBLA0C004408.23ON3754372562e-23
TPHA0D002508.23ON3754372543e-23
ZYRO0F02772g8.23ON3754372543e-23
TDEL0C004708.23ON3754372543e-23
CAGL0K12694g8.23ON3754372543e-23
Suva_6.188.23ON3754372543e-23
Smik_6.398.23ON3754372543e-23
YFL039C (ACT1)8.23ON3754372543e-23
KNAG0L002508.23ON3754372534e-23
KAFR0D009408.23ON3754372534e-23
NDAI0G030408.23ON3754372525e-23
SAKL0B00968g8.23ON3754372508e-23
ABR222W8.23ON3764372509e-23
Kpol_1058.158.23ON3754372501e-22
KLLA0D05357g8.23ON3754372463e-22
KLTH0G18832g8.23ON3754372454e-22
Ecym_15208.23ON3764372437e-22
Skud_6.318.23ON3603892428e-22
Kwal_14.11098.23ON3603892341e-20
Ecym_63852.117ON3774442074e-17
TBLA0F008703.161ON3913882058e-17
NDAI0G029003.161ON3913862041e-16
KLTH0F06490g3.161ON3913842031e-16
ZYRO0B04928g3.161ON3914532022e-16
AFR051W2.117ON4054441978e-16
Ecym_32852.248ON7461631991e-15
Kwal_23.48482.248ON7451571972e-15
ZYRO0G05676g2.117ON3814361942e-15
SAKL0E11814g2.117ON3794501932e-15
TDEL0C041402.248ON7491601963e-15
CAGL0K01595g3.161ON3913841933e-15
NCAS0C035503.161ON3923861933e-15
KLLA0C03850g3.161ON3913861915e-15
TPHA0I013002.117ON3794361906e-15
SAKL0C07370g3.161ON3913841906e-15
KNAG0K01130na 1ON3933861899e-15
Skud_4.2223.161ON3913861881e-14
ADR316W3.161ON3913861881e-14
Ecym_52373.161ON3913841871e-14
KNAG0I018602.248ON7531561892e-14
Suva_4.2203.161ON3913861872e-14
Kwal_33.141773.161ON3373181852e-14
SAKL0E08602g2.248ON7471571892e-14
TDEL0D046103.161ON3913841862e-14
KLLA0E22925g2.117ON3804431853e-14
YDL029W (ARP2)3.161ON3913861843e-14
Smik_4.2063.161ON3913861844e-14
NDAI0D010602.248ON7531561864e-14
TDEL0B048102.117ON3734341835e-14
Kpol_479.253.161ON3913861792e-13
Suva_14.2812.248ON7551581802e-13
Kpol_1003.162.248ON7491551803e-13
NCAS0B071302.117ON3814481764e-13
KNAG0B001701.514ON4534411765e-13
Smik_14.2672.248ON7551561775e-13
YNL059C (ARP5)2.248ON7551561767e-13
KLTH0G09482g2.248ON7451571751e-12
KLLA0B13904g1.514ON4564461721e-12
ADL253C2.248ON7511571741e-12
SAKL0D12804g1.514ON4564401712e-12
KAFR0D037001.514ON4494381703e-12
TBLA0D036801.514ON4584491703e-12
TBLA0E038602.248ON7591561713e-12
TPHA0O010401.514ON4584311684e-12
NDAI0A039701.514ON4624471685e-12
YJR065C (ARP3)1.514ON4494531685e-12
Skud_14.2722.248ON7551661696e-12
TDEL0F004701.514ON4614491676e-12
KLLA0F03421g2.248ON7471561687e-12
CAGL0F00517g1.514ON4542551667e-12
Kpol_1023.188.23ON3193501631e-11
KAFR0C01040na 1ON3373201631e-11
KLTH0C02508g1.514ON4514401651e-11
TPHA0A009203.161ON3913841632e-11
AFR419C1.514ON4552541622e-11
Suva_12.1541.514ON4494451623e-11
NDAI0B044602.117ON3813881613e-11
Kpol_1056.161.514ON4604151613e-11
ZYRO0G01936g1.514ON4614061613e-11
NCAS0A122701.514ON4542571613e-11
CAGL0J10054g2.248ON7541551615e-11
Smik_10.3551.514ON4492571588e-11
Skud_10.2891.514ON4492571571e-10
Ecym_31531.514ON4582581561e-10
ZYRO0A01584g2.248ON7481541553e-10
TPHA0C031602.248ON7551561543e-10
Skud_8.1902.117ON3844381515e-10
Smik_8.2102.117ON3843871515e-10
Suva_15.3262.117ON3843831515e-10
CAGL0H09042g2.117ON3874281507e-10
YHR129C (ARP1)2.117ON3843881453e-09
KNAG0H036502.117ON3874301444e-09
KLTH0B05940g2.117ON3832491434e-09
Kwal_27.99581.514ON4453931435e-09
Kwal_33.146422.117ON3834421382e-08
KAFR0F005902.117ON3864031346e-08
KAFR0J011602.248ON7511561349e-08
TBLA0B010702.117ON3834341231e-06
Kpol_282.41.287ON5011461151e-05
KLLA0D02288g1.287ON5201051142e-05
TBLA0D053601.287ON5961251098e-05
AFR105C1.287ON4791051052e-04
TPHA0I010301.287ON5033251052e-04
NDAI0G055801.287ON5152421034e-04
ZYRO0G21428g1.287ON4834641026e-04
NCAS0G030502.248ON743142980.002
TDEL0D015501.287ON48089970.002
Ecym_63301.287ON480105950.004
Smik_10.1611.287ON489237880.028
KLTH0H09702g1.287ON481105870.037
Suva_6.1541.287ON489237870.038
CAGL0M03201g1.287ON49352870.039
YJL081C (ARP4)1.287ON489237840.083
SAKL0D05874g1.287ON497105820.15
Kwal_14.23771.287ON48189820.17
KAFR0A015601.287ON485113800.31
SAKL0F13772g7.448ON42284790.32
Skud_10.1321.287ON488237790.40
NCAS0B060601.287ON49734780.44
KLTH0C05324g7.448ON399210770.60
Kwal_27.105527.448ON351214760.70
KNAG0B019201.287ON505105741.5
TPHA0E006407.436ON1071182732.1
CAGL0K05335g7.448ON52940722.6
KNAG0G026808.699ON608135722.6
ACR184C7.448ON40185712.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_10.169
         (438 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...   914   0.0  
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...   829   0.0  
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...   816   0.0  
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...   806   0.0  
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...   630   0.0  
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...   630   0.0  
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...   629   0.0  
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...   622   0.0  
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...   618   0.0  
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...   615   0.0  
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...   615   0.0  
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...   608   0.0  
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...   591   0.0  
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...   586   0.0  
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...   584   0.0  
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...   579   0.0  
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...   563   0.0  
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...   542   0.0  
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...   539   0.0  
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...   534   0.0  
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   103   1e-23
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   103   2e-23
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   102   3e-23
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...   102   3e-23
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   102   3e-23
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   102   3e-23
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   102   3e-23
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   102   3e-23
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   102   3e-23
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   102   4e-23
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   102   4e-23
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   101   5e-23
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...   100   8e-23
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   100   9e-23
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...   100   1e-22
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...    99   3e-22
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...    99   4e-22
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...    98   7e-22
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    98   8e-22
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...    95   1e-20
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    84   4e-17
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    84   8e-17
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    83   1e-16
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    83   1e-16
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    82   2e-16
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    80   8e-16
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    81   1e-15
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    80   2e-15
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    79   2e-15
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    79   2e-15
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    80   3e-15
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    79   3e-15
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    79   3e-15
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    78   5e-15
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    78   6e-15
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    78   6e-15
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    77   9e-15
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    77   1e-14
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    77   1e-14
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    77   1e-14
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    77   2e-14
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    77   2e-14
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    76   2e-14
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    77   2e-14
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    76   2e-14
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    76   3e-14
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    75   3e-14
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    75   4e-14
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    76   4e-14
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    75   5e-14
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    74   2e-13
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    74   2e-13
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    74   3e-13
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    72   4e-13
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...    72   5e-13
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    73   5e-13
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    72   7e-13
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    72   1e-12
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...    71   1e-12
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    72   1e-12
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...    70   2e-12
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...    70   3e-12
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...    70   3e-12
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    70   3e-12
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....    69   4e-12
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514     69   5e-12
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...    69   5e-12
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    70   6e-12
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...    69   6e-12
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    69   7e-12
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...    69   7e-12
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...    67   1e-11
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    67   1e-11
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...    68   1e-11
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    67   2e-11
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...    67   2e-11
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...    67   3e-11
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    67   3e-11
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....    67   3e-11
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...    67   3e-11
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...    67   3e-11
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    67   5e-11
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...    65   8e-11
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...    65   1e-10
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...    65   1e-10
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    64   3e-10
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    64   3e-10
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    63   5e-10
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    63   5e-10
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    63   5e-10
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    62   7e-10
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    60   3e-09
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    60   4e-09
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    60   4e-09
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...    60   5e-09
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    58   2e-08
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    56   6e-08
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    56   9e-08
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    52   1e-06
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    49   1e-05
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    49   2e-05
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    47   8e-05
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    45   2e-04
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    45   2e-04
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    44   4e-04
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    44   6e-04
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    42   0.002
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    42   0.002
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    41   0.004
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    39   0.028
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    38   0.037
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    38   0.038
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    38   0.039
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    37   0.083
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    36   0.15 
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    36   0.17 
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    35   0.31 
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    35   0.32 
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    35   0.40 
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    35   0.44 
KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {...    34   0.60 
Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {...    34   0.70 
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    33   1.5  
TPHA0E00640 Chr5 complement(113447..116662) [3216 bp, 1071 aa] {...    33   2.1  
CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} simil...    32   2.6  
KNAG0G02680 Chr7 (600934..602760) [1827 bp, 608 aa] {ON} Anc_8.6...    32   2.6  
ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON} S...    32   2.9  

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  914 bits (2361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/438 (100%), Positives = 438/438 (100%)

Query: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP
Sbjct: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180
           EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180

Query: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
           NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD
Sbjct: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300
           ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD
Sbjct: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300

Query: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360
           AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF
Sbjct: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360

Query: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYY 420
           NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYY
Sbjct: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYY 420

Query: 421 EHGPDWCTKHRFGYQNWI 438
           EHGPDWCTKHRFGYQNWI
Sbjct: 421 EHGPDWCTKHRFGYQNWI 438

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  829 bits (2142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/438 (89%), Positives = 413/438 (94%)

Query: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           ME  PIVIDNGSYEIKF PSTN+MPFRALNALAKDKFGTSYLSNHIKNIKDISS+TFRRP
Sbjct: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLTLWELESCIWDYC FNPSEF GFDLKEGKGHHLVASESCMTLPELSKHADQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180
           EEYEFDSLFKSPVAVFVPFTKSYKGK++TISGKDE+ADV  S+S   TFTS+E     NS
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180

Query: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
           ++DYHDFQLVIDSGF+CTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300
           ETILVNN+KEKCLFVSP SYFDSFK+K+KH LEYVLPDFQTSFIGYVR+P EE+SPLP D
Sbjct: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300

Query: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360
           AQ+I LTDELFTIPETFFHPEISQI KPGIVEAILESLSMLPEIVRPLM+GNIVCTGGNF
Sbjct: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYY 420
           NLPNFAQRLA ELQRQLPTDWTC+VSVP GDC LFGWEVMSQFAKTESY+RARVTR+EYY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYY 420

Query: 421 EHGPDWCTKHRFGYQNWI 438
           EHGPDWCTK RFGYQNWI
Sbjct: 421 EHGPDWCTKQRFGYQNWI 438

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/438 (89%), Positives = 413/438 (94%)

Query: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           ME PPIVIDNGSYEIKFGPSTNK PFRALNALAKDKFGTSYLSNHIKNIKDISS+TFRRP
Sbjct: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180
           EEYEFDSLFKSPVAVFVPFTKSYKG+MRTISGKDED D+   +SD    TS E  +  +S
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGNSDSTNSTSSESKNAQDS 180

Query: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
            +DYHDFQLVIDSGF+CTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD
Sbjct: 181 GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300
           ETILVNNIKE+CLFVSP SYFDSFK+K+KH LEYVLPDFQTSF+GYVR+P +E+ PLP D
Sbjct: 241 ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED 300

Query: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360
           AQ ITLTDELFTIPETFFHPEISQI KPGIVEAILESLSMLPEIVRPLM+GNIVCTGGNF
Sbjct: 301 AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYY 420
           NLPNFAQRLA ELQRQLPTDWTC+VSVPEGDC LFGWEVMSQFAKT+SY++ARVTREEYY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYY 420

Query: 421 EHGPDWCTKHRFGYQNWI 438
           EHGPDWCTKHRFGYQNWI
Sbjct: 421 EHGPDWCTKHRFGYQNWI 438

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/438 (86%), Positives = 402/438 (91%)

Query: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           ME  PIVIDNGSYEIKFGPSTN+ PFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP
Sbjct: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLTLWELESCIWDYC FNP EFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180
           EEYEFDSLFKSPVA FVPFTKSYK KM+ ISGKDEDAD+ +S S++    S  P D    
Sbjct: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180

Query: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
           ++DYHDFQLVIDSGF+CTWIIPVLKGIPYYKAVKKLD+GGRFLTGLLKETLSFRHYNMMD
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240

Query: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300
           ETILVNNIKEKCLFVSP SYFDSFK K+KH LEYVLPDFQTSF+GYVR+  +E+SPL  D
Sbjct: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300

Query: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360
           AQ+ITLTDELFTIPETFFHPEI+QI KPGIVEAILESLSMLPEIVRPLM+GNIVCTGGNF
Sbjct: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYY 420
           NLPNFAQRLA ELQRQLPTDWTC+VSVPE DC LFGWEVMSQF+ T SY+ ARVTREEYY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYY 420

Query: 421 EHGPDWCTKHRFGYQNWI 438
           EHG DWCTKHRFGYQNWI
Sbjct: 421 EHGSDWCTKHRFGYQNWI 438

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/438 (66%), Positives = 352/438 (80%), Gaps = 18/438 (4%)

Query: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           ME  P+VIDNGSY +KFGP++ + P+ ALNA+A DK+  SYLSN IK+IKDISSV+ +RP
Sbjct: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           H LGQLT WE+++ IWDYCL+NP EF+GF++ + K  HL+ SE+CMTLPEL K+ DQVIF
Sbjct: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180
           EEYEF SL KSPVA ++PF ++ K +            + I + D       EP  ET S
Sbjct: 121 EEYEFGSLMKSPVAGYMPFLRNTKDQ------------IIIGERD------TEPFVETPS 162

Query: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
             +Y DFQLV+DSGF+CTWIIPV+KGIPYYKAVKKLDIGGRFL GLLKETLSFRHYN+MD
Sbjct: 163 TEEYRDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 222

Query: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300
           ETILVNNIKEKCLFVSP SYFDSFK+K+    EYVLPDFQTSF+GYVR  NE+  PLP D
Sbjct: 223 ETILVNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPED 282

Query: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360
           +QSITL DELF +PETFFHPEISQI+KPG+VE ILESLSM+PE++RPLM+ NI+C GGNF
Sbjct: 283 SQSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNF 342

Query: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYY 420
           NLP+FA R+A+ELQRQLPTDW C +++ +G+  L GW+ MS FA T+ Y+  RVTREEYY
Sbjct: 343 NLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYY 402

Query: 421 EHGPDWCTKHRFGYQNWI 438
           EHG DWCTKHRFGYQNW+
Sbjct: 403 EHGIDWCTKHRFGYQNWV 420

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/442 (65%), Positives = 361/442 (81%), Gaps = 7/442 (1%)

Query: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           M++ P+V+DNGSYEIKFG S ++ P+RALN  A DK+G++YLSN +K I+++S VT RRP
Sbjct: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLT WELESCIWDYCL+NP EFDGF+L      HL+ SE CMTLPELSK+ DQVIF
Sbjct: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120

Query: 121 EEYEFDSLFKSPVAVFVPF---TKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDE 177
           EEYEFDSLFK+P A ++PF       K  + TISGK  D D+ I  S++ T ++    D+
Sbjct: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDM-IGQSENVTISTDNLKDD 179

Query: 178 TNS-NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY 236
               +NDY D++LVIDSGF+CTWIIP++KG+PYYKA+KKLDIGGRFLTGLLKETLSFRHY
Sbjct: 180 KKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHY 239

Query: 237 NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSP 296
           ++MDET+LVNNIKEKCLFVSPTSYFDSFK+K +  +EY+LPD  +S++GY R    +  P
Sbjct: 240 DLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRE--NKSKP 297

Query: 297 LPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCT 356
           LP  +Q + L DELF++PETFFHPEIS+I+KPGIVE ILESLSM+PEI+RPL++ NIVCT
Sbjct: 298 LPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCT 357

Query: 357 GGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTR 416
           GGNFNLP+FA RLA ELQRQLPTDWTC +SVP+ +C LF W+ M QFA T+SY++ R+++
Sbjct: 358 GGNFNLPHFAARLAAELQRQLPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISK 417

Query: 417 EEYYEHGPDWCTKHRFGYQNWI 438
           EEYYEHGPDW TKH+FGYQNW+
Sbjct: 418 EEYYEHGPDWLTKHKFGYQNWL 439

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/438 (68%), Positives = 356/438 (81%), Gaps = 18/438 (4%)

Query: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           ME+ PI IDNGSYEIKFG +    P+RA+NA A DK+ T+YLSN IKNIKDI+SVTFRRP
Sbjct: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLT WELES IWDY LFNP EF GFDL + KG HL+ASE+CMTLPELSK+ DQV+F
Sbjct: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180
           EEYEFDS +KS +A F+ F      K+  ISGK E+         D +  S   V E   
Sbjct: 121 EEYEFDSYYKSSIAGFIQFADDKNTKI--ISGKTEE---------DISLDSVNQVRE--- 166

Query: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
             +Y+D+QLVIDSGF+CTWIIPV+KG+PYYKAVKKLDIGGRFL GLLKETLSFRHY++MD
Sbjct: 167 -KEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMD 225

Query: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300
           ETILVNNIKE CLFVSPTSYFDSFK+KN+  +EYVLP+FQT+F+G+VR   ++  PLP +
Sbjct: 226 ETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVR---DKTKPLPEN 282

Query: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360
            Q+I L DELF++PETFFHPEI++I+KPG+VE ILESLSM+PE++RPL++GN+VCTGGNF
Sbjct: 283 TQTIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNF 342

Query: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYY 420
           NLP+FA RL  ELQRQLPTDW C  SVP  +C LFGW+ M+QFA TESY++ RVTREEYY
Sbjct: 343 NLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYY 402

Query: 421 EHGPDWCTKHRFGYQNWI 438
           EHG DW TK+RFGYQNWI
Sbjct: 403 EHGTDWLTKNRFGYQNWI 420

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/438 (68%), Positives = 343/438 (78%), Gaps = 24/438 (5%)

Query: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           ME+PPIV+DNGSYEIKFG    + P RA NALA+DKFG+ YLSN IK IKDISSV FRRP
Sbjct: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HE GQLT WELES IWDYC FNP EF+GFDLK+ KG HLV SE+CMT+PELSK+ DQV+F
Sbjct: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180
           EEYEF S+FKSP+A F PF +        ISGK           DD+     EP      
Sbjct: 121 EEYEFASMFKSPIAGFAPFGRPSIA----ISGK----------GDDQPNRKAEP------ 160

Query: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
            + Y  FQLVID GF+CTW++PV+KGIPYYKAVKKLDIGGRFL GLLKETLSFRHYN+MD
Sbjct: 161 -DAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219

Query: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300
           ETILVNNIKE CLFVSP SYF+SFK K +  +EYVLPDFQTSF+GYV+ P +   PLP D
Sbjct: 220 ETILVNNIKENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKK---PLPQD 276

Query: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360
           +Q++ L DELF++PETFFHPEI Q++KPGI+E ILESLS+LPE +RPLM+GNIVCTGGNF
Sbjct: 277 SQTVELKDELFSVPETFFHPEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNF 336

Query: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYY 420
           NLPNFA RLA ELQRQLPTDWTC V +P G   L+GW  M+ F  +  Y  ARVTREEY+
Sbjct: 337 NLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYF 396

Query: 421 EHGPDWCTKHRFGYQNWI 438
           EHG DWCT+HRFGYQNW+
Sbjct: 397 EHGVDWCTRHRFGYQNWM 414

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/439 (66%), Positives = 353/439 (80%), Gaps = 13/439 (2%)

Query: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           ME  PIVIDNGSYE+KFG S  K+P RALNALAKDK+G  YLSN + NIKDISSVT RRP
Sbjct: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQL  WELE  +WDYC FNP EF  F+LKE KGHHLV SE+CMTLPELS + DQV+F
Sbjct: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180
           EEYEF+SLFKSPVA FVPF  + +  M+ I GK +D    +  +          +D  N 
Sbjct: 121 EEYEFESLFKSPVAGFVPFL-NLQDNMKMICGKGDDVMGDLISN----------MDSQNI 169

Query: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
            N Y DF LVIDSGF+CTWIIP++KG+PYYKAVKK+++GGRFL GL KET+S+RHY++ D
Sbjct: 170 KNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTD 229

Query: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300
           ETILVNNIKEKCLF+SPTSY DSFK+K+++ ++YVLPDFQTSFIGYV+   + +S LP +
Sbjct: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKD-KKSNSQLPEN 288

Query: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360
           +Q ITLTDELF++PET FHPE+++++KPGIVE ILESLS++PE +RPL++ NIVC GGNF
Sbjct: 289 SQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNF 348

Query: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAK-TESYQRARVTREEY 419
           N+PNF  RLA ELQRQLPTDW CN+ +PE DC L GW+ MSQFA+ T+ Y++AR++REEY
Sbjct: 349 NMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEY 408

Query: 420 YEHGPDWCTKHRFGYQNWI 438
           YEHG DW TK RFGYQNWI
Sbjct: 409 YEHGTDWTTKKRFGYQNWI 427

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/438 (65%), Positives = 347/438 (79%), Gaps = 18/438 (4%)

Query: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           ME  PIVIDNGSYEIKFG +++  PF ALN++AKDK+G  +LSN +++IKDISSVTF RP
Sbjct: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           H+LGQL  WELES IWDYCLFNP EFDG+ L   K  HL+ASESCMTLPELSK+ DQV+F
Sbjct: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180
           EEYE+DSLFK+PV VFVPF    +G    I    EDADV  SD          P D    
Sbjct: 121 EEYEYDSLFKAPVPVFVPFNA--EGDTTHILVAKEDADVVASD---------HPSD---- 165

Query: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
           N DY D++LVIDSGF+CTW++PV+KG+PYYKAVKKLDIGGRFL G L+E LSFRHYN+MD
Sbjct: 166 NKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMD 225

Query: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300
           ETILVN+IKEKCLF+SP SYFDSF+S+ K   EYVLPDF TSF GY+R P +    LP D
Sbjct: 226 ETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQT---LPED 282

Query: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360
           +Q+I L DELF +PETFFHPEI+ ++ PGI+EAILES+SMLPE +RPL++GN+V TGGNF
Sbjct: 283 SQTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNF 342

Query: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYY 420
           N+PNFA RLA ELQRQ PTDW+C VSVP GD  L+GW+ M +F++T++Y+ +RV+REEYY
Sbjct: 343 NIPNFASRLATELQRQCPTDWSCRVSVPTGDARLYGWKCMQKFSETQAYRESRVSREEYY 402

Query: 421 EHGPDWCTKHRFGYQNWI 438
           EHG DWCT  RFGYQ W+
Sbjct: 403 EHGVDWCTSKRFGYQAWL 420

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/439 (65%), Positives = 355/439 (80%), Gaps = 21/439 (4%)

Query: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           ME+ P+V+DNGSYE+KFG ST   PFRALNALA+DKFG +YLSN I  IKDISSV+F+RP
Sbjct: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HE GQLT WEL+SC+WDYC FNP+EFDGFDLK+ KG HL+ASE+CMTLPELSK+ DQV+F
Sbjct: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180
           EEYEFDSL K+P++ F+PF+K +    + ISGK         DS+  T TS+        
Sbjct: 121 EEYEFDSLLKAPISGFMPFSK-HTENTKVISGK--------GDSESGTSTSE-------- 163

Query: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
             DY  FQ+VIDSGF+CTW++P++KG+P+YKAVKKLD+GGRF+ GLLKETLSFRHYN+MD
Sbjct: 164 TKDYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMD 223

Query: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300
           ETILVNNIKEKCLF+SP SYFDSF  K++  +EYVLPDFQT+F+GYV    +  +P   D
Sbjct: 224 ETILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVA---DRKNPPSKD 280

Query: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360
           AQ++TL DELF++PETFFHPEI+Q++KPGI+E ILESLS++PE +RPLM+ NI+CTGGNF
Sbjct: 281 AQTVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNF 340

Query: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPE-GDCTLFGWEVMSQFAKTESYQRARVTREEY 419
           NLP+F +RLA ELQRQLPTDW+  + +P+   C L GW  MS FA T+ Y+ ARV+R+EY
Sbjct: 341 NLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEY 400

Query: 420 YEHGPDWCTKHRFGYQNWI 438
           YEHG +W TK+RFGYQNWI
Sbjct: 401 YEHGVEWTTKNRFGYQNWI 419

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/446 (64%), Positives = 354/446 (79%), Gaps = 12/446 (2%)

Query: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           M+  PIVIDNGSYEIKFG S +++PFRA+NA+AKDK+ T YLSN IK IKDISSV FRRP
Sbjct: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           +ELGQLT WELES IWDYC +NP EFDGF L++    HLV SE+C++LPE S++ D +IF
Sbjct: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGK--------DEDADVAISDSDDKTFTSK 172
           EEY + S++KSPVA F+PF    K  + +ISGK        +      +  +D  T+ S 
Sbjct: 121 EEYNYGSIYKSPVAGFIPFADLTKDVI-SISGKADDDDDDNNAKFQEQLVTNDLNTYISS 179

Query: 173 EPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232
           E    T +  +Y DFQL+IDSGF+CTWIIPV+KGIPYYKA+KK+DIGGRFLTGLLKETLS
Sbjct: 180 EEPSVTKTA-EYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLS 238

Query: 233 FRHYNMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNE 292
           FRHYN+ DETILVNNIKEKCLFV+P SY +SFK KNK  +EYVLPDF T+F+GY++  + 
Sbjct: 239 FRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIK--DN 296

Query: 293 EDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGN 352
             + LP +AQ ITL DELF++ ET FHPEIS+I+KPGI+E I+ESLSMLPE++RPLM+ N
Sbjct: 297 SKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNN 356

Query: 353 IVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRA 412
           IVC GGNFNLPNF++RL  ELQRQLPTDWT +V +P+ D  LFGW+ M+QF+ T+SY++A
Sbjct: 357 IVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKA 416

Query: 413 RVTREEYYEHGPDWCTKHRFGYQNWI 438
           R+TREEY EHG +WCTKHRFGYQNWI
Sbjct: 417 RITREEYMEHGVEWCTKHRFGYQNWI 442

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/440 (64%), Positives = 339/440 (77%), Gaps = 23/440 (5%)

Query: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           M+  PI+IDNGSYE+KFGP+TN  PFRALNALA+DK+G  +LSN +  +KDIS+V FRRP
Sbjct: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLT WEL+SCIWDYCL+NP EF+ +++   KG HLV SE CM++PELSK  DQV+F
Sbjct: 61  HELGQLTSWELQSCIWDYCLYNPDEFN-WEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119

Query: 121 EEYEFDSLFKSPVAVFVPFT-KSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETN 179
           EEYEF S FK PVA FVPF  ++ +  M             I   +D  +      D T 
Sbjct: 120 EEYEFGSCFKGPVAGFVPFNWQALEHNM-------------IYAKEDSVYRK----DSTG 162

Query: 180 SNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMM 239
             N+Y+DFQLVIDSGF+CTW++P++KGIPYYKA+KKLDIGGRFL G LKETLSFRHYN+M
Sbjct: 163 ERNEYNDFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVM 222

Query: 240 DETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPT 299
           DETILVNNIKEKCLF+SP SYF+SF+ K     EYVLPDFQTSF GYV+   ++   +P 
Sbjct: 223 DETILVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVK---QQKQKIPE 279

Query: 300 DAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGN 359
           D+Q+I L DELF+IPETFFHPEI+ ++KPGIVE ILES+SMLPE +RPLM+ N V TGGN
Sbjct: 280 DSQTIKLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGN 339

Query: 360 FNLPNFAQRLARELQRQLPTDWTCNVSVPEG-DCTLFGWEVMSQFAKTESYQRARVTREE 418
           FN+ NFA+RLA ELQRQ PTDW   VSVP   D  LFGW+ M QF++T +YQ+ RVTREE
Sbjct: 340 FNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREE 399

Query: 419 YYEHGPDWCTKHRFGYQNWI 438
           YYEHG DWCTK RFGYQ W+
Sbjct: 400 YYEHGVDWCTKQRFGYQKWL 419

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/438 (61%), Positives = 338/438 (77%), Gaps = 19/438 (4%)

Query: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           ME  P++IDNGSYEIKFG  + K P RALN++AKDK+G  +LSN +++IKDISSV F RP
Sbjct: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQL  WELE+ IWDYCLFNP +F+G+ +   KG HL+ SESCMT+PELSK+ DQV+F
Sbjct: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180
           EEYEF+++FK+PV VFVPF           +GK     +   +  +   +   P      
Sbjct: 121 EEYEFETMFKAPVPVFVPFN----------TGKKSTHMLVAKEDSEVEESEVAPA----- 165

Query: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
             +Y+DFQLVIDSGF+C+WI+PV+KG+PYYKAVKKLDIGGRFL G L+E LSFRHYN+MD
Sbjct: 166 -KNYNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMD 224

Query: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300
           ETILVN+IKE CLF+SP +YF+SF+S++K   EYVLPDF TSF GY+R P +    LP +
Sbjct: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQ---VLPAE 281

Query: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360
           +Q+I L DELF +PETFFHPEI+ ++  GIVE ILES+SMLPE +RPLM+GNIV TGGNF
Sbjct: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341

Query: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYY 420
           N+PNFA RLA ELQRQ PTDW+C VS+P+GD  L+GW+ M +F++TE Y  +RVTR+EYY
Sbjct: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401

Query: 421 EHGPDWCTKHRFGYQNWI 438
           EHG DWCT  RFGYQ W+
Sbjct: 402 EHGVDWCTAKRFGYQAWL 419

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/433 (61%), Positives = 341/433 (78%), Gaps = 18/433 (4%)

Query: 6   IVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRPHELGQ 65
           IVIDNGSY++KFG ++   P  ALNALAKDK+G ++LSN ++NIKDISSV FRRPHELGQ
Sbjct: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66

Query: 66  LTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEF 125
           LT WELESCIWDYCL+NP EF G D +  +  H+V SE+CMTLPELSK+ DQV+FEEYE 
Sbjct: 67  LTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEV 125

Query: 126 DSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNSNNDYH 185
           DSL+K+P A ++PF  + +  ++TISGK +  ++ I +             +  +  +Y+
Sbjct: 126 DSLYKAPTAAYIPFYTTNEN-IKTISGKSDHGELDIEE-------------KIEAGKEYN 171

Query: 186 DFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILV 245
           DF LVIDSGF+CTW+IP++KG+PYYKAVKKLD+GGRFL GLLKET+SFRHYN+MDE+ILV
Sbjct: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILV 231

Query: 246 NNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQSIT 305
           NNIKE+CL+V P SYF++FK+K K+ +++VLPDFQTSF GYVR P    + LP +AQ +T
Sbjct: 232 NNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPK---TALPDNAQILT 288

Query: 306 LTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNF 365
           LTDE F++PE FFHPEISQ +KPGI+E +LES+ MLPE++RPLM  NIVC GGNFNLP F
Sbjct: 289 LTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGF 348

Query: 366 AQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYYEHGPD 425
             RL  ELQRQLPTDW C   +  GD +L GW  M++FA T++Y++ARVT+E+Y+EHG D
Sbjct: 349 TDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLD 408

Query: 426 WCTKHRFGYQNWI 438
           W TK RFGYQNW+
Sbjct: 409 WTTKERFGYQNWV 421

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/437 (62%), Positives = 331/437 (75%), Gaps = 18/437 (4%)

Query: 5   PIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRPHELG 64
           P VIDNGSYEIKFG +    PFRA N +AKDK+G SYLSNH+K I+DISS T RRPHELG
Sbjct: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELG 62

Query: 65  QLTLWELESCIWDYCLFNPSEFDGFDLKEG-KGHHLVASESCMTLPELSKHADQVIFEEY 123
           QL  WELE CIWDYCL+NP EFDGF L +  +   L+ +E+C TLPELSK++DQV+FEEY
Sbjct: 63  QLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEY 122

Query: 124 EFDSLFKSPVAVFVPFTKSYKGK-MRTISGKDEDADVAISDSDDKTFTSKEPVDETNSNN 182
           EF ++FKSP + F+PF      K M  + GKD   +     +D  T T+KE         
Sbjct: 123 EFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAVN-----TDYTTATTKE--------- 168

Query: 183 DYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDET 242
            Y DFQLVIDSGF+CTW++P++KG+P+YKA+KK+DIGGRFL GLLKETLSFRHYNMMDET
Sbjct: 169 -YRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDET 227

Query: 243 ILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQ 302
           IL+NNIKEKCLFVSP SYFDSFK+K +  +EYVLPDFQTSF+GY+   +          Q
Sbjct: 228 ILLNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287

Query: 303 SITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNL 362
           +ITLTDE F +PETFFHPE++ I+KPG+VE ILE++SM+PE +RP+++ NIVC GGNF L
Sbjct: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347

Query: 363 PNFAQRLARELQRQLPTDWTCNVSVP-EGDCTLFGWEVMSQFAKTESYQRARVTREEYYE 421
           P+ + RL  ELQRQLPTDWTC V+VP   DC L  W  M+QF+ T+ Y+  RVTREEY E
Sbjct: 348 PHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLE 407

Query: 422 HGPDWCTKHRFGYQNWI 438
           HG DWC+KHRF YQNWI
Sbjct: 408 HGTDWCSKHRFTYQNWI 424

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/434 (61%), Positives = 329/434 (75%), Gaps = 26/434 (5%)

Query: 5   PIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRPHELG 64
           PI+IDNGSYEIKFGPS+ K P+RALN LA+DK+G  +LSN +K I+++S+   RRP ELG
Sbjct: 4   PIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFELG 63

Query: 65  QLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYE 124
           QL  WELE  IWDYCLFN  EF  +DLK+ K   L+ SE+CM++PE+SKH DQV+FEEYE
Sbjct: 64  QLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEYE 122

Query: 125 FDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNSNNDY 184
           F SL K PVA ++PF              D  AD  +  SD      K+        +DY
Sbjct: 123 FGSLMKCPVAQYIPF--------------DNMADYKVYGSDGLPVVRKK--------DDY 160

Query: 185 HDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETIL 244
           +DFQLV+DSGF+CTW+IPV+KG+PYYKAVKKLDIGGRFLTGLLKET+SFRHYN+MDETIL
Sbjct: 161 NDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETIL 220

Query: 245 VNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQSI 304
            NNIKE+C F+ P SYFDSF+ K +  ++YVLPDFQTS IGYVR P +    +P D+Q++
Sbjct: 221 ANNIKEQCCFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQ---AIPEDSQTL 277

Query: 305 TLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPN 364
            L DELFTIPETFFHPEI+ I+KPG++E +LES+SMLPE++RPLM+ NI   GGNFN+ N
Sbjct: 278 NLEDELFTIPETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISN 337

Query: 365 FAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYYEHGP 424
           FA RLA ELQRQ PTDW+  V +P+GD  L GW+ M +F+ T+SY++ RVTR EY EHG 
Sbjct: 338 FASRLATELQRQCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGV 397

Query: 425 DWCTKHRFGYQNWI 438
           DWCTK+RFGY+ WI
Sbjct: 398 DWCTKYRFGYEQWI 411

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/442 (59%), Positives = 328/442 (74%), Gaps = 31/442 (7%)

Query: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           M  P +VIDNGSYEIKFG S    P RALN L KDK+   +LSN  K ++DIS    RRP
Sbjct: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDL---KEGKGHHLVASESCMTLPELSKHADQ 117
           HELGQL  WELES +WDYC +N  +F  ++L    + K HHLV SE+ MT+PELSK+ DQ
Sbjct: 61  HELGQLVSWELESEVWDYCFYNEDDFH-WNLTHDNDTKDHHLVVSETLMTIPELSKNMDQ 119

Query: 118 VIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDE 177
           VIFEEY+F S+FK PVA ++PF   Y+G+ +         D A++ ++DK  +S      
Sbjct: 120 VIFEEYDFKSMFKGPVAQYIPF---YQGQYQ---------DDAMTAAEDKKTSS------ 161

Query: 178 TNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYN 237
                 Y DFQLVIDSGF+CTW +P++KG+PYYKA+KKLDIGGRFLTGLL+ET+SFRHYN
Sbjct: 162 ------YKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN 215

Query: 238 MMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPL 297
           +M+ETILVNNIKE+C FV P SYF SF +K    +EYVLPDFQTSF+GYV+ P +E   L
Sbjct: 216 VMEETILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEK--L 273

Query: 298 PTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTG 357
             DAQ++ LTDE+F++PETFFHPEI+QI+KPGIVE ILE ++M PE+VRPL++ NIVCTG
Sbjct: 274 TDDAQTLLLTDEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTG 333

Query: 358 GNFNLPNFAQRLARELQRQLPTDWTCNVSVP-EGDCTLFGWEVMSQFAKTESYQRARVTR 416
           GNFN+PNF +RL  ELQRQ P DW+C V  P E D +L GWE M  FA ++ ++ ARVTR
Sbjct: 334 GNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTR 393

Query: 417 EEYYEHGPDWCTKHRFGYQNWI 438
           EEY EHG DWCTK+RFGYQ W+
Sbjct: 394 EEYLEHGLDWCTKNRFGYQQWL 415

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/434 (58%), Positives = 321/434 (73%), Gaps = 27/434 (6%)

Query: 5   PIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRPHELG 64
           P++++NGSYEIKFGP+  + P+RA N L +D++G  +LSN +  I+DIS    RRP ELG
Sbjct: 4   PLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSELG 63

Query: 65  QLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYE 124
           QL  WELE  IWDYCLFNP EF G++LK+ K   L+ASE+CMT+PE+SK+ DQV+FEEYE
Sbjct: 64  QLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYE 122

Query: 125 FDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNSNNDY 184
           F S+ K PVA FVPF ++             D D+     +         V E  S   Y
Sbjct: 123 FGSMMKCPVAQFVPFDRA------------RDYDIVGGAGE---------VVEAKSG--Y 159

Query: 185 HDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETIL 244
           ++FQLV+DSGF+CTW++PV+KG+PYYKA KKLDIGGRFL GLLKET+SFRHYN+MDETIL
Sbjct: 160 NNFQLVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETIL 219

Query: 245 VNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQSI 304
           +NNIKE+C F+ P SYFDSF+ K +  +EY+LPDFQTS IGYVR P +    +P  +Q +
Sbjct: 220 INNIKEQCCFMPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQ---AIPKTSQIL 276

Query: 305 TLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPN 364
            L DELFT+PETFFHPEIS I+KPG+VE ILE +SM+PE++RPL++ NIV  GGNFN+ N
Sbjct: 277 RLEDELFTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIAN 336

Query: 365 FAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYYEHGP 424
           FA RLA ELQRQ PTDW   V  P+ D  L GW+ M QF++T+SY+ +RVTR EY EHG 
Sbjct: 337 FATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGA 396

Query: 425 DWCTKHRFGYQNWI 438
           DWCTKHRFGY+ WI
Sbjct: 397 DWCTKHRFGYEQWI 410

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/440 (57%), Positives = 325/440 (73%), Gaps = 21/440 (4%)

Query: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           M   P++IDNGSYEIKFG S  + PF ALNALAKDK+ T YLSN I NIKDISSV+ +RP
Sbjct: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           H+LGQL  WELE  IWDYC +N  +F GF++ E   +HLV +E+ MTLPELS++ DQV+F
Sbjct: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180
           EEY FDSL+K+P A F+PF K+       +SGK                 SK  +D +  
Sbjct: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGK-----------------SKTYLDGSKE 163

Query: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
           NN Y DF LVIDSG++C+WIIP++KG+PYYKAVKK+D+GGRFL GLLKET+S+RHY++ D
Sbjct: 164 NN-YQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTD 222

Query: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300
           E++LVNNIKE C+F+SP SY +SFK K    +EYVLPDFQTSF+GYVR   ++ S LP  
Sbjct: 223 ESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDM-KKHSTLPEH 281

Query: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360
           +QSI L DELF++PE FFHPE++ ++KPGI+E ILESL +LPE +R LM+ NIVCTGGNF
Sbjct: 282 SQSIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNF 341

Query: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKT--ESYQRARVTREE 418
           N+PNF  R+  ELQ+Q+ T+W C+VS+P+ +  L  W+ M  F +   E Y+  RVT++E
Sbjct: 342 NIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQE 401

Query: 419 YYEHGPDWCTKHRFGYQNWI 438
           Y EHG +W TK RFGYQNW+
Sbjct: 402 YNEHGFEWTTKQRFGYQNWL 421

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  103 bits (256), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 106/437 (24%), Positives = 174/437 (39%), Gaps = 87/437 (19%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E   +VIDNGS   K G + +  P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLPE 110
           I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFT 170
             +   Q++FE +   + + S  AV   ++          SG+                 
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 HPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPL 348
             + E S    D Q IT+ +E F  PE  FHP I  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCN-VSVPEGDCTLFGWEVMSQFAKTE 407
           + GNIV +GG    P  A+R+ +E+    P+      ++ PE   ++  W   S  A   
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYQRARVTREEYYEHGP 424
           ++Q+  ++++EY E GP
Sbjct: 351 TFQQMWISKQEYDESGP 367

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  103 bits (256), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 105/437 (24%), Positives = 174/437 (39%), Gaps = 87/437 (19%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E   +VIDNGS   K G + +  P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLPE 110
           I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFT 170
             +   Q++FE +   + + S  AV   ++          SG+                 
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAIMRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 HPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPL 348
             + E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCN-VSVPEGDCTLFGWEVMSQFAKTE 407
           + GNIV +GG    P  A+R+ +E+    P+      ++ PE   ++  W   S  A   
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMEVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYQRARVTREEYYEHGP 424
           ++Q+  ++++EY E GP
Sbjct: 351 TFQQMWISKQEYDESGP 367

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  102 bits (254), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 105/437 (24%), Positives = 174/437 (39%), Gaps = 87/437 (19%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E   +VIDNGS   K G + +  P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLPE 110
           I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFT 170
             +   Q++FE +   + + S  AV   ++          SG+                 
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 HPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPL 348
             + E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKE 292

Query: 349 MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCN-VSVPEGDCTLFGWEVMSQFAKTE 407
           + GNIV +GG    P  A+R+ +E+    P+      ++ PE   ++  W   S  A   
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYQRARVTREEYYEHGP 424
           ++Q+  ++++EY E GP
Sbjct: 351 TFQQMWISKQEYDESGP 367

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score =  102 bits (254), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 104/437 (23%), Positives = 173/437 (39%), Gaps = 87/437 (19%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E   +VIDNGS   K G + +  P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLPE 110
           I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFT 170
             +   Q++FE +   + + S  AV   ++       RT                     
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-----RTTG------------------- 150

Query: 171 SKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSMPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 HPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPL 348
             + E S    D Q IT+ +E F  PE  FHP +  +   G+ +    S+      VR  
Sbjct: 233 SSSVEKSYELPDGQVITIGNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKD 292

Query: 349 MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCN-VSVPEGDCTLFGWEVMSQFAKTE 407
           + GNIV +GG    P  A+R+ +E+    P+      ++ PE   ++  W   S  A   
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYQRARVTREEYYEHGP 424
           ++Q+  ++++EY E GP
Sbjct: 351 TFQQMWISKQEYDESGP 367

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  102 bits (254), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 105/437 (24%), Positives = 173/437 (39%), Gaps = 87/437 (19%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E   +VIDNGS   K G + +  P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLPE 110
           I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFT 170
             +   Q++FE +   + + S  AV   ++       RT                     
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-----RTTG------------------- 150

Query: 171 SKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 HPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPL 348
             + E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCN-VSVPEGDCTLFGWEVMSQFAKTE 407
           + GNIV +GG    P  A+R+ +E+    P+      ++ PE   ++  W   S  A   
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYQRARVTREEYYEHGP 424
           ++Q+  ++++EY E GP
Sbjct: 351 TFQQMWISKQEYDESGP 367

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  102 bits (254), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 105/437 (24%), Positives = 173/437 (39%), Gaps = 87/437 (19%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E   +VIDNGS   K G + +  P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLPE 110
           I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFT 170
             +   Q++FE +   + + S  AV   ++       RT                     
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-----RTTG------------------- 150

Query: 171 SKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 HPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPL 348
             + E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCN-VSVPEGDCTLFGWEVMSQFAKTE 407
           + GNIV +GG    P  A+R+ +E+    P+      ++ PE   ++  W   S  A   
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYQRARVTREEYYEHGP 424
           ++Q+  ++++EY E GP
Sbjct: 351 TFQQMWISKQEYDESGP 367

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  102 bits (254), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 105/437 (24%), Positives = 173/437 (39%), Gaps = 87/437 (19%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E   +VIDNGS   K G + +  P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLPE 110
           I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFT 170
             +   Q++FE +   + + S  AV   ++       RT                     
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-----RTTG------------------- 150

Query: 171 SKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 HPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPL 348
             + E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCN-VSVPEGDCTLFGWEVMSQFAKTE 407
           + GNIV +GG    P  A+R+ +E+    P+      ++ PE   ++  W   S  A   
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYQRARVTREEYYEHGP 424
           ++Q+  ++++EY E GP
Sbjct: 351 TFQQMWISKQEYDESGP 367

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  102 bits (254), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 105/437 (24%), Positives = 173/437 (39%), Gaps = 87/437 (19%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E   +VIDNGS   K G + +  P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLPE 110
           I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFT 170
             +   Q++FE +   + + S  AV   ++       RT                     
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-----RTTG------------------- 150

Query: 171 SKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 HPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPL 348
             + E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCN-VSVPEGDCTLFGWEVMSQFAKTE 407
           + GNIV +GG    P  A+R+ +E+    P+      ++ PE   ++  W   S  A   
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYQRARVTREEYYEHGP 424
           ++Q+  ++++EY E GP
Sbjct: 351 TFQQMWISKQEYDESGP 367

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  102 bits (254), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 105/437 (24%), Positives = 173/437 (39%), Gaps = 87/437 (19%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E   +VIDNGS   K G + +  P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLPE 110
           I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFT 170
             +   Q++FE +   + + S  AV   ++       RT                     
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-----RTTG------------------- 150

Query: 171 SKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 HPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPL 348
             + E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCN-VSVPEGDCTLFGWEVMSQFAKTE 407
           + GNIV +GG    P  A+R+ +E+    P+      ++ PE   ++  W   S  A   
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYQRARVTREEYYEHGP 424
           ++Q+  ++++EY E GP
Sbjct: 351 TFQQMWISKQEYDESGP 367

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  102 bits (253), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 105/437 (24%), Positives = 174/437 (39%), Gaps = 87/437 (19%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E   +VIDNGS   K G + +  P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLPE 110
           I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFT 170
             +   Q++FE +   + + S  AV   ++          SG+                 
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 HPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPL 348
             + E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCN-VSVPEGDCTLFGWEVMSQFAKTE 407
           + GNIV +GG    P  A+R+ +E+    P+      ++ PE   ++  W   S  A   
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYQRARVTREEYYEHGP 424
           ++Q+  ++++EY E GP
Sbjct: 351 TFQQMWISKQEYDESGP 367

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  102 bits (253), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 105/437 (24%), Positives = 174/437 (39%), Gaps = 87/437 (19%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E   +VIDNGS   K G + +  P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLPE 110
           I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFT 170
             +   Q++FE +   + + S  AV   ++          SG+                 
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 HPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPL 348
             + E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCN-VSVPEGDCTLFGWEVMSQFAKTE 407
           + GNIV +GG    P  A+R+ +E+    P+      ++ PE   ++  W   S  A   
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYQRARVTREEYYEHGP 424
           ++Q+  ++++EY E GP
Sbjct: 351 TFQQMWISKQEYDESGP 367

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  101 bits (252), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 105/437 (24%), Positives = 175/437 (40%), Gaps = 87/437 (19%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E   +VIDNGS   K G + +  P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLPE 110
           I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFT 170
             +   Q++FE +   + + S  AV   ++          SG+                 
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTASQ 232

Query: 289 HPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPL 348
             + E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCN-VSVPEGDCTLFGWEVMSQFAKTE 407
           + GNIV +GG+   P  A+R+ +E+    P+      ++ PE   ++  W   S  A   
Sbjct: 293 LYGNIVMSGGSTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYQRARVTREEYYEHGP 424
           ++Q+  ++++EY E GP
Sbjct: 351 TFQQMWISKQEYDESGP 367

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score =  100 bits (250), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 104/437 (23%), Positives = 172/437 (39%), Gaps = 87/437 (19%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E   +VIDNGS   K G + +  P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLPE 110
           I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFT 170
             +   Q++FE +   + + S  AV   ++       RT                     
Sbjct: 115 NREKMTQILFETFNVPAFYVSIQAVLSLYSSG-----RTTG------------------- 150

Query: 171 SKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR +T  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 HPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPL 348
               E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSAIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCN-VSVPEGDCTLFGWEVMSQFAKTE 407
           + GNIV +GG    P  A+R+ +E+    P+      ++ PE   ++  W   S  A   
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYQRARVTREEYYEHGP 424
           ++Q+  ++++EY E GP
Sbjct: 351 TFQQMWISKQEYDESGP 367

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score =  100 bits (250), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 104/437 (23%), Positives = 172/437 (39%), Gaps = 87/437 (19%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E   +VIDNGS   K G + +  P           R    +       SY+ +  ++ + 
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 64

Query: 52  ISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLPE 110
           I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M    
Sbjct: 65  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 115

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFT 170
             +   Q++FE +   + + S  AV   ++       RT                     
Sbjct: 116 NREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-----RTTG------------------- 151

Query: 171 SKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR +T  L + 
Sbjct: 152 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKI 193

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 194 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 233

Query: 289 HPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPL 348
               E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 234 SSAIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKE 293

Query: 349 MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCN-VSVPEGDCTLFGWEVMSQFAKTE 407
           + GNIV +GG    P  A+R+ +E+    P+      ++ PE   ++  W   S  A   
Sbjct: 294 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 351

Query: 408 SYQRARVTREEYYEHGP 424
           ++Q+  ++++EY E GP
Sbjct: 352 TFQQMWISKQEYDESGP 368

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score =  100 bits (250), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 104/437 (23%), Positives = 172/437 (39%), Gaps = 87/437 (19%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E   +VIDNGS   K G + +  P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLPE 110
           I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFT 170
             +   Q++FE +   + + S  AV   ++       RT                     
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-----RTTG------------------- 150

Query: 171 SKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G      + ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 HPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPL 348
             + E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCN-VSVPEGDCTLFGWEVMSQFAKTE 407
           + GNIV +GG    P  A+R+ +E+    P+      ++ PE   ++  W   S  A   
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYQRARVTREEYYEHGP 424
           ++Q+  ++++EY E GP
Sbjct: 351 TFQQMWISKQEYDESGP 367

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 99.4 bits (246), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 103/437 (23%), Positives = 173/437 (39%), Gaps = 87/437 (19%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E   +VIDNGS   K G + +  P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLPE 110
           I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKN 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFT 170
             +   Q++FE +   + + S  AV   ++          SG+                 
Sbjct: 115 NREKMTQILFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR +T  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDITDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVR 288
           L+ R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LAERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTASQ 232

Query: 289 HPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPL 348
               E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSAVEKSYELPDGQVITIGNERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCN-VSVPEGDCTLFGWEVMSQFAKTE 407
           + GNIV +GG    P  A+R+ +E+    P+      ++ PE   ++  W   S  A   
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYQRARVTREEYYEHGP 424
           ++Q+  ++++EY E GP
Sbjct: 351 TFQQMWISKQEYDESGP 367

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 99.0 bits (245), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 103/437 (23%), Positives = 171/437 (39%), Gaps = 87/437 (19%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E   +VIDNGS   K G + +  P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLPE 110
           I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFT 170
             +   Q++FE +   + + S  AV   ++       RT                     
Sbjct: 115 NREKMTQILFETFNVPAFYVSIQAVLSLYSSG-----RTTG------------------- 150

Query: 171 SKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G      + ++D+ GR +T  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 HPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPL 348
               E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSAIEKSYELPDGQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKE 292

Query: 349 MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCN-VSVPEGDCTLFGWEVMSQFAKTE 407
           + GNIV +GG    P  A+R+ +E+    P+      ++ PE   ++  W   S  A   
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYQRARVTREEYYEHGP 424
           ++Q+  ++++EY E GP
Sbjct: 351 TFQQMWISKQEYDESGP 367

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score = 98.2 bits (243), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 104/437 (23%), Positives = 176/437 (40%), Gaps = 87/437 (19%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E   +VIDNGS   K G + +  P           R    +        Y+ +  ++ + 
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDCYVGDEAQSKRG 64

Query: 52  ISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLPE 110
           I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M    
Sbjct: 65  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 115

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFT 170
             +   Q++FE +   + + S  AV   ++       RT                     
Sbjct: 116 NREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-----RTTG------------------- 151

Query: 171 SKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR +T  L + 
Sbjct: 152 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKI 193

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVR 288
           LS R Y+     E  +V +IKEK  +V+   Y    ++             Q+S I    
Sbjct: 194 LSERGYSFSTTAEREIVRDIKEKLCYVA-LDYDQEMQTAA-----------QSSAI---- 237

Query: 289 HPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPL 348
              E+   LP D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 238 ---EKSYELP-DGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKE 293

Query: 349 MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCN-VSVPEGDCTLFGWEVMSQFAKTE 407
           + GNIV +GG    P  A+R+ +E+    P+      ++ PE   ++  W   S  A   
Sbjct: 294 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 351

Query: 408 SYQRARVTREEYYEHGP 424
           ++Q+  ++++EY E GP
Sbjct: 352 TFQQMWISKQEYDESGP 368

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 97.8 bits (242), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 94/389 (24%), Positives = 159/389 (40%), Gaps = 77/389 (19%)

Query: 40  SYLSNHIKNIKDISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH- 98
           SY+ +  ++ + I  +T R P E G +T W+    IW +  +N       +L+     H 
Sbjct: 37  SYVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHP 87

Query: 99  LVASESCMTLPELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDAD 158
           ++ +E+ M      +   Q++FE +   + + S  AV   ++          SG+     
Sbjct: 88  VLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-- 135

Query: 159 VAISDSDDKTFTSKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDI 218
                                         +V+DSG   T ++P+  G     A+ ++D+
Sbjct: 136 ------------------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDL 165

Query: 219 GGRFLTGLLKETLSFRHYNM--MDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVL 276
            GR LT  L + LS R Y+     E  +V +IKEK                    L YV 
Sbjct: 166 AGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEK--------------------LCYVA 205

Query: 277 PDFQTSFIGYVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILE 336
            DF+       +  + E S    D Q IT+ +E F  PE  FHP +  +   GI +    
Sbjct: 206 LDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYN 265

Query: 337 SLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCN-VSVPEGDCTLF 395
           S+      VR  + GNIV +GG    P  A+R+ +E+    P+      ++ PE   ++ 
Sbjct: 266 SIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV- 324

Query: 396 GWEVMSQFAKTESYQRARVTREEYYEHGP 424
            W   S  A   ++Q+  ++++EY E GP
Sbjct: 325 -WIGGSILASLTTFQQMWISKQEYDESGP 352

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 92/389 (23%), Positives = 157/389 (40%), Gaps = 77/389 (19%)

Query: 40  SYLSNHIKNIKDISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH- 98
           SY+ +  ++ + I  +T R P E G +T W+    IW +  +N       +L+     H 
Sbjct: 37  SYVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHP 87

Query: 99  LVASESCMTLPELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDAD 158
           ++ +E+ M      +   Q++FE +   + + S  AV   ++          SG+     
Sbjct: 88  VLLTEAPMNPKSNREKMTQILFETFNVPAFYVSIQAVLSLYS----------SGRTTG-- 135

Query: 159 VAISDSDDKTFTSKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDI 218
                                         +V+DSG   T ++P+  G      + ++D+
Sbjct: 136 ------------------------------IVLDSGDGVTHVVPIYAGFSLPHGILRIDL 165

Query: 219 GGRFLTGLLKETLSFRHYNM--MDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVL 276
            GR +T  L + LS R Y+     E  +V +IKEK                    L YV 
Sbjct: 166 AGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEK--------------------LCYVA 205

Query: 277 PDFQTSFIGYVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILE 336
            DF+       +    E S    D Q IT+ +E F  PE  FHP +  +   GI +    
Sbjct: 206 LDFEQEMQTAAQSSAIEKSYELPDGQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYN 265

Query: 337 SLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCN-VSVPEGDCTLF 395
           S+      VR  + GNIV +GG    P  A+R+ +E+    P+      ++ PE   ++ 
Sbjct: 266 SIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV- 324

Query: 396 GWEVMSQFAKTESYQRARVTREEYYEHGP 424
            W   S  A   ++Q+  ++++EY E GP
Sbjct: 325 -WIGGSILASLTTFQQMWISKQEYDESGP 352

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 84.3 bits (207), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 101/444 (22%), Positives = 175/444 (39%), Gaps = 92/444 (20%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP----FRALNALAKDKF------GTSYLSNHIKNIKDISS 54
           PIV+DNGS  IK G S  + P    +  +  +  +K       G +++ N  + ++ +  
Sbjct: 9   PIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEGDTFIGNQAQELRGL-- 66

Query: 55  VTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P E G +  W     IW Y +FN S      L+  + H ++ +E+ +      + 
Sbjct: 67  LKLRHPVEHGIVKNWSDMEHIWSY-VFNKS----LQLQNVEDHPILITEAPLNPRNNRER 121

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEP 174
             +++FE +   +L+ S  AV   +           SG+                     
Sbjct: 122 MCELLFESFNVPALYVSIQAVLSLYA----------SGRTTGC----------------- 154

Query: 175 VDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGR----FLTGLLKET 230
                          V+D G  C   +PV  G     +++++DI GR    FL  LL++T
Sbjct: 155 ---------------VVDCGDGCCHAVPVFDGFSIPSSIRRIDIAGRDITEFLQLLLRKT 199

Query: 231 LSFRHYNMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHP 290
                 +  +  + V  IKEK  +V+          K+ H+ E            +  +P
Sbjct: 200 TGVSLLSSSEREV-VRIIKEKACYVA----------KDPHIEEQ----------NFSINP 238

Query: 291 NEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMI 350
           N     LP D ++I L  E F  PE  F PE+       + +   +S+  +   +R L+ 
Sbjct: 239 NYTKFKLP-DGKTIDLGQEKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLF 297

Query: 351 GNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVP--EGDCTLFGWEVMSQFAKTES 408
            N++ +GG   LP F  RL  EL+    +     +  P      T  G  ++S  +   +
Sbjct: 298 SNVLLSGGTSILPGFGDRLLSELKSLSDSQTKIKIFAPPERKYSTWIGGSILSGLS---T 354

Query: 409 YQRARVTREEYYEHGPDWCTKHRF 432
           +++  VTR E+ E     C   RF
Sbjct: 355 FKKLWVTRAEWEEAAD--CIHSRF 376

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 83.6 bits (205), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 93/388 (23%), Positives = 150/388 (38%), Gaps = 88/388 (22%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP---FRALNA---LAKDKFGTSYLSNHIKNI-------KD 51
           PIV+D G+  +K G +    P   F ++     L  ++ GT  +S  +K+I       + 
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGT--ISTPLKDIMIGDEASEV 63

Query: 52  ISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPEL 111
            S +    P E G +  W     +WDY  FN        L    G  ++ +E  M   + 
Sbjct: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MKLPTTSGGKVLLTEPPMNPVKN 118

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTS 171
            +   +V+FE Y+F  ++ +  AV   + +         SG                   
Sbjct: 119 RERMCEVMFERYDFGGVYVAIQAVLALYAQGLS------SG------------------- 153

Query: 172 KEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T I+PV + +      ++LD+ GR +T  L + L
Sbjct: 154 -----------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL 196

Query: 232 SFRHY--NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVL--EYVLPDFQTSFIGYV 287
           S R Y  N   +   V  IKEK  +VS     D+  ++    L  EY LPD         
Sbjct: 197 SRRGYSFNRTADFETVRQIKEKVCYVSYDLNLDTKLARETTTLVQEYELPD--------- 247

Query: 288 RHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRP 347
                         + I +  E F  PE  F P++  +  PG+ E +  ++      VR 
Sbjct: 248 -------------GRIIKVGQERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRS 294

Query: 348 LMIGNIVCTGGNFNLPNFAQRLARELQR 375
            +   IV +GG+   P    RL REL++
Sbjct: 295 SLYKAIVLSGGSSMYPGLPSRLERELKQ 322

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 88/386 (22%), Positives = 146/386 (37%), Gaps = 84/386 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP-FRALNALAKDKFGTSYLSNHIKNIKDI----------S 53
           PIV+D G+  +K G +    P +   + + +        +N    ++DI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEASDVRS 65

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY  FN        L    G  ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MKLNNTSGGKILLTEPPMNPLKNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
              +V+FE+Y+F  ++ +  AV   + +         SG                     
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------SG--------------------- 153

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                          +V+DSG   T I+PV + +      ++LD+ GR +T  L + LS 
Sbjct: 154 ---------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVL--EYVLPDFQTSFIGYVRH 289
           R Y  N   +   V  IKEK  +VS     D+  ++    L   Y LPD +T  +G    
Sbjct: 199 RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVG---- 254

Query: 290 PNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLM 349
                              E F  PE  F P +  + +PG+ E +  ++      VR  +
Sbjct: 255 ------------------QERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSAL 296

Query: 350 IGNIVCTGGNFNLPNFAQRLARELQR 375
              IV +GG+   P    RL +EL++
Sbjct: 297 YKAIVLSGGSSMYPGLPSRLEKELKQ 322

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 87/384 (22%), Positives = 146/384 (38%), Gaps = 80/384 (20%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP-FRALNALAKDKFGTSYLSNHIKNIKDI----------S 53
           PIV+D G+  +K G +    P +   + + +        +N +  +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY  +     D   L    G  ++ +E  M      +
Sbjct: 66  YLQISYPMENGVIKNWSDMELLWDYAFY-----DQMKLPSTSGGKVMLTEPPMNPLRNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
              +V+FE+Y+F  ++ +  AV   + +         SG                     
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------SG--------------------- 153

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                          +V+DSG   T I+PV + +      ++LD+ GR +T  L + LS 
Sbjct: 154 ---------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPN 291
           R Y  N   +   V  IKEK  +VS     D+  ++    L                   
Sbjct: 199 RGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV------------------ 240

Query: 292 EEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIG 351
            E+  LP D + I +  E F  PE  F P +  + +PG+ E +  ++      VR  +  
Sbjct: 241 -ENYELP-DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYR 298

Query: 352 NIVCTGGNFNLPNFAQRLARELQR 375
            IV +GG+   P    RL +EL++
Sbjct: 299 AIVLSGGSSMYPGLPSRLEKELKQ 322

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 104/453 (22%), Positives = 178/453 (39%), Gaps = 99/453 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP---FRALNA---LAKDKFGTSYLSNHIKNI------KDI 52
           PIV+D G+  +K G +    P   F ++     L  ++ G+  +S  +K+I       D+
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGS--ISTPLKDIMIGEEASDV 63

Query: 53  SS-VTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPEL 111
            S +    P E G +  W+    +WDY  +N  +F         G  ++ +E  M   + 
Sbjct: 64  RSYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKF-----PSTSGGKILLTEPPMNPLKN 118

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTS 171
            +   +V+FE+Y+F  ++ +  AV   + +         SG                   
Sbjct: 119 RELMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------SG------------------- 153

Query: 172 KEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T I+PV + +      ++LD+ GR +T  L + L
Sbjct: 154 -----------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL 196

Query: 232 SFRHY--NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRH 289
           S R Y  N   +   V  IKEK  +VS     D+  ++   VL                 
Sbjct: 197 SRRGYAFNRSADFETVRQIKEKLSYVSYDLNLDTKLARETTVLV---------------- 240

Query: 290 PNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLM 349
              E+  LP D + I +  E F  PE  F P++  + +PGI E +  ++      +R  +
Sbjct: 241 ---ENYELP-DGRVIKVGQERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSL 296

Query: 350 IGNIVCTGGNFNLPNFAQRLARELQ-----RQLPTD------WTCNVSVP--EGDCTLFG 396
              IV +GG+   P    RL +EL+     R L  D      +   +  P         G
Sbjct: 297 YRAIVLSGGSSMYPGLPSRLEKELKQLWYTRILRGDAARLDKFKVKIEDPPRRKHMVFIG 356

Query: 397 WEVMSQFAKTESYQRARVTREEYYEHGPDWCTK 429
             V++     + +    +T+EE++E GP    K
Sbjct: 357 GAVLASIMAEKDHM--WLTKEEWHESGPAAMAK 387

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 80.5 bits (197), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 101/444 (22%), Positives = 176/444 (39%), Gaps = 92/444 (20%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP----------FRALNALAKDKFGTSYLSNHIKNIKDISS 54
           P+V+DNGS  IK G S  + P           +    +A    G +++ N  + ++ +  
Sbjct: 37  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRGL-- 94

Query: 55  VTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P + G +T W     +W Y +FN S      L+  + H  + +E+ +   +  + 
Sbjct: 95  LKLRYPLQHGIVTNWADMEQVWGY-VFNKS----LQLQNVEDHPNLVTEAPLNPHKNREK 149

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEP 174
             +++FE +   +L+ S  AV   +           SG+                     
Sbjct: 150 MCELLFESFNVPALYVSVQAVLSLYA----------SGRTTGC----------------- 182

Query: 175 VDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGR----FLTGLLKET 230
                          V+D G  C   +PV  G     +++++DI GR    FL  LL++T
Sbjct: 183 ---------------VVDCGDGCCHAVPVFDGFSVPSSIRRIDIAGRDITEFLQLLLRKT 227

Query: 231 LSFRHYNMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHP 290
                 +  +  I V  IKEK  FV+          K+  + E   P           +P
Sbjct: 228 TGVSLLSSSEREI-VRTIKEKACFVT----------KDPKLEEQNFP----------MNP 266

Query: 291 NEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMI 350
           +     LP D ++I L  E +  PE  F PE+       + +   +S+  +   +R L+ 
Sbjct: 267 SFSKFKLP-DGKTIELGQERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLY 325

Query: 351 GNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVP--EGDCTLFGWEVMSQFAKTES 408
            NI+ +GG   LP F  RL +EL+    +     +  P      T  G  ++S  +   +
Sbjct: 326 SNILLSGGTSMLPGFGDRLLKELKSLSGSRTKIKIFAPPERKYSTWIGGSILSGLS---T 382

Query: 409 YQRARVTREEYYEHGPDWCTKHRF 432
           +++  VT+ E+ E  PD C   RF
Sbjct: 383 FKKLWVTKSEWEEF-PD-CIHSRF 404

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 81/163 (49%), Gaps = 13/163 (7%)

Query: 286 YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSM----- 340
           ++R P   DS    +   + L  E   +PE  F P I  + + GIVE + E+L +     
Sbjct: 586 FLRGPRSHDSESIHEQHQMHLNVERIRVPEVIFQPSIGGLDQAGIVE-LCETLLLKKFGS 644

Query: 341 ----LPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFG 396
               L EI + +M  NI  TGGN  LP   +R+ RE    LP     NV + E D ++  
Sbjct: 645 NRRELSEISK-MMAKNIFITGGNAKLPGIRERVVREFTGFLPVGTNLNVKLAE-DPSMSA 702

Query: 397 WEVMSQFAKTES-YQRARVTREEYYEHGPDWCTKHRFGYQNWI 438
           W  M++FA   S Y+ + +T++EY E GP++  +H  G   ++
Sbjct: 703 WRGMAKFANNTSLYETSIMTKKEYEELGPEYIKEHNLGNAKFV 745

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 75/157 (47%), Gaps = 11/157 (7%)

Query: 286 YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILES-------- 337
           ++R P   DS        + L  E   +PE  F P +  + + GI+E I E+        
Sbjct: 586 FLRGPRPHDSEDINQQHQMHLNVERIRVPEVIFQPSMGGLDQAGIIE-ICETNFLKKFGS 644

Query: 338 LSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGW 397
                  +   +  N+  TGGN  LP   +R+ RE +  LP     NV +   DC L  W
Sbjct: 645 SRSELSSISRSLASNVFLTGGNMRLPGMRERVVREFRGLLPIGTELNVRMA-NDCALDAW 703

Query: 398 EVMSQFAKTES-YQRARVTREEYYEHGPDWCTKHRFG 433
             M++ ++T+S ++   VTR+EY+E+GPD+  +H  G
Sbjct: 704 RGMAKLSRTDSLFRDTYVTRQEYHEYGPDYIKEHNLG 740

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 6/82 (7%)

Query: 180 SNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGR----FLTGLLKETLSFRH 235
           +NND     LVI SG + T IIPV+ G       K+++ GGR    +L+ LL   L + +
Sbjct: 174 ANNDASASGLVISSGNEDTHIIPVVDGKGVLGEAKRINWGGRQSVDYLSNLL--ALKYPY 231

Query: 236 YNMMDETILVNNIKEKCLFVSP 257
           + +   T     + ++  +VSP
Sbjct: 232 FPIKPSTHQFKALYDEFCYVSP 253

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 103/436 (23%), Positives = 172/436 (39%), Gaps = 91/436 (20%)

Query: 3   APPIVIDNGSYEIKFGPSTNKMP-FRALNALAKDKFG--------TSYLSNHIKNIKDIS 53
           + P+V+DNGS  +K G S    P F   + +   + G         +++ N  +  + I 
Sbjct: 10  SQPVVLDNGSAILKAGYSGEDRPKFLEHSIVGSPRHGYVNDSSKDDTFVGNLAQERRSI- 68

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P + G +  W     IWDY +F     D   LK+   H ++ +E+ +       
Sbjct: 69  -LQLRHPVDHGVVKNWNDMELIWDY-MFK----DKLKLKDVDEHPVLITEAPLNPVSNRD 122

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
               ++FE +   +L+ +  AV   +     GK   ISG        + D  D       
Sbjct: 123 EMCDLLFESFGVQALYVANPAVLSLYAS---GK---ISG-------CVLDCGD------- 162

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                               G+ C+  +PV +G     A+K++D+GGR LT  L+  L  
Sbjct: 163 --------------------GYSCS--VPVYQGYTLKSAIKRIDLGGRDLTEQLQ--LQL 198

Query: 234 RHYNMMDETI-----LVNNIKEKCLFVSPTSYFDSFKSK---NKHVLEYVLPDFQTSFIG 285
           R    +  T      LV  IKEK  +V+     +  K     ++  L++ LP        
Sbjct: 199 RKSTGLSLTTSGEMELVRMIKEKSCYVAVDLDIEEEKCNYEGDQVGLKFKLP-------- 250

Query: 286 YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIV 345
                         D + ITL+ + F +PE  F P +       I E I +S+S L   +
Sbjct: 251 --------------DGKFITLSKDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDL 296

Query: 346 RPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAK 405
           RP M  +I+ +GG   L  F  RL +EL +         +  P  +     W   S  A+
Sbjct: 297 RPQMWSDILLSGGTTMLKGFGNRLVQELDKLNQAQSRVKIWAPP-ERKYTSWIGGSILAE 355

Query: 406 TESYQRARVTREEYYE 421
             ++Q+  VT+ ++ E
Sbjct: 356 LSTFQKIIVTKSQWQE 371

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 104/450 (23%), Positives = 173/450 (38%), Gaps = 104/450 (23%)

Query: 5   PIVIDNGSYEIKFGPSTNKMPF----------RALNALAKDKFGTSYLSNHIKNIKDISS 54
           PIV+DNGS  IK G S  + P           +    +A    G  ++ N  + ++ +  
Sbjct: 11  PIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLEGEQFIGNQAQELRGL-- 68

Query: 55  VTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P E G +  W     IW++ +F+ S      L   + H ++A+E+ +   +  + 
Sbjct: 69  LKLRYPLEHGIVKNWSDMELIWNH-VFHKS----LQLNNIEEHPVLATEAPLNPLKNREA 123

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEP 174
             +++FE +   +++ S  AV   +           SG+                     
Sbjct: 124 MCEMLFETFNVPAVYVSIQAVLSLYA----------SGRTTGC----------------- 156

Query: 175 VDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGR----FLTGLLKET 230
                          V+D G  C   +PV  G     +++++D+ GR    FL  LL++T
Sbjct: 157 ---------------VLDCGDGCCHSVPVFDGFSLPSSIRRIDVAGRDVTEFLQLLLRKT 201

Query: 231 LSFRHYNMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHP 290
                 +  +  I V  IKEK                      YV  D  T    Y   P
Sbjct: 202 TGVSLLSSSEREI-VRIIKEKAC--------------------YVARDPLTEEQTYHLTP 240

Query: 291 NEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMI 350
                 LP D + + L +E F  PE  F P++       I E   +S+S +   +RP ++
Sbjct: 241 TSTIFKLP-DGKVLDLKNEKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALL 299

Query: 351 GNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFG--------WEVMSQ 402
            NIV +GG    P F  RL  EL+         N+S P+    +F         W   S 
Sbjct: 300 SNIVLSGGTTMFPGFGDRLLTELR---------NLSEPQTKIKIFAPPERKYSTWIGGSI 350

Query: 403 FAKTESYQRARVTREEYYEHGPDWCTKHRF 432
            +   ++++  VT+ E+ E+ PD C   RF
Sbjct: 351 LSGLSTFKKIWVTKSEWQEN-PD-CVHSRF 378

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 80.1 bits (196), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 82/160 (51%), Gaps = 9/160 (5%)

Query: 286 YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVE----AILESLSML 341
           ++R P   DS    +   + L  E   +PE FF P +    + G+ E     +L      
Sbjct: 589 FLRGPRPHDSENSHEQHQMHLNVERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGAS 648

Query: 342 PEIVRPL---MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWE 398
           P  +  +   M  N+  TGGN  +P   +R+ +E    LP + + NV++   D +L  W 
Sbjct: 649 PRQMSSITSEMAKNVWVTGGNAKIPGLRERIVKEFTGFLPVNTSFNVNIS-SDPSLDAWR 707

Query: 399 VMSQFAKTES-YQRARVTREEYYEHGPDWCTKHRFGYQNW 437
            M+++A+ E+ Y+++ ++++EY E+GPD+  +H+ G  N+
Sbjct: 708 GMAKYAQNETDYKKSFISKKEYEEYGPDYIKEHKLGNMNY 747

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 88/384 (22%), Positives = 146/384 (38%), Gaps = 80/384 (20%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP-FRALNALAKDKFGTSYLSNHIKNIKDI----------S 53
           PIV+D G+  +K G +    P +   + + +        +   K +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKDIMIGDEASDVRS 65

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY  FN  +     L    G  ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFNQMQ-----LPTTSGGKILLTEPPMNPVKNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
              +V+FE+Y+F  ++ +  AV   + +         SG                     
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------SG--------------------- 153

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                          +V+DSG   T I+PV + +      ++LD+ GR +T  L + LS 
Sbjct: 154 ---------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPN 291
           R Y  N   +   V  IKEK  +VS     D+  ++    L                   
Sbjct: 199 RGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV------------------ 240

Query: 292 EEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIG 351
            E+  LP D + I +  E F  PE  F P +  + + GI E +  ++      VR  +  
Sbjct: 241 -ENYELP-DGRIIKVGQERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYK 298

Query: 352 NIVCTGGNFNLPNFAQRLARELQR 375
            IV +GG+   P    RL +EL++
Sbjct: 299 AIVLSGGSSMYPGLPSRLEKELKQ 322

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 87/386 (22%), Positives = 146/386 (37%), Gaps = 84/386 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP-FRALNALAKDKFGTSYLSNHIKNIKDI----------S 53
           PIV+D G+  +K G +    P +   + + +        +N    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVRS 65

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY  F     +   L       ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFF-----EQMKLPTTSNGKILLTEPPMNPTKNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
              +V+FE+Y+F  ++ +  AV   + +         SG                     
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------SG--------------------- 153

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                          +V+DSG   T I+PV + +      ++LD+ GR +T  L + LS 
Sbjct: 154 ---------------VVVDSGDGVTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVL--EYVLPDFQTSFIGYVRH 289
           R Y  N   +   V  IKEK  +VS     D+  ++    L   Y LPD +T  +G    
Sbjct: 199 RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVG---- 254

Query: 290 PNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLM 349
                              E F  PE  F P +  + +PG+ E + +++      VR  +
Sbjct: 255 ------------------QERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSAL 296

Query: 350 IGNIVCTGGNFNLPNFAQRLARELQR 375
              IV +GG+   P    RL +EL++
Sbjct: 297 YKAIVLSGGSSMYPGLPSRLEKELKQ 322

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 86/386 (22%), Positives = 142/386 (36%), Gaps = 84/386 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKN-IKDI----------S 53
           PIV+D G+  +K G +    P     ++       +    H    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRS 65

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY  F     +   L    G  ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIRNWADMELLWDYAFF-----EQMKLPTTSGGKVLLTEPPMNPIKNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
              +V+FE+Y+F   + +  AV   + +         SG                     
Sbjct: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLS------SG--------------------- 153

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                          +V+DSG   T I+PV + +      ++LD+ GR +T  L + LS 
Sbjct: 154 ---------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVL--EYVLPDFQTSFIGYVRH 289
           R Y  N   +   V  IKEK  +VS     D+  ++    L   Y LPD           
Sbjct: 199 RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD----------- 247

Query: 290 PNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLM 349
                       + I +  E F  PE  F P +  + +PG+ E +  ++      +R  +
Sbjct: 248 -----------GRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSL 296

Query: 350 IGNIVCTGGNFNLPNFAQRLARELQR 375
              IV +GG+   P    RL +EL++
Sbjct: 297 YKAIVLSGGSSMYPGLPSRLEKELKQ 322

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 77.8 bits (190), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 91/436 (20%), Positives = 174/436 (39%), Gaps = 94/436 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP--FRALNALAKDKFG---------TSYLSNHIKNIKDIS 53
           P+VIDNG+  +K G   +  P  F+  N +   KF            Y+ N  +  + + 
Sbjct: 10  PVVIDNGTGVLKVGFVGDDKPKCFQH-NIVGTPKFDKVMIGGLDDNMYIGNKAQENRGL- 67

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P E G++  W+    +W + L +       +++  + H ++ +E+ +   +  +
Sbjct: 68  -LRLRHPMEHGEVKHWDEMEAVWKHTLLHD-----LNIQHIEEHPILITEAPLNSSKNRE 121

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
           H  +++FE +   ++     AV   ++       RT                        
Sbjct: 122 HMCEILFESFNIPAIHVENPAVLALYSGG-----RTTG---------------------- 154

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                           VID G      +P+ +G     +++++DIGGR +T    E L F
Sbjct: 155 ---------------CVIDCGEGYCSAVPIYEGFALTPSIRRIDIGGREIT----EQLQF 195

Query: 234 RHYNMM-------DETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGY 286
           +    +       +E  +V  IKE+  +V+     D  K ++K++L+             
Sbjct: 196 QIRKSVGMSLFSSNEKEIVRTIKERACYVAD----DISKEEHKYILD------------- 238

Query: 287 VRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVR 346
               N     LP D +S+++ +  F   E  F+P +       + E + ++LS +   +R
Sbjct: 239 -SESNSSKFKLP-DGKSLSIGNVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLR 296

Query: 347 PLMIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCN-VSVPEGDCTLFGWEVMSQFAK 405
           P++  ++V  GG   LP F  R+ +ELQ     D     ++ PE   T   W   S  A 
Sbjct: 297 PMLYKSLVLNGGTTVLPGFGNRILKELQILTKQDTKLRIIASPERKYTT--WIGGSILAG 354

Query: 406 TESYQRARVTREEYYE 421
             ++Q+  VT+  + E
Sbjct: 355 LSTFQKILVTKSNWNE 370

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 77.8 bits (190), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 85/384 (22%), Positives = 145/384 (37%), Gaps = 80/384 (20%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP-FRALNALAKDKFGTSYLSNHIKNIKDI----------S 53
           PIV+D G+  +K G +    P +   + + +        ++    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRS 65

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY  +     +   L    G  ++ +E  M      +
Sbjct: 66  YLQISYPMENGIIKNWADMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPLRNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
              +V+FE+Y+F  ++ +  AV   + +         SG                     
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------SG--------------------- 153

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                          +V+DSG   T I+PV + +      K+LD+ GR +T  L + LS 
Sbjct: 154 ---------------VVVDSGDGVTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPN 291
           R Y  N   +   V  IKEK  +VS     D+  ++    L                   
Sbjct: 199 RGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV------------------ 240

Query: 292 EEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIG 351
            E+  LP D + I +  E F  PE  F P +  + +PG+ E +  ++      VR  +  
Sbjct: 241 -ENYELP-DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYR 298

Query: 352 NIVCTGGNFNLPNFAQRLARELQR 375
            +V +GG+   P    RL +EL++
Sbjct: 299 AVVLSGGSSMYPGLPSRLEKELKQ 322

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 77.4 bits (189), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 88/386 (22%), Positives = 146/386 (37%), Gaps = 82/386 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP---FRALNALAKDKFGTSYLSNHIKNIKDI--------- 52
           PIV+D G+  +K G +    P   F ++      +       +    IKDI         
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKTPIKDIMVGEEASDV 65

Query: 53  -SSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPEL 111
            S +    P E G +  W     +WD+  F     +   L    G  ++ +E  M   + 
Sbjct: 66  RSYLQISYPMENGIIKHWTDMELLWDHAFF-----EKMKLPSTSGGKILLTEPPMNPLKN 120

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTS 171
            +   QV+FE+Y+F  ++ +  AV   + +         SG                   
Sbjct: 121 REMMCQVMFEKYDFGGVYVAIQAVLALYAQGLS------SG------------------- 155

Query: 172 KEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T I+PV + +      ++LD+ GR +T  L + L
Sbjct: 156 -----------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL 198

Query: 232 SFRHY--NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRH 289
           S R Y  N   +   V  IKEK  +VS    FD+  ++    L                 
Sbjct: 199 SRRGYAFNRSADFETVRQIKEKLSYVSYDLDFDTKLARETTTLV---------------- 242

Query: 290 PNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLM 349
              E+  LP D + I +  E F  PE  F P +  + +PG+ E +  ++      +R  +
Sbjct: 243 ---ENYELP-DGRIIKVGQERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSL 298

Query: 350 IGNIVCTGGNFNLPNFAQRLARELQR 375
              IV +GG+   P    RL +EL++
Sbjct: 299 YKAIVLSGGSSMYPGLPSRLEKELKQ 324

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 86/386 (22%), Positives = 146/386 (37%), Gaps = 84/386 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP-FRALNALAKDKFGTSYLSNHIKNIKDI----------S 53
           PIV+D G+  +K G +    P +   + + +        ++    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASDVRS 65

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY  F     +   L       ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFF-----EQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
              +V+FE+Y+F  ++ +  AV   + +         SG                     
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------SG--------------------- 153

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                          +V+DSG   T I+PV + +      ++LD+ GR +T  L + LS 
Sbjct: 154 ---------------VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVL--EYVLPDFQTSFIGYVRH 289
           R Y  N   +   V  IKEK  +VS     D+  ++   VL   Y LPD +T  +G    
Sbjct: 199 RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTVLVESYELPDGRTIKVG---- 254

Query: 290 PNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLM 349
                              E F  PE  F P +  + +PG+ E +  ++      +R  +
Sbjct: 255 ------------------QERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSL 296

Query: 350 IGNIVCTGGNFNLPNFAQRLARELQR 375
              IV +GG+   P    RL +EL++
Sbjct: 297 YRAIVLSGGSSMYPGLPSRLEKELKQ 322

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 85/386 (22%), Positives = 143/386 (37%), Gaps = 84/386 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP-FRALNALAKDKFGTSYLSNHIKNIKDI----------S 53
           PIV+D G+  +K G +    P +   + + +        +N    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEASQVRS 65

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY  +     +   L    G  ++ +E  M      +
Sbjct: 66  YLQISYPMENGIIRDWADMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPLRNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
              +V+FE+Y+F  ++    AV   + +         SG                     
Sbjct: 121 QMCEVMFEKYDFGGVYVGIQAVLALYAQGLS------SG--------------------- 153

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                          +V+DSG   T I+PV + +      ++LD+ GR +T  L + LS 
Sbjct: 154 ---------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDMTRYLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVL--EYVLPDFQTSFIGYVRH 289
           R Y  N   +   V  IKEK  +VS     D+  ++    L  +Y LPD           
Sbjct: 199 RGYAFNKTADFETVRQIKEKLCYVSYDLDLDTRLAQETTTLVEQYELPD----------- 247

Query: 290 PNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLM 349
                       + I +  E F  PE  F P +  + +PGI E +  ++      +   +
Sbjct: 248 -----------GRVIKVGSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTL 296

Query: 350 IGNIVCTGGNFNLPNFAQRLARELQR 375
              IV +GG+   P    RL +EL++
Sbjct: 297 YKAIVLSGGSSMYPGLPSRLEKELKQ 322

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 86/384 (22%), Positives = 146/384 (38%), Gaps = 80/384 (20%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP-FRALNALAKDKFGTSYLSNHIKNIKDI----------S 53
           PIV+D G+  +K G +    P +   + + +        SN    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEASNVRS 65

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY  +     D   +    GH ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWADMEQLWDYAFY-----DQMKIPSTAGHKVLLTEPPMNPLKNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
              +V+FE+Y+F  ++ +  AV   + +         SG                     
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------SG--------------------- 153

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                          +V+DSG   T I+PV + +      ++LD+ GR +T  L + LS 
Sbjct: 154 ---------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRYLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPN 291
           R Y  N   +   V  IKEK  +VS   Y     +K  H    ++  ++           
Sbjct: 199 RGYAFNKTADFETVRQIKEKLCYVS---YDLDLDTKLAHETTTLVETYE----------- 244

Query: 292 EEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIG 351
                LP D + I +  E F  PE  F P +  + + GI E +  ++      +   +  
Sbjct: 245 -----LP-DGRVIKVGSERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYR 298

Query: 352 NIVCTGGNFNLPNFAQRLARELQR 375
            IV +GG+   P    RL +EL++
Sbjct: 299 AIVLSGGSSMYPGLPSRLEKELKQ 322

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 73/156 (46%), Gaps = 9/156 (5%)

Query: 286 YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVE----AILESLSML 341
           ++R P   DS        + L  E   +PE  F P I+   + GI E     +L+     
Sbjct: 590 FLRGPRPHDSEDVHQQHQLHLNTERIRVPEILFEPSIAGQDQAGIAELCETILLKKFGSK 649

Query: 342 P---EIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWE 398
           P         M+ N+  TGGN  +P    R+ +E    LP     +V + E D +L  W+
Sbjct: 650 PGNLSAASSRMVNNVWITGGNARIPGIKNRIVKEFTEFLPAGTPLSVHMSE-DPSLDAWK 708

Query: 399 VMSQFAKTES-YQRARVTREEYYEHGPDWCTKHRFG 433
            M++ A  E+ Y+   VTR+EY E+GPD+  +H+ G
Sbjct: 709 GMAKLANNETDYKNTAVTRKEYEEYGPDYIKEHKLG 744

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 85/386 (22%), Positives = 146/386 (37%), Gaps = 84/386 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP-FRALNALAKDKFGTSYLSNHIKNIKDI----------S 53
           PIV+D G+  +K G +    P +   + + +        ++    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY  F     +   L+      ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFF-----EQMKLQSTSNGKILLTEPPMNPLKNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
              +V+FE+Y+F  ++ +  AV   + +         SG                     
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------SG--------------------- 153

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                          +V+DSG   T I+PV + +      ++LD+ GR +T  L + LS 
Sbjct: 154 ---------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVL--EYVLPDFQTSFIGYVRH 289
           R Y  N   +   V  IKEK  +VS     D+  ++    L   Y LPD +T  +G    
Sbjct: 199 RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVG---- 254

Query: 290 PNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLM 349
                              E F  PE  F P +  + +PG+ E +  ++      +R  +
Sbjct: 255 ------------------QERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSL 296

Query: 350 IGNIVCTGGNFNLPNFAQRLARELQR 375
              IV +GG+   P    RL +EL++
Sbjct: 297 YKAIVLSGGSSMYPGLPSRLEKELKQ 322

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/318 (23%), Positives = 122/318 (38%), Gaps = 69/318 (21%)

Query: 60  PHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVI 119
           P E G +  W     +WDY  +     D   L    G  ++ +E  M   +  +   +V+
Sbjct: 18  PMENGVIKNWSDMELLWDYAFY-----DQMQLPSTSGGKVMLTEPPMNPVKNREQMCEVM 72

Query: 120 FEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETN 179
           FE+Y+F  ++ +  AV   + +         SG                           
Sbjct: 73  FEKYDFGGVYVAIQAVLALYAQGLS------SG--------------------------- 99

Query: 180 SNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--N 237
                    +V+DSG   T I+PV + +      ++LD+ GR +T  L + LS R Y  N
Sbjct: 100 ---------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFN 150

Query: 238 MMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPL 297
              +   V  IKEK  +VS     D+  ++    L                    E+  L
Sbjct: 151 RSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV-------------------ENYEL 191

Query: 298 PTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTG 357
           P D + I +  E F  PE  F P +  + +PG+ E +  ++      VR  +   IV +G
Sbjct: 192 P-DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSG 250

Query: 358 GNFNLPNFAQRLARELQR 375
           G+   P    RL +EL++
Sbjct: 251 GSSMYPGLPSRLEKELKQ 268

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 77/157 (49%), Gaps = 11/157 (7%)

Query: 286 YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLP--- 342
           ++R P   DS    +   + L  E   +PE  F P +  + + GI+E + E++ M     
Sbjct: 587 FLRGPRPHDSEDAHEQHQMHLNVERIRVPEVIFQPPMGGLDQAGIIE-LSETIIMNKFGS 645

Query: 343 -----EIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGW 397
                  V   M  N+  TGGN  +P    R+ RE    LP     N+ V   D  +  W
Sbjct: 646 SRRQLSSVSQEMANNVFLTGGNVRVPGLRDRIVREFTEFLPVGTKYNIKVA-SDPAIDAW 704

Query: 398 EVMSQFAKTES-YQRARVTREEYYEHGPDWCTKHRFG 433
           + M++FA++ + Y+ + VT++EY E+GPD+  +H+ G
Sbjct: 705 KGMAKFAQSSTDYKGSYVTKKEYEEYGPDYIKEHKLG 741

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 85/384 (22%), Positives = 143/384 (37%), Gaps = 80/384 (20%)

Query: 5   PIVIDNGSYEIKFGPSTNKMPFRAL-NALAKDKFGTSYLSNHIKNIKDI----------S 53
           PIV+D G+  +K G +    P     + + +        +N    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEASDVRS 65

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY  F     D   L       ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFF-----DQMKLPTTSNGKILLTEPPMNPVKNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
              +V+FE+Y+F  ++ +  AV   + +         SG                     
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------SG--------------------- 153

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                          +V+DSG   T I+PV + +      ++LD+ GR +T  L + LS 
Sbjct: 154 ---------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPN 291
           R Y  N   +   V  IKEK  +VS     D+  ++    L                   
Sbjct: 199 RGYAFNRSADFETVRQIKEKVCYVSYDLDLDTKLARETTTLV------------------ 240

Query: 292 EEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIG 351
            E+  LP D + I +  E F  PE  F P +  + + G+ E +  ++      +R  +  
Sbjct: 241 -ENYELP-DGRVIKVGQERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYR 298

Query: 352 NIVCTGGNFNLPNFAQRLARELQR 375
            IV +GG+   P    RL +EL++
Sbjct: 299 AIVLSGGSSMYPGLPSRLEKELKQ 322

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 97/443 (21%), Positives = 175/443 (39%), Gaps = 90/443 (20%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP---------FRALNALAKDKF-GTSYLSNHIKNIKDISS 54
           PIV+DNGS  IK G      P             + +   +F G +++ N  + I+ +  
Sbjct: 12  PIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFDGNTFVGNQAQEIRGL-- 69

Query: 55  VTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P E G +T W     +W +         G  L   + H ++ +E+ +   +  + 
Sbjct: 70  LKLRHPLEHGVVTDWNALEQLWGHVFEK-----GLQLSSLQDHPVLVTEAPLNPKKNREQ 124

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEP 174
             +++FE +   +++ S  AV   +           SG+                     
Sbjct: 125 MCELLFETFSVPAVYVSIQAVLSLYA----------SGRTTGC----------------- 157

Query: 175 VDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFR 234
                          V+DSG  C+  +PV  G     A++++DI GR ++ LL+  +   
Sbjct: 158 ---------------VLDSGDGCSHAVPVYDGYTLPSAIRRIDIAGRDISELLQVLIRKS 202

Query: 235 HYNMM---DETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPN 291
               +    E  +V  IKEK  +++     D  K + K+   Y +   QT F    R P 
Sbjct: 203 TGVSLLSSSEREIVRIIKEKACYIA----LDP-KEEEKN---YTMHGKQTMF----RLP- 249

Query: 292 EEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIG 351
                   D + I L +E F  PE  F+P++       + E + ES+  +   +R  +  
Sbjct: 250 --------DGKQIELDNEKFRAPEILFNPQLIGSEFQSLPEILYESIQKVDLDLRTSLFS 301

Query: 352 NIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVP--EGDCTLFGWEVMSQFAKTESY 409
           NIV +GG   +P F  R+ +EL+          +  P      T  G  ++S  +   ++
Sbjct: 302 NIVFSGGTTMIPGFGDRVLKELKLSCEPQTKIKIFAPPERKYSTWIGGSILSGLS---TF 358

Query: 410 QRARVTREEYYEHGPDWCTKHRF 432
           ++  VT++E+ E+    C   RF
Sbjct: 359 KKIWVTKKEWEEN--PRCVHARF 379

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 85/386 (22%), Positives = 145/386 (37%), Gaps = 84/386 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP-FRALNALAKDKFGTSYLSNHIKNIKDI----------S 53
           PIV+D G+  +K G +    P +   + + +        ++    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEVRS 65

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY  F     +   L       ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFF-----EQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
              +V+FE+Y+F  ++ +  AV   + +         SG                     
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------SG--------------------- 153

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                          +V+DSG   T I+PV + +      ++LD+ GR +T  L + LS 
Sbjct: 154 ---------------VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVL--EYVLPDFQTSFIGYVRH 289
           R Y  N   +   V  IKEK  +VS     D+  ++    L   Y LPD +T  +G    
Sbjct: 199 RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVG---- 254

Query: 290 PNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLM 349
                              E F  PE  F P +  + +PG+ E +  ++      +R  +
Sbjct: 255 ------------------QERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSL 296

Query: 350 IGNIVCTGGNFNLPNFAQRLARELQR 375
              IV +GG+   P    RL +EL++
Sbjct: 297 YKAIVLSGGSSMYPGLPSRLEKELKQ 322

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 75.5 bits (184), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 85/386 (22%), Positives = 145/386 (37%), Gaps = 84/386 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP-FRALNALAKDKFGTSYLSNHIKNIKDI----------S 53
           PIV+D G+  +K G +    P +   + + +        ++    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY  F     +   L       ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFF-----EQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
              +V+FE+Y+F  ++ +  AV   + +         SG                     
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------SG--------------------- 153

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                          +V+DSG   T I+PV + +      ++LD+ GR +T  L + LS 
Sbjct: 154 ---------------VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVL--EYVLPDFQTSFIGYVRH 289
           R Y  N   +   V  IKEK  +VS     D+  ++    L   Y LPD +T  +G    
Sbjct: 199 RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVG---- 254

Query: 290 PNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLM 349
                              E F  PE  F P +  + +PG+ E +  ++      +R  +
Sbjct: 255 ------------------QERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSL 296

Query: 350 IGNIVCTGGNFNLPNFAQRLARELQR 375
              IV +GG+   P    RL +EL++
Sbjct: 297 YKAIVLSGGSSMYPGLPSRLEKELKQ 322

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 77/156 (49%), Gaps = 9/156 (5%)

Query: 286 YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVE----AILESLSML 341
           ++R P   DS        I L  E   +PE  F P +  + + GI E     +L      
Sbjct: 593 FLRGPRPHDSEDIHQQHQIHLNVERIRVPEIVFQPSMGGLDQAGIAELSETILLRKFGSE 652

Query: 342 PEIVRPL---MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWE 398
           P+ +  L   M  NI  TGGN  +P   +R+ +E +  LP +   NV++   D T   W 
Sbjct: 653 PKHLSELSLTMANNIWLTGGNSKIPGLRERIVKEFREFLPVNTQFNVNMT-SDPTFDAWN 711

Query: 399 VMSQFAKTES-YQRARVTREEYYEHGPDWCTKHRFG 433
            M++ A+ E+ Y++  ++++EY E+GP++  +H+ G
Sbjct: 712 GMAKLAQNETDYKKTIISKKEYEEYGPEYIKEHKLG 747

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 99/434 (22%), Positives = 166/434 (38%), Gaps = 88/434 (20%)

Query: 5   PIVIDNGSYEIKFGPSTNKMPFRALNALAKDK------FGT----SYLSNHIKNIKDISS 54
           P+VIDNGS  +K G    + P     +L  D        G     S++ N  + ++ +  
Sbjct: 11  PVVIDNGSAVVKAGFCGEEKPRCMEYSLIGDANYNKIMVGGLECDSFVGNKAQRLRGL-- 68

Query: 55  VTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  + P E G ++ W+    +W + LF     D   L  G  H L+ +E+ +  PE +K 
Sbjct: 69  LKLKHPMERGVVSDWDDMELLWSHILF-----DSLQLTSGMEHPLLITEAPLN-PESNKE 122

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEP 174
               +F    F++     + V +P   S     RT                         
Sbjct: 123 KMLEVF----FETFNIPAICVSIPGVLSLYASGRTTG----------------------- 155

Query: 175 VDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFR 234
                          V+D G      +PV +G     ++K++++GG  +T  L+  L   
Sbjct: 156 --------------CVVDCGEGYCSSVPVCEGYTLASSIKRINLGGIDVTKQLQFQLRKE 201

Query: 235 HYNMM---DETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPN 291
               +    E  LV  +KEK  +VS     +  K + K   E       T+F        
Sbjct: 202 SGVWLFSSGERELVRTMKEKSCYVS----LNQLKDEEKFTFEP--GKMNTNF-------- 247

Query: 292 EEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIG 351
                LP D   +TL+   F  PE  F P+I    +P + E  L+S+  +   +RP ++ 
Sbjct: 248 ----KLP-DGNMLTLSKSRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMS 302

Query: 352 NIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSV---PEGDCTLFGWEVMSQFAKTES 408
            I  +GG      F  R  +EL  Q+ T    N+ +   PE   T   W   S  A   +
Sbjct: 303 RITLSGGTTMFRGFGDRFLQEL--QISTCKKSNIRILAPPERKYT--AWIGGSMLAGLTT 358

Query: 409 YQRARVTREEYYEH 422
           +++   T+ ++ EH
Sbjct: 359 FRKMLTTKSDWREH 372

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 85/386 (22%), Positives = 142/386 (36%), Gaps = 84/386 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKN-IKDI----------S 53
           PIV+D G+  +K G +    P     ++       +     I   +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKDIMIGDEASEVRS 65

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY  +     +   L    G  ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPLKNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
              +V+FE+Y+F  ++ +  AV   + +         SG                     
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------SG--------------------- 153

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                          +V+DSG   T I+PV + +      ++LD+ GR +T  L + LS 
Sbjct: 154 ---------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVL--EYVLPDFQTSFIGYVRH 289
           R Y  N   +   V  IKEK  +VS     D+  ++    L  +Y LPD           
Sbjct: 199 RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTRLARETTTLVEKYELPD----------- 247

Query: 290 PNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLM 349
                       + I +  E F  PE  F P +  +   G+ E +  ++      VR  +
Sbjct: 248 -----------GRIIKVGQERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRSSL 296

Query: 350 IGNIVCTGGNFNLPNFAQRLARELQR 375
              IV +GG+   P    RL +EL++
Sbjct: 297 YKAIVLSGGSSMYPGLPSRLEKELKQ 322

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 78/158 (49%), Gaps = 13/158 (8%)

Query: 286 YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVE----AILESLSML 341
           ++R P   DS    +   + L  E   +PE  F P +    + GI E     +L+     
Sbjct: 594 FLRGPRPHDSENIHEQHQMHLNVERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGSQ 653

Query: 342 PEIVRPL---MIGNIVCTGGNFNLPNFAQRLARELQRQLP--TDWTCNVSVPEGDCTLFG 396
           P  +      M+ N+  TGGN  +P   +R+ RE    LP  T+++ N+S    D +L  
Sbjct: 654 PGKLSSTSLDMVNNVFITGGNSKVPGLRERIVREFTEFLPVGTNFSVNMS---SDPSLDA 710

Query: 397 WEVMSQFAKT-ESYQRARVTREEYYEHGPDWCTKHRFG 433
           W+ M+  A+  E Y++  ++++EY E+GPD+  +H+ G
Sbjct: 711 WKGMAALAQNKEEYKKTVISKKEYEEYGPDYIKEHKLG 748

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%)

Query: 179 NSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH 235
           N N   +   LVID G + T +IPV+ G       K+++ GGR     L + ++ ++
Sbjct: 175 NQNTSGNKTGLVIDCGHEDTNVIPVVDGTGVLTDAKRINWGGRQAVDYLSDLMALKY 231

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 75/155 (48%), Gaps = 8/155 (5%)

Query: 286 YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVE----AILESLSML 341
           ++R P   DS    +   + L  E   +PE  F P +    + G+ E     +L+     
Sbjct: 590 FLRGPRPHDSDDVHEQHQMHLNIERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFGSS 649

Query: 342 PEIVRPL---MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWE 398
           P  +      M  NI  +GGN  +P    R+ +E    LP     +V++   D  L  W+
Sbjct: 650 PNQLSKTAEDMANNIWLSGGNAKVPGLKNRIVKEFTSFLPVGTKLSVNMS-SDPLLDSWK 708

Query: 399 VMSQFAKTESYQRARVTREEYYEHGPDWCTKHRFG 433
            M+++AK+E Y ++ +T++EY E+GP++  +H+ G
Sbjct: 709 GMAKWAKSEDYNKSFITKKEYEEYGPEYIKEHKMG 743

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 98/448 (21%), Positives = 168/448 (37%), Gaps = 96/448 (21%)

Query: 5   PIVIDNGSYEIKFGPS-TNKMPFRALNALAKDKFGTSYLSNHIKN----------IKDIS 53
           P+V+DNGS  IK G S  NK      N +   K+    L+N I N           K   
Sbjct: 10  PVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISNNDLTYIGNRAQKSRG 69

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P   G +  W+    +W +   +  + + FD      H L+ +E+ +   +   
Sbjct: 70  LLRLRHPMNRGIVENWDDMETLWSHTFNDILKINDFD-----EHPLLITEAPLNPEKNRD 124

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
              +V FE+++F +++     +  P T S     RT                        
Sbjct: 125 KMCEVFFEKFDFAAVY-----IANPSTLSLYASGRTTG---------------------- 157

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                           V+D G      +P+ +G     +++++D+GGR +T  L+     
Sbjct: 158 ---------------CVLDCGDGYCSSVPIYEGFALPSSIRRIDVGGRDVTEQLQ--FQI 200

Query: 234 RHYNMMD-----ETILVNNIKEKCLFVSPTSYFDSFKSK---NKHVLEYVLPDFQTSFIG 285
           R Y  +      E  +V N+KEK  +VS     D   S     K   ++ LPD       
Sbjct: 201 RKYTGISLYSSSEHEIVKNVKEKACYVSTDFAHDEDMSNLNPEKIRCQFKLPD------- 253

Query: 286 YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIV 345
                           + + L    F  PE  F P+I  +    + +   ES+S +   +
Sbjct: 254 ---------------GKDLILDKARFRAPEILFRPQIMGLEYDSVSDMCFESISKVDLEL 298

Query: 346 RPLMIGNIVCTGGNFNLPNFAQRLARELQ-RQLPTDWTCNVSVPEGDCTLFGWEVMSQFA 404
           RP +  +I+  GG+     F  RL +ELQ R    +    ++ PE   T   W   S   
Sbjct: 299 RPKLFSSIILNGGSTMFRGFGDRLLKELQIRTGNKNLIKIIAPPERKYT--SWIGGSILT 356

Query: 405 KTESYQRARVTREEYYEHGPDWCTKHRF 432
              ++++  +T+ E+ E   D   ++RF
Sbjct: 357 GLSTFKQLWMTKAEWQE---DNNLRYRF 381

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 105/441 (23%), Positives = 176/441 (39%), Gaps = 96/441 (21%)

Query: 17  FGPSTNKMPFRAL-------NALAKDKFGTSYLSNHIKNIKDISS----VTFRRPHELGQ 65
           FG ST+   F  L       N LA  K GT  L  +I N   I+S     +   P   GQ
Sbjct: 66  FGNSTSATSFNNLSSQMLMSNNLA-GKRGTEDLDFYIGNEALIASQGASYSLSYPIRHGQ 124

Query: 66  LTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEF 125
           +  W+     W+  +F       +   E + H  + +E  +  PE  +   ++ FE +  
Sbjct: 125 VENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENREQIAEIFFESFNC 178

Query: 126 DSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNSNNDYH 185
             L+                             V    +   ++TS + VD + +     
Sbjct: 179 AGLY---------------------------IAVQAVLALAASWTSSKVVDRSLTGT--- 208

Query: 186 DFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-L 244
               VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D ++  
Sbjct: 209 ----VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITQFIQTLL--RERGEADTSLRT 262

Query: 245 VNNIKEKCLFVSP--TSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQ 302
              IK++  +V P     F+ F    +   +YV+              N+E     T  +
Sbjct: 263 AERIKQEYCYVCPDIVKEFNKFDRDPEKFAQYVV-------------ENQEK----TQKK 305

Query: 303 SITLTDELFTIPETFFHPEI--SQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360
            + +  E F  PE FF+PEI  S  + P +   + +++   P  VR  +  NIV +GG+ 
Sbjct: 306 VVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGGST 364

Query: 361 NLPNFAQRLARELQRQLPTDWTCN------------VSV----PEGDCTLFGWEVMSQFA 404
              +F +RL R+L+  +      N            VSV     + +   FG  +++Q A
Sbjct: 365 MFKDFGRRLQRDLKSIVNNRIAQNELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTA 424

Query: 405 KTESYQRARVTREEYYEHGPD 425
           + +SY     T+++Y E+GP+
Sbjct: 425 EFKSYCH---TKKDYEEYGPE 442

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 72.8 bits (177), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 74/156 (47%), Gaps = 9/156 (5%)

Query: 286 YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVE----AILESLSML 341
           ++R P   DS    +   + L  E   +PE  F P +    + GI E     +L+     
Sbjct: 594 FLRGPRPHDSENIHEQHQMHLNVERTRVPEIVFQPTMGGQDQAGICELAETILLKKFGSQ 653

Query: 342 PEIVRPL---MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWE 398
           P  +      M  N+  TGGN  +P   +R+ +E    LP     N+++   D +L  W+
Sbjct: 654 PGKLSQTSIDMANNVFITGGNAKVPGLKERIVKEFTGFLPVGTNININMS-SDPSLDAWK 712

Query: 399 VMSQFAKTES-YQRARVTREEYYEHGPDWCTKHRFG 433
            M+  A+ E  Y+R  ++R+EY E+GPD+  +H+ G
Sbjct: 713 GMAALAQNEEEYKRTIISRKEYEEYGPDYIKEHKLG 748

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 72.4 bits (176), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 76/156 (48%), Gaps = 9/156 (5%)

Query: 286 YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVE----AILESLSML 341
           ++R P   DS    +   + L  E   +PE  F P +    + GI E     +L+     
Sbjct: 594 FLRGPRPHDSENIHEQHQMHLNVERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQ 653

Query: 342 PEIVRPL---MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWE 398
           P  +      M+ N++ TGGN  +P   +R+ +E    LPT     V++   D +L  W+
Sbjct: 654 PGKLSQTSIDMVNNVLITGGNAKVPGLKERIVKEFTGFLPTGTNITVNM-SSDPSLDAWK 712

Query: 399 VMSQFAKT-ESYQRARVTREEYYEHGPDWCTKHRFG 433
            M+  A+  E Y++  ++++EY E+GP++  +H+ G
Sbjct: 713 GMAALARNEEQYRKTVISKKEYEEYGPEYIKEHKLG 748

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 71/157 (45%), Gaps = 11/157 (7%)

Query: 286 YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVE--------AILES 337
           ++R P   DS    +   + L  E   +PE  F P ++ + + G+ E            +
Sbjct: 586 FLRGPRPHDSENINEQHQMHLNVERIRVPEVIFQPSMAGLDQAGVTEICETNFLKKFGST 645

Query: 338 LSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGW 397
            S L E  + L   N+  TGGN  LP   +R+ RE    LP     NV +   D  +  W
Sbjct: 646 RSQLSEGSKKLA-ANVFLTGGNMRLPGVRERIVREFTGMLPMGSNLNVRMA-SDSAVDAW 703

Query: 398 EVMSQFAKTES-YQRARVTREEYYEHGPDWCTKHRFG 433
             M++ ++  S Y+ + +TR+EY E G D+  +H  G
Sbjct: 704 RGMAKLSQAGSQYKGSYITRKEYQELGADYIKEHNLG 740

 Score = 37.0 bits (84), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%)

Query: 180 SNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH 235
           +NND     LVI+SG + T +IPV+ G       K+++ GGR     L   L+ ++
Sbjct: 174 ANNDATASGLVINSGNEDTHVIPVMNGKGVLSEAKRINWGGRQSVEYLSNLLALKY 229

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 102/446 (22%), Positives = 175/446 (39%), Gaps = 96/446 (21%)

Query: 12  SYEIKFGPSTNKMPFRAL-------NALAKDKFGTSYLSNHIKNIKDISS----VTFRRP 60
           SY    G ST+   F +L       N LA  K GT  L  +I N   ++S     +   P
Sbjct: 64  SYLSGGGNSTSATDFNSLASSTLISNNLA-GKRGTEDLDFYIGNEALVASQGPSYSLSYP 122

Query: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
              GQ+  W+     W+  +F       +   E + H  + +E  +  PE  +   ++ F
Sbjct: 123 IRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENRQQVAEIFF 176

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180
           E +    L+                             V    +   ++TS +  D + +
Sbjct: 177 ESFNCAGLY---------------------------IAVQAVLALAASWTSSKVTDRSLT 209

Query: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
                    VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D
Sbjct: 210 GT-------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEQD 260

Query: 241 ETI-LVNNIKEKCLFVSP--TSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPL 297
            ++     IK++  +V P     F+ F   ++   ++++              N+E    
Sbjct: 261 ASLRTAERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFIV-------------ENKER--- 304

Query: 298 PTDAQSITLTDELFTIPETFFHPEI--SQIIKPGIVEAILESLSMLPEIVRPLMIGNIVC 355
            T  + + +  E F  PE FF+PEI  S  + P  V  + E++   P  VR  +  NIV 
Sbjct: 305 -TTKKVVDVGYERFLAPEIFFNPEIASSDFLTPLPV-VVDETIQACPIDVRKGLYNNIVL 362

Query: 356 TGGNFNLPNFAQRLARELQ----------------RQLPTDWTCNVSVPEGDCTLFGWEV 399
           +GG+    +F +RL R+L+                R    D +      + +   FG  +
Sbjct: 363 SGGSTMFKDFGRRLQRDLKGIVNDRISQSEKLSGTRSTGVDVSVISHKRQRNAVWFGGSL 422

Query: 400 MSQFAKTESYQRARVTREEYYEHGPD 425
           ++Q  + +SY     T+++Y E+GPD
Sbjct: 423 LAQTGEFKSYCH---TKQDYEEYGPD 445

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 76/157 (48%), Gaps = 11/157 (7%)

Query: 286 YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILES--LSMLPE 343
           ++R P   DS    +   + +  E   +PE  F P I  + + G+VE + E+  L     
Sbjct: 591 FLRGPRPHDSENIHEQHQMHINVERIRVPEVIFQPSIGGLDQAGVVE-LCETVLLKKFDS 649

Query: 344 IVRPL------MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGW 397
             R L      M  N+  TGGN  LP   +R+ RE    LP      V++ + D +L  W
Sbjct: 650 SRRALSATCEKMAKNVFITGGNTKLPGIRERIVREFTGFLPVGTELKVTLAK-DPSLSAW 708

Query: 398 EVMSQFAKT-ESYQRARVTREEYYEHGPDWCTKHRFG 433
           + M++FA    SY+ + +T+ EY E+GP++  +H  G
Sbjct: 709 KGMAKFASDPTSYKSSILTKREYEEYGPEYIKEHNLG 745

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 96/440 (21%), Positives = 171/440 (38%), Gaps = 94/440 (21%)

Query: 17  FGPSTNKMPFRALNALA------KDKFGTS----YLSNHIKNIKDISSVTFRRPHELGQL 66
           FG ST+   F +L A A        K GT     Y+ N         S +   P   GQ+
Sbjct: 69  FGNSTSATSFDSLAASALLSNNLAGKRGTEDLDFYIGNEALAASRGPSYSLSYPIRHGQV 128

Query: 67  TLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEFD 126
             W+     W+  +F       +   E + H  + +E  +  PE  +   ++ FE +   
Sbjct: 129 ENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCA 182

Query: 127 SLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNSNNDYHD 186
            L+                             V    +   ++TS +  D + +      
Sbjct: 183 GLY---------------------------IAVQAVLALAASWTSSKVTDRSLTGT---- 211

Query: 187 FQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LV 245
              VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R    +D ++   
Sbjct: 212 ---VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLRTA 266

Query: 246 NNIKEKCLFVSP--TSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQS 303
             IK++  +V P     F+ F        ++++ + ++                 T  + 
Sbjct: 267 ERIKQEYCYVCPDIVKEFNKFDRDAGKFAQFIVENSES-----------------TKKKI 309

Query: 304 ITLTDELFTIPETFFHPEI--SQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFN 361
           + +  E F  PE FF+PEI  S  + P +   + +++   P  VR  +  NIV +GG+  
Sbjct: 310 VDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTM 368

Query: 362 LPNFAQRLARELQ----------RQLPTDWTCNVSVP------EGDCTLFGWEVMSQFAK 405
             +F +RL R+L+            L    +  V V       + +   FG  +++Q A+
Sbjct: 369 FKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAQTAE 428

Query: 406 TESYQRARVTREEYYEHGPD 425
            +SY     T+++Y E+GP+
Sbjct: 429 FKSYCH---TKQDYEEYGPE 445

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 102/438 (23%), Positives = 171/438 (39%), Gaps = 90/438 (20%)

Query: 17  FGPSTNKMPFRALNA---LAKD---KFGTS----YLSNHIKNIKDISSVTFRRPHELGQL 66
           FG ST+   F +LNA   L+ +   K GT     Y+ N         S +   P   GQ+
Sbjct: 62  FGNSTSATSFNSLNASMPLSNNLAGKRGTEDLDFYIGNEALAAAQGPSYSLSYPIRHGQI 121

Query: 67  TLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEFD 126
             W+     W+  +F       +   E + H  + +E  +  PE  +   ++ FE +   
Sbjct: 122 ENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCA 175

Query: 127 SLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNSNNDYHD 186
            L+                             V    +   ++TS +  D + +      
Sbjct: 176 GLY---------------------------IAVQAVLALAASWTSSKVTDRSLTGT---- 204

Query: 187 FQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LV 245
              VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D ++   
Sbjct: 205 ---VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGETDTSLRTA 259

Query: 246 NNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQSIT 305
             IK++  +V P    D  K  NK       PD    FI      N+E     T  + + 
Sbjct: 260 ERIKQEYCYVCP----DIVKEFNKFDRN---PDKFAQFI----VENQEK----TQKKIVD 304

Query: 306 LTDELFTIPETFFHPEI--SQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLP 363
           +  E F  PE FF+PEI  S  + P +   +  ++   P  VR  +  NIV +GG+    
Sbjct: 305 VGYERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFK 363

Query: 364 NFAQRLARELQ----------------RQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTE 407
           +F +RL R+++                +    D        + +   FG  +++Q A+ +
Sbjct: 364 DFGRRLQRDIKSIVNNRIAQSELLSGTKSTGVDVNVITHRKQRNAVWFGGSLLAQTAEFK 423

Query: 408 SYQRARVTREEYYEHGPD 425
           SY     T+++Y E+GP+
Sbjct: 424 SYCH---TKKDYEEYGPE 438

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 98/449 (21%), Positives = 176/449 (39%), Gaps = 97/449 (21%)

Query: 10  NGSYEIKFGPSTNKMPFRAL--------NALAKDKFGTSYLSNHIKNIKDIS----SVTF 57
           NGS    FG ST+   F  L        N LA  K GT  L  +I N   ++    S + 
Sbjct: 63  NGSSNPYFGNSTSATNFGGLTGGKMLLSNNLA-GKRGTEDLDFYIGNEALVAAQSPSYSL 121

Query: 58  RRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQ 117
             P   GQ+  W+     W+  +F       +   E + H+ + +E  +  PE  +   +
Sbjct: 122 SYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHYFLLTEPPLNPPENREQVAE 175

Query: 118 VIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDE 177
           + FE +    L+                             V    +   ++TS + +D 
Sbjct: 176 IFFESFNCAGLY---------------------------IAVQAVLALAASWTSSKVIDR 208

Query: 178 TNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYN 237
           + +         VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R   
Sbjct: 209 SLTGT-------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITEFIQSLL--RERG 259

Query: 238 MMDETI-LVNNIKEKCLFVSP--TSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEED 294
             D ++     IK++  +V P     F+ F  + +   ++++                 +
Sbjct: 260 EADTSLRTAERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIV-----------------E 302

Query: 295 SPLPTDAQSITLTDELFTIPETFFHPEI--SQIIKPGIVEAILESLSMLPEIVRPLMIGN 352
           S   T  + + +  E F  PE FF+PEI  S  + P +   + +++   P  VR  +  N
Sbjct: 303 SQEKTKQKVVDVGYERFLAPEIFFNPEIASSDYLTP-LPTVVDQTIQACPIDVRKGLYNN 361

Query: 353 IVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSV----------------PEGDCTLFG 396
           IV +GG+    +F++RL R+++  +    + N  +                 + +   FG
Sbjct: 362 IVLSGGSTMFKDFSRRLQRDMKSIVNARISQNEKMTGVKSSGVDVQVISHRKQRNAVWFG 421

Query: 397 WEVMSQFAKTESYQRARVTREEYYEHGPD 425
             +++Q A+   Y     T+ +Y E GP+
Sbjct: 422 GSLLAQTAEFRGYCH---TKRDYEEIGPE 447

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 74/156 (47%), Gaps = 9/156 (5%)

Query: 286 YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVE----AILESLSML 341
           ++R P   DS  P     I +  E   +PE  F P I    + GI E      L   +  
Sbjct: 599 FLRGPRPHDSEDPHQQHQIHMNVERIRVPEVMFQPSIGGCDQAGISELSETLFLRKFNSS 658

Query: 342 PEIVRPL---MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWE 398
           P  +  +   M+ N+  TGG+  LP   +R+ +E    LP     ++++   D +L  W+
Sbjct: 659 PRKLSSISERMLNNVWLTGGHAKLPGLKERIVKEYTEFLPVGTKMSINI-SNDPSLDTWK 717

Query: 399 VMSQFAKTESY-QRARVTREEYYEHGPDWCTKHRFG 433
            M++ A    Y ++ +VT+++Y E+GP++  +H  G
Sbjct: 718 GMAKLASNTDYLKKIQVTKKDYEEYGPEYMMEHNLG 753

 Score = 38.1 bits (87), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 52/237 (21%), Positives = 88/237 (37%), Gaps = 48/237 (20%)

Query: 5   PIVIDNGSYEIKFGPSTNKMPFRAL-NALAKDK----FGTSYLSNHIKNIKDISSVTFRR 59
           PI ID GSY +K G +   +P     N L + +      T     +  N+     +  +R
Sbjct: 38  PIAIDFGSYNVKAGYTNQSLPTHVFTNKLTRYRDRKLAKTMTFIGNDTNLDQPLRIQAKR 97

Query: 60  PHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGK-GHHLVASESCMTLPELSKHADQV 118
           P++   +  WE    I+DY L +     G     G   + ++ +E    L     +  Q+
Sbjct: 98  PYDGLFIANWEYAEEIFDYTLHHL----GVQTTNGSISNPIILTEKMACLQSQRANWYQL 153

Query: 119 IFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDET 178
           +FE       F  P A F                   D+  A  +               
Sbjct: 154 LFE------TFDVPSATF-----------------GLDSLYAFYN--------------- 175

Query: 179 NSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH 235
           N  N +    LVI+ G + T I+P+++G       K+++ GGR  T  L   L+ ++
Sbjct: 176 NCANPFESDGLVINCGHEDTNIVPIVQGKGILTEAKRINWGGRHSTEYLSSLLTLKY 232

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 93/431 (21%), Positives = 172/431 (39%), Gaps = 89/431 (20%)

Query: 20  STNKMPFRALNALAKDKFGTSYLSNHIKNIKDISS----VTFRRPHELGQLTLWELESCI 75
           ++N   F   N LA  K GT  L  +I N   ++S     +   P   GQ+  W+     
Sbjct: 81  ASNSNAFLLSNNLA-GKRGTEDLDFYIGNEALVASQGPAYSLSYPIRHGQVENWDHMERF 139

Query: 76  WDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEFDSLFKSPVAV 135
           W+  +F       +   E + H  + +E  +  PE  +   ++ FE +    L+      
Sbjct: 140 WENSIFK------YLRAEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLY------ 187

Query: 136 FVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNSNNDYHDFQLVIDSGF 195
                                  V    +   ++TS +  D + +         VIDSG 
Sbjct: 188 ---------------------IAVQAVLALAASWTSAQVTDRSLTGT-------VIDSGD 219

Query: 196 DCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNIKEKCLF 254
             T +IPV +G     A+K + I GR +T  ++  L  R     D ++     IK++  +
Sbjct: 220 GVTHVIPVAEGYVVGSAIKNIPIAGRDITLFIQSLL--RERGEADSSLKTAERIKQEYCY 277

Query: 255 VSP--TSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQSITLTDELFT 312
           V P     F+ F  + +   ++++ +              +D    T  + I +  E F 
Sbjct: 278 VCPDIVKEFNKFDRQPEKFAQFIIEN--------------QDK---TTKKVIDIGYERFL 320

Query: 313 IPETFFHPEI--SQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLA 370
            PE FF+PEI  S  + P +   + +++   P  VR  +  NIV +GG+    +F++RL 
Sbjct: 321 APEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRRLQ 379

Query: 371 RELQRQLPTDWTCNVSV----------------PEGDCTLFGWEVMSQFAKTESYQRARV 414
           R+++  +      N ++                 + +   FG  +++Q A+ + Y     
Sbjct: 380 RDVKSIVSNRIAQNEALTGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKGYCH--- 436

Query: 415 TREEYYEHGPD 425
           T+++Y EHGP+
Sbjct: 437 TKKDYEEHGPE 447

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 101/447 (22%), Positives = 177/447 (39%), Gaps = 94/447 (21%)

Query: 10  NGSYEIKFGPSTNKMPFRALNA---LAKD---KFGTSYLSNHIKNIKDISS----VTFRR 59
           N S    FG ST+   F  LN    L+ +   K GT  L  +I N   ++S     +   
Sbjct: 68  NSSATPYFGNSTSATSFNNLNKNMLLSNNLAGKRGTEDLDFYIGNEALVASQGPSYSLSY 127

Query: 60  PHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVI 119
           P   GQ+  W+     W+  +F       +   E + H  + +E  +  PE  +   ++ 
Sbjct: 128 PIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENREQIAEIF 181

Query: 120 FEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETN 179
           FE +    L+                             V    +   ++TS +  D + 
Sbjct: 182 FESFNCAGLY---------------------------IAVQAVLALAASWTSSKVTDRSL 214

Query: 180 SNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMM 239
           +         VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R    +
Sbjct: 215 TGT-------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEV 265

Query: 240 DETI-LVNNIKEKCLFVSP--TSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSP 296
           D ++     IK++  +V P     F+ F        ++++              N+E   
Sbjct: 266 DTSLKTAERIKQEYCYVCPDIVKEFNKFDRDGSKFAQFIV-------------ENQEQ-- 310

Query: 297 LPTDAQSITLTDELFTIPETFFHPEI--SQIIKPGIVEAILESLSMLPEIVRPLMIGNIV 354
             T  + + +  E F  PE FF+PEI  S  + P +   +  ++   P  VR  +  NIV
Sbjct: 311 --TRKKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVRKGLYNNIV 367

Query: 355 CTGGNFNLPNFAQRLARELQ----------RQLPTDWTCNVSV------PEGDCTLFGWE 398
            +GG+    +F +RL R+L+           +L    +  V V       + +   FG  
Sbjct: 368 LSGGSTMFKDFGRRLQRDLKSIVSNRIAQSERLSGTKSTGVDVQVISHRKQRNAVWFGGS 427

Query: 399 VMSQFAKTESYQRARVTREEYYEHGPD 425
           +++Q A+ +SY     T+++Y E+GP+
Sbjct: 428 LLAQTAEFKSYCH---TKKDYEEYGPE 451

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 104/453 (22%), Positives = 179/453 (39%), Gaps = 96/453 (21%)

Query: 3   APPIVIDNGSYEIKFGPSTNKMPFRA-----LNALAKDKFGTSYLSNHIKNIKDISS--- 54
           AP  V +  SY   FG ST+   F       L+     K GT  L  +I N   ++S   
Sbjct: 52  APSAVSNEASY---FGNSTSATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGP 108

Query: 55  -VTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
             +   P   GQ+  W+     W+  +F       +   E + H  + +E  +  PE  +
Sbjct: 109 SYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENRE 162

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
              ++ FE +    L+                             V    +   ++TS +
Sbjct: 163 QVAEIFFESFNCAGLY---------------------------IAVQAVLALAASWTSSK 195

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
             D + +         VIDSG   T +IPV +G     A+K + I GR +T  ++  L  
Sbjct: 196 VTDRSLTGT-------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL-- 246

Query: 234 RHYNMMDETI-LVNNIKEKCLFVSP--TSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHP 290
           R     D ++     IK++  +V P     F+ F        ++V+              
Sbjct: 247 RERGEADTSLRTAEKIKQEYCYVCPDIVKEFNKFDKDPSKFAQFVV-------------E 293

Query: 291 NEEDSPLPTDAQSITLTDELFTIPETFFHPEI--SQIIKPGIVEAILESLSMLPEIVRPL 348
           N+E     T  + + +  E F  PE FF+PEI  S  + P +   + +++   P  VR  
Sbjct: 294 NQEK----TRRKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKG 348

Query: 349 MIGNIVCTGGNFNLPNFAQRLAREL---------QRQLPT---DWTCNVSV----PEGDC 392
           +  NIV +GG+    +F +RL R+L         Q +L +       +VSV     + + 
Sbjct: 349 LYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNA 408

Query: 393 TLFGWEVMSQFAKTESYQRARVTREEYYEHGPD 425
             FG  +++Q A+ + Y     T+++Y E+GP+
Sbjct: 409 VWFGGSLLAQTAEFKGYCH---TKKDYEEYGPE 438

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 69.7 bits (169), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 80/166 (48%), Gaps = 12/166 (7%)

Query: 278 DFQTSFIG-YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILE 336
           D++ S +  ++R P   DS    +   + L  E   +PE  F P +    + GI E + E
Sbjct: 585 DWRNSLLHLFLRGPRPHDSENIHEQHQMHLNVERIRVPEVVFQPTMGGQDQAGICE-LSE 643

Query: 337 SLSMLP--------EIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVP 388
           ++ M                M+ NI+ TGGN  +P   +R+ +E    LP      V++ 
Sbjct: 644 TILMKKFGSQRGKLSSTSLDMVNNILITGGNAKVPGLRERIVKEFTEFLPVGTNVAVNIS 703

Query: 389 EGDCTLFGWEVMSQFAKTES-YQRARVTREEYYEHGPDWCTKHRFG 433
             + +L  W  M+  A+ ++ Y++  +++EEY E+GPD+  +H+ G
Sbjct: 704 -SNPSLDAWRGMAALARNKAEYKKTVISKEEYEEYGPDYIKEHKLG 748

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 102/449 (22%), Positives = 178/449 (39%), Gaps = 97/449 (21%)

Query: 10  NGSYEIKFGPSTNKMPFRAL--------NALAKDKFGTSYLSNHIKNIKDIS----SVTF 57
           +GS    FG ST+   F +L        N LA  K GT  L  +I N   I+    S   
Sbjct: 66  SGSGRQYFGNSTSATAFNSLSSGSALMSNNLA-GKRGTEDLDFYIGNEALIAAQGPSYGL 124

Query: 58  RRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQ 117
             P   GQ+  W+     W+  +F       +   E + H  + +E  +  PE  +   +
Sbjct: 125 SYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHCFLLTEPPLNPPENREQVAE 178

Query: 118 VIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDE 177
           + FE +    L+                             V    +   ++TS + +D 
Sbjct: 179 IFFESFNCAGLY---------------------------IAVQAVLALAASWTSSKVIDR 211

Query: 178 TNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYN 237
           + +         VIDSG   T +IPV +G     A+K + I GR +T  +++ L  R   
Sbjct: 212 SLTGT-------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERG 262

Query: 238 MMDETI-LVNNIKEKCLFVSP--TSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEED 294
             D ++     IK++  +V P     F+ F   ++   ++V+                 +
Sbjct: 263 EEDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFVV-----------------E 305

Query: 295 SPLPTDAQSITLTDELFTIPETFFHPEI--SQIIKPGIVEAILESLSMLPEIVRPLMIGN 352
           S   T  + + +  E F  PE FF+PEI  S  + P +   +  ++   P  VR  +  N
Sbjct: 306 SQEKTRRKVVDVGCERFMAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYNN 364

Query: 353 IVCTGGNFNLPNFAQRLARELQ-----RQLPTDWTCNVSVPEGDCTL-----------FG 396
           IV +GG+    +F +RL R+L+     R + +++         D  +           FG
Sbjct: 365 IVLSGGSTMFKDFGRRLQRDLKSIVNNRIVQSEYLSGTKSTGVDVQVISHRKQRNAVWFG 424

Query: 397 WEVMSQFAKTESYQRARVTREEYYEHGPD 425
             +++Q A+ +SY     T+++Y E GP+
Sbjct: 425 GSLLAQTAEFKSYCH---TKKDYEEIGPE 450

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 69.3 bits (168), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 73/156 (46%), Gaps = 10/156 (6%)

Query: 286 YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVE---AIL-----ES 337
           ++R P   +         + L  E    PE  F P +  + + GI E    IL       
Sbjct: 588 FLRGPRPHNGEDVHQQHQLHLNIERIRAPEVIFQPSMGGLDQAGIAELADGILTKKFGSG 647

Query: 338 LSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGW 397
            S L +     M  NI  TGGN  +PN  +R+  E    LP +   NV+  + + +L  W
Sbjct: 648 SSKLSQQCLD-MASNIFITGGNTKIPNLRERIVNEFTGFLPVNTPLNVNYAQ-NVSLDAW 705

Query: 398 EVMSQFAKTESYQRARVTREEYYEHGPDWCTKHRFG 433
           + M++FA++++Y    VT+ EY E GP++  +H+ G
Sbjct: 706 KGMAKFARSDTYSSTCVTKVEYEEFGPNYIKEHKLG 741

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%)

Query: 180 SNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH 235
           +NN      L+I+SG + T IIPV+KG       K++D GG      LK  LS ++
Sbjct: 177 ANNSPDSTGLIINSGHEDTNIIPVIKGKGILSEAKRIDWGGNQSIDYLKSLLSLKY 232

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 69/255 (27%), Positives = 116/255 (45%), Gaps = 40/255 (15%)

Query: 190 VIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + I GR +T  +++ L  R     D ++     I
Sbjct: 210 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEQDTSLKTAERI 267

Query: 249 KEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQSITLTD 308
           K++  +V P    D  K  NK   +       + F  +V    E+     T  + + +  
Sbjct: 268 KQEYCYVCP----DIVKEFNKFDRD------ASKFAQFVVESQEK-----TRKKIVDVGY 312

Query: 309 ELFTIPETFFHPEI--SQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFA 366
           E F  PE FF+PEI  S  + P +   + E++   P  VR  +  NIV +GG+    +F 
Sbjct: 313 ERFLAPEIFFNPEIASSDFLTP-LPTVVDETIQACPIDVRKGLYNNIVLSGGSTMFKDFG 371

Query: 367 QRLARELQ----------RQLPTDWTCNVSV------PEGDCTLFGWEVMSQFAKTESYQ 410
           +RL R+++            L    +  V V       + +   FG  +++Q A+ +SY 
Sbjct: 372 RRLQRDMKSIVNNRIAQSEALSGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYC 431

Query: 411 RARVTREEYYEHGPD 425
               T+++Y E+GP+
Sbjct: 432 H---TKKDYDEYGPE 443

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 80/350 (22%), Positives = 130/350 (37%), Gaps = 84/350 (24%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E   +VIDNGS   K G + +  P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHH-LVASESCMTLPE 110
           I  +T R P E G +T W+    IW +  +N       +L+     H ++ +E+ M    
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFT 170
             +   Q++FE +   + + S  AV   ++       RT                     
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYSSG-----RTTG------------------- 150

Query: 171 SKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G      + ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 HPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESL 338
             + E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSI 282

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/320 (22%), Positives = 120/320 (37%), Gaps = 73/320 (22%)

Query: 60  PHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVI 119
           P E G +  W     +WDY  +   +    D   GK   ++ +E  M   +  +   +V+
Sbjct: 18  PMENGIIKNWTDMELLWDYAFYEQMKLP--DTSNGK---ILLTEPPMNPIKNREKMCEVM 72

Query: 120 FEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETN 179
           FE+Y F  ++ +  AV   + +         SG                           
Sbjct: 73  FEKYNFGGVYVAIQAVLALYAQGLS------SG--------------------------- 99

Query: 180 SNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--N 237
                    +V+DSG   T I+PV + +      ++LD+ GR +T  L + LS R Y  N
Sbjct: 100 ---------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRNLIDLLSRRGYAFN 150

Query: 238 MMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVL--EYVLPDFQTSFIGYVRHPNEEDS 295
              +   V  IKEK  +VS     D+  ++    L   Y LPD                 
Sbjct: 151 RTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD----------------- 193

Query: 296 PLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVC 355
                 + I +  E F  PE  F P +  + + G+ E +  ++      +R  +   IV 
Sbjct: 194 -----GRVIKVGSERFEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRSTLFKAIVL 248

Query: 356 TGGNFNLPNFAQRLARELQR 375
           +GG+   P    RL +EL++
Sbjct: 249 SGGSSMYPGLPSRLEKELKQ 268

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 97/440 (22%), Positives = 169/440 (38%), Gaps = 94/440 (21%)

Query: 17  FGPSTNKMPFRALNALA------KDKFGTS----YLSNHIKNIKDISSVTFRRPHELGQL 66
           FG ST+   F +L + A        K GT     Y+ N         S +   P   GQ+
Sbjct: 64  FGNSTSATSFNSLASAALLSNNLAGKRGTEDLDFYIGNEALAASQGPSYSLSYPIRHGQV 123

Query: 67  TLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEFD 126
             W+     W+  +F       +   E + H  + +E  +  PE  +   ++ FE +   
Sbjct: 124 ENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCA 177

Query: 127 SLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNSNNDYHD 186
            L+                             V    +   ++TS + VD + +      
Sbjct: 178 GLY---------------------------IAVQAVLALAASWTSSKVVDRSLTGT---- 206

Query: 187 FQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LV 245
              VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D T+   
Sbjct: 207 ---VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEEDTTLRTA 261

Query: 246 NNIKEKCLFVSP--TSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQS 303
             IK++  +V       F+ F    +   ++++ + +                  T  + 
Sbjct: 262 ERIKQEYCYVCSDIVKEFNKFDRDPQKFAQFIVENSEK-----------------TKRKV 304

Query: 304 ITLTDELFTIPETFFHPEI--SQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFN 361
           I +  E F  PE FF+PEI  S  + P +   + +++   P  VR  +  NIV +GG+  
Sbjct: 305 IDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTM 363

Query: 362 LPNFAQRLARELQ----------RQLPTDWTCNVSVP------EGDCTLFGWEVMSQFAK 405
             +F +RL R+L+            L    +  V V       + +   FG  +++Q A+
Sbjct: 364 FKDFGRRLQRDLKGIVNNRIALSEHLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAQTAE 423

Query: 406 TESYQRARVTREEYYEHGPD 425
            +SY     T+++Y E GP+
Sbjct: 424 FKSYCH---TKQDYEEIGPE 440

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 82/384 (21%), Positives = 141/384 (36%), Gaps = 80/384 (20%)

Query: 5   PIVIDNGSYEIKFGPSTNKMPFRAL-NALAKDKFGTSYLSNHIKNIKDI----------S 53
           PIV+D G+  +K G +    P     + + +         N    +KD+          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVRS 65

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY  +     +   L    G  ++ +E  +   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPLNPLKNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
              +V+FE+Y+F  ++ +  AV   + +         SG                     
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------SG--------------------- 153

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                          +VIDSG   T I+PV + +      ++LD+ GR +T  L + LS 
Sbjct: 154 ---------------VVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPN 291
           R Y  N   +   V  IKEK  +VS     D+  ++    L                   
Sbjct: 199 RGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTL------------------- 239

Query: 292 EEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIG 351
            E+  LP D + I +  E F   E  F P +  +   G+ E +  ++      VR  +  
Sbjct: 240 VENYELP-DGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYK 298

Query: 352 NIVCTGGNFNLPNFAQRLARELQR 375
            IV +GG+   P    R+ +EL++
Sbjct: 299 AIVLSGGSSMYPGLPSRIEKELKQ 322

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 115/254 (45%), Gaps = 40/254 (15%)

Query: 190 VIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R    +D ++     I
Sbjct: 211 VIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGRDITLFIQSLL--RERGEVDTSLRTAERI 268

Query: 249 KEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQSITLTD 308
           K++  +V P    D  K  NK   +       T F  ++    E+     T  + + +  
Sbjct: 269 KQEYCYVCP----DIVKEFNKFDRD------ATKFAQFIVENKEK-----TQKKVVDVGY 313

Query: 309 ELFTIPETFFHPEI--SQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFA 366
           E F  PE FF+PEI  S  + P +   + +++   P  VR  +  NIV +GG+    +F 
Sbjct: 314 ERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFG 372

Query: 367 QRLARELQ----------RQLPTDWTCNVSVP------EGDCTLFGWEVMSQFAKTESYQ 410
           +RL R+L+            L    +  V V       + +   FG  +++Q A+ +SY 
Sbjct: 373 RRLQRDLRSIVNNRIAQSELLSGTKSTGVEVQVISHRRQRNAVWFGGSLLAQTAEFKSYC 432

Query: 411 RARVTREEYYEHGP 424
               T+++Y E+GP
Sbjct: 433 H---TKKDYEEYGP 443

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 101/445 (22%), Positives = 178/445 (40%), Gaps = 93/445 (20%)

Query: 11  GSYEIKFGPSTNKMPFRALNA--LAKD---KFGTSYLSNHIKNIKDISS----VTFRRPH 61
           GS    FG ST+   F  +    L+ +   K GT  L  +I N   ++S     +   P 
Sbjct: 57  GSDTSYFGNSTSATNFNGVTGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSYSLSYPI 116

Query: 62  ELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFE 121
             GQ+  W+     W+  +F       +   E + H  + +E  +  PE  +   ++ FE
Sbjct: 117 RHGQVENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENREQVAEIFFE 170

Query: 122 EYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNSN 181
            +    L+                             V    +   ++TS +  D + + 
Sbjct: 171 SFNCAGLY---------------------------IAVQAVLALAASWTSSKVTDRSLTG 203

Query: 182 NDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDE 241
                   VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D 
Sbjct: 204 T-------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADT 254

Query: 242 TI-LVNNIKEKCLFVSP--TSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLP 298
           ++     IK++  +V P     F+ F        ++V+              N+E     
Sbjct: 255 SLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVV-------------ENQEK---- 297

Query: 299 TDAQSITLTDELFTIPETFFHPEI--SQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCT 356
           T  +++ +  E F  PE FF+PEI  S  + P +   + +++   P  VR  +  NIV +
Sbjct: 298 TRRKAVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLS 356

Query: 357 GGNFNLPNFAQRLAREL---------QRQLPT---DWTCNVSV----PEGDCTLFGWEVM 400
           GG+    +F +RL R+L         Q +L +       +VSV     + +   FG  ++
Sbjct: 357 GGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLL 416

Query: 401 SQFAKTESYQRARVTREEYYEHGPD 425
           +Q A+ + Y     T+++Y E+GP+
Sbjct: 417 AQTAEFKGYCH---TKKDYEEYGPE 438

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 88/388 (22%), Positives = 152/388 (39%), Gaps = 89/388 (22%)

Query: 5   PIVIDNGSYEIKFGPSTNKMPFR---ALNALAK-DKFGTS--------YLSNHIKNIKDI 52
           PIVIDNGS  IK G S    P      L  + K DK   +        Y+ N  ++I+ +
Sbjct: 11  PIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENLDKYIGNRAQSIRGL 70

Query: 53  SSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELS 112
             +  + P   G +  W+    +W + +FN    D  +++  + H L+ +E+ +T+ +  
Sbjct: 71  --LRLQHPMNRGVVDNWDDMELLW-WHIFN----DTLNVQNIEEHPLLITEAPLTIEKQR 123

Query: 113 KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSK 172
               + +FE +   SL+ +  +V   +           SG                    
Sbjct: 124 HIMCERLFETFNIPSLYVANPSVLSLYA----------SGNTTGC--------------- 158

Query: 173 EPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLL----K 228
                            V+D G       P+ +G     +++K+++GGR +T  L    +
Sbjct: 159 -----------------VVDCGDGYCSSTPIYEGFVLPASIRKMEVGGRDITEHLQFQIR 201

Query: 229 ETLSFRHYNMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVR 288
           ++     Y+  +E  +V  IKEK  ++S                     DF  S   Y  
Sbjct: 202 KSSGISLYSS-NEKEIVRTIKEKVCYISE--------------------DFNKSEESYYL 240

Query: 289 HPNEEDSP--LPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVR 346
             +E      LP D + +TL  E F  PE  F+P++  +    +     ES+S +   +R
Sbjct: 241 RQDEMSCKFKLP-DGKELTLNKERFRSPEVLFNPQLMGLENENVSAMCFESISKVDLELR 299

Query: 347 PLMIGNIVCTGGNFNLPNFAQRLARELQ 374
           P +  NI+ TGG+     F  RL  +LQ
Sbjct: 300 PKLFSNILLTGGSTLFKGFGSRLLGDLQ 327

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 89/415 (21%), Positives = 166/415 (40%), Gaps = 88/415 (21%)

Query: 36  KFGTSYLSNHIKNIKDISS----VTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDL 91
           K GT  L  +I N   I+S     +   P   GQ+  W+     W+  +F       +  
Sbjct: 98  KRGTEDLDFYIGNEALIASQGPSYSLSYPIRHGQIENWDHMERFWENSIFK------YLR 151

Query: 92  KEGKGHHLVASESCMTLPELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTIS 151
            E + H  + +E  +  PE  +   ++ FE +    L+                      
Sbjct: 152 AEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLY---------------------- 189

Query: 152 GKDEDADVAISDSDDKTFTSKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYK 211
                  V    +   ++TS +  D + +         VIDSG   T +IPV +G     
Sbjct: 190 -----IAVQAVLALAASWTSSQVTDRSLTGT-------VIDSGDGVTHVIPVAEGYVIGS 237

Query: 212 AVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNIKEKCLFVSP--TSYFDSFKSKN 268
           A+K + I GR +T  ++  L  R     D ++     IK++  +V P     F+ F  + 
Sbjct: 238 AIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAERIKQEYCYVCPDIVKEFNKFDRQP 295

Query: 269 KHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEI--SQII 326
           +   ++++ +              +D    T  + + +  E F  PE FF+PEI  S  +
Sbjct: 296 EKFAQFIIEN--------------QDK---TKQKVVDIGYERFLAPEIFFNPEIASSDFL 338

Query: 327 KPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVS 386
            P +   +  ++   P  VR  +  NIV +GG+    +F++RL R+++  + +    N +
Sbjct: 339 TP-LPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRRLQRDIKSIVNSRIIQNEA 397

Query: 387 V----------------PEGDCTLFGWEVMSQFAKTESYQRARVTREEYYEHGPD 425
           V                 + +   FG  +++Q A+ +SY     T+++Y E+GP+
Sbjct: 398 VTGVKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCH---TKKDYEEYGPE 449

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 86/406 (21%), Positives = 160/406 (39%), Gaps = 84/406 (20%)

Query: 41  YLSNHIKNIKDISSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLV 100
           Y+ N        ++ +   P   GQ+  W+     W+  +F       +   E + H  +
Sbjct: 108 YIGNEALTASQGANYSLNYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFL 161

Query: 101 ASESCMTLPELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVA 160
            +E  +  PE  +   ++ FE +    L+                             V 
Sbjct: 162 LTEPPLNPPENREQVAEIFFESFNCAGLY---------------------------IAVQ 194

Query: 161 ISDSDDKTFTSKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGG 220
              +   ++TS + VD + +         VIDSG   T +IPV +G     A+K + I G
Sbjct: 195 AVLALAASWTSSKVVDRSLTGT-------VIDSGDGVTHVIPVAEGYVIGSALKNIPIAG 247

Query: 221 RFLTGLLKETLSFRHYNMMDETI-LVNNIKEKCLFVSP--TSYFDSFKSKNKHVLEYVLP 277
           R +T  ++  L  R    +D ++     IK++  +V P     F+ F    +   +YV+ 
Sbjct: 248 RDITQFIQSLL--RERGEVDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDAEKFAQYVVE 305

Query: 278 DFQTSFIGYVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEI--SQIIKPGIVEAIL 335
           +              +D    T  + + +  E F  PE FF+PEI  S  + P +   + 
Sbjct: 306 N--------------QDK---TRQKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVLD 347

Query: 336 ESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQ----------RQLPTDWTCNV 385
           +++   P  VR  +  NIV +GG+    +F +RL R+L+           +L    +  V
Sbjct: 348 QTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAETERLSGARSTGV 407

Query: 386 SV------PEGDCTLFGWEVMSQFAKTESYQRARVTREEYYEHGPD 425
            V       + +   FG  +++Q  + + Y     T+++Y E+GP+
Sbjct: 408 DVQVISHRKQRNAVWFGGSLLAQTPEFKGYCH---TKKDYEEYGPE 450

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 115/257 (44%), Gaps = 44/257 (17%)

Query: 190 VIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D ++     I
Sbjct: 210 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAERI 267

Query: 249 KEKCLFVSP--TSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQSITL 306
           K++  +V P     F+ F    +   ++V+ + ++                 T  + + +
Sbjct: 268 KQEYCYVCPDIVKEFNKFDRDGEKFAQFVVENQES-----------------TRKKIVDV 310

Query: 307 TDELFTIPETFFHPEI--SQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPN 364
             E F  PE FF+PEI  S  + P +   + +++   P  VR  +  NIV +GG+    +
Sbjct: 311 GYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKD 369

Query: 365 FAQRLARELQ----------RQLPTDWTCNVSV------PEGDCTLFGWEVMSQFAKTES 408
           F +RL R+L+            L    +  V+V       + +   FG  +++Q A+ + 
Sbjct: 370 FGRRLQRDLKGIVNNRIAQSEMLSGTKSTGVNVQVISHRKQRNAVWFGGSLLAQTAEFKG 429

Query: 409 YQRARVTREEYYEHGPD 425
           Y     T+++Y E+GP+
Sbjct: 430 YCH---TKKDYDEYGPE 443

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 68/155 (43%), Gaps = 9/155 (5%)

Query: 286 YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEA----ILESLSML 341
           ++R P   DS    +   + +  E   +PE  F P +    + GI E     I +     
Sbjct: 594 FLRGPRPHDSENIHEQHQMHINVERIRVPEVMFQPILGGQDQAGITEICETIITKKFGST 653

Query: 342 PEIVRPL---MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWE 398
           P  +      M  N+   GGN  +P    R+ +E    LP+D   NV++ E   TL  W 
Sbjct: 654 PRNLSQQSLDMAKNVWLVGGNAQVPGLKSRVVKEFTEFLPSDTKINVNISEA-PTLDVWN 712

Query: 399 VMSQFAKTES-YQRARVTREEYYEHGPDWCTKHRF 432
            M + A TE  YQR  VT EEY E G D+  +H+ 
Sbjct: 713 GMYRLANTEEDYQRTIVTSEEYDECGVDYLKEHKL 747

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 116/257 (45%), Gaps = 44/257 (17%)

Query: 190 VIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D ++     I
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKI 262

Query: 249 KEKCLFVSP--TSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQSITL 306
           K++  +V P     F+ F        ++V+              N+E     T  + + +
Sbjct: 263 KQEYCYVCPDIVKEFNKFDRDPSKFAQFVV-------------ENQEK----TRRKVVDI 305

Query: 307 TDELFTIPETFFHPEI--SQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPN 364
             E F  PE FF+PEI  S  + P +   + +++   P  VR  +  NIV +GG+    +
Sbjct: 306 GYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKD 364

Query: 365 FAQRLAREL---------QRQLPT---DWTCNVSV----PEGDCTLFGWEVMSQFAKTES 408
           F +RL R+L         Q +L +       +VSV     + +   FG  +++Q A+ + 
Sbjct: 365 FGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKG 424

Query: 409 YQRARVTREEYYEHGPD 425
           Y     T+++Y E+GP+
Sbjct: 425 YCH---TKKDYEEYGPE 438

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 115/257 (44%), Gaps = 44/257 (17%)

Query: 190 VIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D ++     I
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKI 262

Query: 249 KEKCLFVSP--TSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQSITL 306
           K++  +V P     F+ F        ++V+              N+E     T  + + +
Sbjct: 263 KQEYCYVCPDIVKEFNKFDRDPSKFAQFVV-------------ENQEK----TRRKVVDI 305

Query: 307 TDELFTIPETFFHPEI--SQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPN 364
             E F  PE FF+PEI  S  + P +   + +++   P  VR  +  NIV +GG+    +
Sbjct: 306 GYERFLAPEIFFNPEIASSDFLTP-LPMVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKD 364

Query: 365 FAQRLARELQRQLPTDWT------------CNVSV----PEGDCTLFGWEVMSQFAKTES 408
           F +RL R+L+  + +                +VSV     + +   FG  +++Q A+ + 
Sbjct: 365 FGRRLQRDLKSIVNSRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKG 424

Query: 409 YQRARVTREEYYEHGPD 425
           Y     T+++Y E+GP+
Sbjct: 425 YCH---TKKDYEEYGPE 438

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 111/258 (43%), Gaps = 46/258 (17%)

Query: 190 VIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R    +D ++     I
Sbjct: 214 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLKTAERI 271

Query: 249 KEKCLFVSP--TSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQSITL 306
           K++  +V P     F+ F        ++++                 ++   T  + + +
Sbjct: 272 KQEYCYVCPDIVKEFNKFDRDVGKFSQFII-----------------ENQGKTQKKIVDV 314

Query: 307 TDELFTIPETFFHPEI--SQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPN 364
             E F  PE FF+PEI  S  + P +   +  ++   P  VR  +  NIV +GG+    +
Sbjct: 315 GYERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYSNIVLSGGSTMFKD 373

Query: 365 FAQRLARELQRQLPTDWTCNVSVPEG-----------------DCTLFGWEVMSQFAKTE 407
           F +RL R+L R +  D      +  G                 +   FG  +++Q A+ +
Sbjct: 374 FGRRLQRDL-RSIVNDRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAQTAEFK 432

Query: 408 SYQRARVTREEYYEHGPD 425
           SY     T+ +Y E+GP+
Sbjct: 433 SYCH---TKRDYEEYGPE 447

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 71/154 (46%), Gaps = 19/154 (12%)

Query: 296 PLPTDAQSIT------LTDELFTIPETFFHPEIS---QIIKPGIVEAILESLSMLPEIVR 346
           P P D +SI       +  E   +PE  F P +    Q   P + E +L  L       R
Sbjct: 592 PRPHDGESIHHQHQMHMNIERIRVPEVLFQPNMGGEDQAGIPELCETLL--LRKFGSTQR 649

Query: 347 PL------MIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVM 400
            L      M  N+  TGGN  LP   +R+ +E    LP+    ++   + D +L  W  M
Sbjct: 650 QLSDVSTSMAQNVWITGGNAKLPGLRERIVKEFSEFLPSGSPFSIRKSQ-DPSLDAWRGM 708

Query: 401 SQFAK-TESYQRARVTREEYYEHGPDWCTKHRFG 433
           ++ A+ TE ++   +T++EY E+GP++  +H  G
Sbjct: 709 AKLAQNTEDFKHGYITKQEYLEYGPEYIKEHNLG 742

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 77/156 (49%), Gaps = 9/156 (5%)

Query: 286 YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVE----AILESLSML 341
           ++R P   DS    +   + +  E   +PE  F P +    + GI+E     +L+     
Sbjct: 595 FLRGPRPFDSENSHEQHQMHMNIERPRVPEILFQPRMGGCDQAGIIELSETMLLKKFGSK 654

Query: 342 PEIVR---PLMIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWE 398
           P  +      M  N+  TGG+  LP    R+ +E    LP D   +V++ +   +L  W+
Sbjct: 655 PSKLSDQAEAMAKNVWITGGHAQLPGLKTRIVKEFTSFLPNDAKFSVNISKH-PSLDAWK 713

Query: 399 VMSQFAKTES-YQRARVTREEYYEHGPDWCTKHRFG 433
            M++F+  ++ ++ + ++++EY E+GP++  +HR G
Sbjct: 714 GMAKFSSDDADFKSSLISKKEYEEYGPEYIKEHRLG 749

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 27/56 (48%)

Query: 180 SNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH 235
           +N D H   LV       T +IP++ G P     K+++ GG    G L + ++ ++
Sbjct: 175 ANTDKHSSGLVFGLNNQDTNVIPIIDGKPVLTDTKRINWGGSQSVGYLSDLMTLKY 230

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 91/438 (20%), Positives = 166/438 (37%), Gaps = 98/438 (22%)

Query: 5   PIVIDNGSYEIKFGPSTNKMPFRAL-----------NALAKDKFGTSYLSNHIKNIKDIS 53
           PIVIDNGS  IK G S  + P +AL             + +   G +++ N  + ++ + 
Sbjct: 14  PIVIDNGSGIIKVGFSGEERP-KALEYSLVGHVKYEKVMLEGLQGDTFVGNKAQKLRGL- 71

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P   G +  W+    IW Y L      +   L+  + H L+ +E+ M   +  +
Sbjct: 72  -LRLRYPMTHGVVEDWDSMELIWSYMLN-----EVLQLQNIEEHPLLITEAPMNPLKNRE 125

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
              QV+FE +   +L+ S  AV   +           SG+                    
Sbjct: 126 VMAQVLFETFNLPALYISNPAVLSLYA----------SGRTTGC---------------- 159

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                           V+D G      +P+  G     ++ ++DIGGR +T    E L F
Sbjct: 160 ----------------VVDCGEGYCSTVPIYDGFALPASIMRMDIGGRDIT----EQLQF 199

Query: 234 RHYNMM-------DETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGY 286
           +             E  +V  IKEK  +++     +  +    H       D  + F   
Sbjct: 200 QLRKSAGISLFSSSELEVVRMIKEKVCYLAKNIKKEEDRYLQGH------HDLGSVF--- 250

Query: 287 VRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVR 346
                     LP D + I + ++ +  PE  F P+I      G+ +  ++S+  +   +R
Sbjct: 251 ---------KLP-DGKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLR 300

Query: 347 PLMIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSV---PEGDCTLFGWEVMSQF 403
             ++ +I+ +GG   L  F +R+  +L+    +  TC + +   PE   T   W   S  
Sbjct: 301 KTLLSSIILSGGTTTLRGFGERMLHDLEAL--SKGTCKIKIIAPPERKYTT--WVGGSIL 356

Query: 404 AKTESYQRARVTREEYYE 421
               ++Q+    + ++ E
Sbjct: 357 TGLSTFQKLWTKKSDWLE 374

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 81/387 (20%), Positives = 152/387 (39%), Gaps = 89/387 (22%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP----FRALNALAKDKF------GTSYLSNHIKNIKDISS 54
           PIVIDNGS  IK G S  + P    +  +     DK       G +++ N  + ++ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEERPKALEYSLVGHTKYDKVMLEGLQGDTFVGNKAQKLRGL-- 71

Query: 55  VTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P + G +  W+    IW Y L          L+  + H L+ +E+ M   +  + 
Sbjct: 72  LRLRYPMKHGVVEDWDSMELIWSYVLNEV-----LQLQNIEEHPLLITEAPMNPLKNREM 126

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEP 174
             QV+FE +   +++ S  AV   +           SG+                     
Sbjct: 127 IAQVMFETFNLSAIYVSDPAVLSLYA----------SGRTTGC----------------- 159

Query: 175 VDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFR 234
                          V+D G      +P+  G     ++ ++DIGG    G + E L F+
Sbjct: 160 ---------------VVDCGEGYCSSVPIYDGFALPASIMRMDIGG----GDITEQLQFQ 200

Query: 235 HYNMMDETI-------LVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYV 287
                  ++       +V  IKEK  +++     D+ K ++K++      D  ++F    
Sbjct: 201 IRKSAGVSLFSSSEREIVRTIKEKVCYLAK----DAKKEEDKYL--QGTQDLISAF---- 250

Query: 288 RHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRP 347
                    LP D +SI + ++ +  PE  F P+I      G+    ++S+  +   +R 
Sbjct: 251 --------KLP-DGKSIEVGNDRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRK 301

Query: 348 LMIGNIVCTGGNFNLPNFAQRLARELQ 374
            ++ +++ +GG   L  F  R+  +L+
Sbjct: 302 NLLSSVILSGGTTTLKGFGDRMLHDLE 328

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 84/383 (21%), Positives = 151/383 (39%), Gaps = 81/383 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP----FRALNALAKDKF------GTSYLSNHIKNIKDISS 54
           PIVIDNGS  IK G S  + P    +  +     DK       G +++ N  + ++ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHAKYDKVMLEGLQGDTFVGNKAQRLRGLLR 73

Query: 55  VTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           + +  P E G +  W+    IW + L      +   L+  + H L+ +E+ M   +  + 
Sbjct: 74  LQY--PIEHGVVEDWDSMELIWAHILN-----EVLQLQNIEEHPLLITEAPMNPLKNREV 126

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEP 174
             QV+FE +   +L+ S  AV   +           SG+                     
Sbjct: 127 MAQVLFETFNLPALYVSNPAVLSLYA----------SGRTTGC----------------- 159

Query: 175 VDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFR 234
                          VID G      +P+  G     ++ ++DIGGR +T  L+  L   
Sbjct: 160 ---------------VIDCGEGYCSTVPIYDGFALPASMMRMDIGGRDITKQLQFQLRKS 204

Query: 235 HYNMM---DETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPN 291
               +    E  +V  IKEK  +++     D  K +N ++ E    D  + F        
Sbjct: 205 AGVSLFSSSEREIVRTIKEKVCYLAT----DIKKEENTYMQES--QDLTSVF-------- 250

Query: 292 EEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIG 351
                LP D + I + ++ +  PE  F P+I      G+ +  ++S+  +   +R  ++ 
Sbjct: 251 ----KLP-DGKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLS 305

Query: 352 NIVCTGGNFNLPNFAQRLARELQ 374
           +I+ +GG   L  F  R+  +L+
Sbjct: 306 SIILSGGTTTLRGFGDRMLHDLE 328

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 89/428 (20%), Positives = 163/428 (38%), Gaps = 88/428 (20%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP-----FRALNALAKDKFGT-----SYLSNHIKNIKDISS 54
           P+++DNGS  IK G + ++ P         N LA+    T     +Y+ N     +  ++
Sbjct: 12  PVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGNSAYERR--AT 69

Query: 55  VTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +    P+    +  W+    +WDY L N  E +   L+E   H +V + S  T  +  + 
Sbjct: 70  LHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIE--QLQE---HPVVLTNSMSTSKKEEEK 124

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEP 174
             +V+FE++   +++ S   +      S  G  RT                         
Sbjct: 125 MCEVLFEKFSIPAIYCSRDPIM-----SLYGLGRTTG----------------------- 156

Query: 175 VDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFR 234
                           +  G     I  V+ G+    + +  + GG  +T  + + L   
Sbjct: 157 --------------CSVSCGHRGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLDLLRHN 202

Query: 235 H---YNMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPN 291
           H    N  +   L+ +IKE+C  +S   Y          +  Y L   +TS   Y R P 
Sbjct: 203 HPKLENGQNGIELIRSIKERCCVLSKDFY--------NEIRAYELITSKTSNNKY-RLP- 252

Query: 292 EEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIG 351
                   D   I +  E F  PE  F+P+     +  + + I+ S+S    + R  ++ 
Sbjct: 253 --------DGNIIEIGSERFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLE 304

Query: 352 NIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPE--------GDCTLFGWEVMSQF 403
           +IV +GG+  +  F +RL +E+++++  +    ++ P         G   L G   M   
Sbjct: 305 SIVLSGGSSLIKGFGERLTKEIRKEIDGNQKIMLNAPHERRFLPWIGGSVLSGLSTMKLL 364

Query: 404 AKTESYQR 411
            K++S  R
Sbjct: 365 WKSKSAYR 372

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 79/388 (20%), Positives = 153/388 (39%), Gaps = 91/388 (23%)

Query: 5   PIVIDNGSYEIKFGPSTNKMPFRAL-----------NALAKDKFGTSYLSNHIKNIKDIS 53
           P+VIDNGS  IK G S  + P +AL             + +   G +++ N+ + ++ + 
Sbjct: 14  PVVIDNGSGIIKAGFSGEERP-KALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGL- 71

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P + G +  W+    IW Y L          L+    H L+ +E+ M   +  +
Sbjct: 72  -LKLRYPIKHGVVEDWDSMELIWSYVLNEV-----LQLQNIGEHPLLITEAPMNPLKNRE 125

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
              QV+FE ++  +L+ S  AV   +           SG+                    
Sbjct: 126 QMAQVLFETFDVSALYVSNPAVLSLYA----------SGRTTGC---------------- 159

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                           V+D G      +P+  G     ++ ++DIGG  +T    E L F
Sbjct: 160 ----------------VVDCGEGYCSTVPIYDGFALPASMMRMDIGGADIT----EQLQF 199

Query: 234 RHYNMMDETI-------LVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGY 286
           +       ++       +V  +KEK  +++      + K + +  L+    D  ++F   
Sbjct: 200 QLRKSAGVSLFSSSEREIVRTMKEKVCYLAK-----NIKKEEEKYLQGT-QDLISTF--- 250

Query: 287 VRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVR 346
                     LP D + I + ++ +  PE  F P+I  +   G+ +  ++S+  +   +R
Sbjct: 251 ---------KLP-DGRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLR 300

Query: 347 PLMIGNIVCTGGNFNLPNFAQRLARELQ 374
             ++ +I+ +GG   L  F  R+  +L+
Sbjct: 301 KPLLSSIILSGGTTTLKGFGDRMLWDLE 328

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 83/430 (19%), Positives = 168/430 (39%), Gaps = 78/430 (18%)

Query: 5   PIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISS--------VT 56
           P+V+DNGS  +K G S ++ P      +A        ++  +++   + +        + 
Sbjct: 13  PVVLDNGSAILKAGFSGDETPAILEYTMAGKPRYKKVMTTGLEDRTFVGNEAQRLRGLLA 72

Query: 57  FRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHAD 116
            RRP   G++T W+    +W +  ++  +    + + G  H L+ +E+ +   +  +   
Sbjct: 73  LRRPISRGEVTNWDDMELLWSHIFYSKLQLGQGNSQIGD-HPLLITEAPLNSTKNRETMC 131

Query: 117 QVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVD 176
           ++++E + FD+L+ +  AV   +           +G+                       
Sbjct: 132 EILYETFNFDALYVAHPAVLSLYA----------TGQTTGC------------------- 162

Query: 177 ETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLL----KETLS 232
                        V++ G   +   PV +G     +++++DIGGR +T  L    +++  
Sbjct: 163 -------------VLECGEGYSASTPVYQGFALPSSIRRIDIGGRDITQELQFYIRKSTG 209

Query: 233 FRHYNMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNE 292
              ++  ++ I V  IKEK  +V+    F+  K                    +  H  E
Sbjct: 210 LSLFSNSEQEI-VRTIKEKANYVALDYKFEEEK--------------------FFIHERE 248

Query: 293 EDSPLPT-DAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIG 351
             S +   D Q +T     +   E  F P++       + E +LES++ +   +R  ++ 
Sbjct: 249 NTSTVKLPDGQELTFGKGKYRTSEILFQPQLIGSECVSVPEMLLESINKVDMDLRTQLLE 308

Query: 352 NIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQR 411
           NIV +GG   L  F QR   E ++ LP      +     + +   W   S  +    ++ 
Sbjct: 309 NIVLSGGTTMLKGFDQRTMSETKKMLPKHTKVKIR-SLAERSYIAWIGGSILSGLYGFRN 367

Query: 412 ARVTREEYYE 421
             +TRE Y E
Sbjct: 368 LWLTREMYEE 377

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 104/249 (41%), Gaps = 30/249 (12%)

Query: 190 VIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGR----FLTGLLKETLSFRHYNMMDETILV 245
           VID G  C   +PV  G     A++++D+ GR    FL  LL+++      +  +  I V
Sbjct: 158 VIDCGDGCCQSVPVYDGFTLPSAIQRIDVAGRDITEFLQLLLRKSSGVTLSSSSEREI-V 216

Query: 246 NNIKEKCLFVSP--TSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQS 303
             IKEK  FV+    +   +++  N   LE       T F             LP D + 
Sbjct: 217 RMIKEKACFVATDVGNEEQNYEGANSAELE-------TRF------------KLP-DGKI 256

Query: 304 ITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLP 363
           +TL  E F  PE  F P +       I E   +S+S +   +R  +  +IV +GG+    
Sbjct: 257 LTLGAEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLRSSLYSSIVLSGGSTMFS 316

Query: 364 NFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYYEHG 423
            F  RL  E+++    +    +  P  +     W   S  A   ++++  VTR E+ E+ 
Sbjct: 317 GFGDRLLSEIRKTSEPNTKIKIFAPP-ERKYSTWIGGSILAGLSTFEKLWVTRAEWQEN- 374

Query: 424 PDWCTKHRF 432
              C   RF
Sbjct: 375 -PQCIHSRF 382

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 82/393 (20%), Positives = 153/393 (38%), Gaps = 84/393 (21%)

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
           S +   P   GQ+  W+     W+  +F       +   E + H+ + +E  +  PE  +
Sbjct: 105 SYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHYFLLTEPPLNPPENRE 158

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
              ++ FE +    L+                             V    +   ++TS +
Sbjct: 159 QVAEIFFESFNCAGLY---------------------------IAVQAVLALAASWTSSK 191

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
            VD + +         VIDSG   T +IPV +G     A+K + I GR +T  ++  L  
Sbjct: 192 VVDRSLTGT-------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL-- 242

Query: 234 RHYNMMDETI-LVNNIKEKCLFVSP--TSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHP 290
           R     D T+     IK++  +V       F+ F   ++   ++++ + +          
Sbjct: 243 RERGEEDTTLRTAERIKQEYCYVCSDIVKEFNKFDRDSEKFAQFIVENSEK--------- 293

Query: 291 NEEDSPLPTDAQSITLTDELFTIPETFFHPEI--SQIIKPGIVEAILESLSMLPEIVRPL 348
                   T  + I +  E F  PE FF+PEI  S  + P +   + +++   P  VR  
Sbjct: 294 --------TRRKVIDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKG 344

Query: 349 MIGNIVCTGGNFNLPNFAQRLARELQ----------RQLPTDWTCNVSVP------EGDC 392
           +  NIV +GG+    +F +RL R+L+            L    +  V V       + + 
Sbjct: 345 LYNNIVLSGGSTMFKDFGRRLQRDLKGIVNNRIALSEHLSGTKSTGVDVQVISHRRQRNA 404

Query: 393 TLFGWEVMSQFAKTESYQRARVTREEYYEHGPD 425
             FG  ++++ A+   Y     ++++Y E GP+
Sbjct: 405 VWFGGSLLAETAEFRGYCH---SKQDYEEIGPE 434

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 93/442 (21%), Positives = 169/442 (38%), Gaps = 84/442 (19%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP----FRALNALAKDKFGTSYLSNHIKNI-----KDISSV 55
           P+V+DNGS  IK G S  + P    +  +     DK     LS+  + +     K    +
Sbjct: 11  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSSRGQLVGNEAQKQRGLL 70

Query: 56  TFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHA 115
             + P E G +  W     +W +  ++  + +         H ++ +E+ +   E     
Sbjct: 71  RLQYPVEHGIVQDWSGLEQLWTHVFYSSLKLNNIG-----DHPMLVTEAPLNPLENRDKM 125

Query: 116 DQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPV 175
            ++++E +   +++ S  AV   +        RT                          
Sbjct: 126 CEMLYETFNVPAVYVSIQAVLALYAGG-----RTTG------------------------ 156

Query: 176 DETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGR----FLTGLLKETL 231
                         VID G  C   +PV  G     A++++D+ GR    FL  LL++++
Sbjct: 157 -------------CVIDCGDGCCQSVPVYDGFSIPSAIRRIDVAGRDVTEFLQLLLRKSI 203

Query: 232 SFRHYNMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPN 291
                +  +  I V  IKEK  +V+P    +  K  +    E +     T F        
Sbjct: 204 GVTLLSSSEREI-VRMIKEKACYVAPEVAAEEQKYASSRGSEEL-----TKF-------- 249

Query: 292 EEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIG 351
                LP D + ++L  E F  PE  F P++       I +   +S+S +   +R  +  
Sbjct: 250 ----KLP-DGKILSLGAEKFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYS 304

Query: 352 NIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNV-SVPEGDCTLFGWEVMSQFAKTESYQ 410
           ++V +GG+     F  RL  EL+ +   +    + + PE   ++  W   S  A   +++
Sbjct: 305 SLVLSGGSTLFAGFGDRLLNELRSRCEPNVKIKIFAPPERKYSV--WIGGSILAGLSTFE 362

Query: 411 RARVTREEYYEHGPDWCTKHRF 432
           +  VTR E+ E+    C   RF
Sbjct: 363 KIWVTRSEWQEN--PQCVHSRF 382

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 89/403 (22%), Positives = 147/403 (36%), Gaps = 92/403 (22%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP----FRALNALAKDKF-------GTSYLSNHIKNIKDIS 53
           PIVIDNG+  IK G +    P    +  +     DK          S++ N  +  + I 
Sbjct: 14  PIVIDNGTNVIKGGFTGETKPRCLEYSIVGTPKYDKIMQSNGIESDSFIGNKAQKYRGI- 72

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P   G +  W+    IW Y +F+    D   L+    H ++ +E  +      +
Sbjct: 73  -LKLRHPMLRGVVQNWDDMETIWQY-VFD----DTLYLENLNEHPILITEPPLNNMANRQ 126

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
              + +FE + F +++ S   V   +           SG+     V   D  D   TS  
Sbjct: 127 KMCEALFEIFGFPAVYISVSPVLSLYA----------SGQTTGCAV---DCGDGYCTS-- 171

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLT-----GLLK 228
                                      IPV  G     +VKK+DIGG  +T      +LK
Sbjct: 172 ---------------------------IPVYNGFSLASSVKKIDIGGCDITEQLQFSILK 204

Query: 229 ETLSFRHYNMMDETILVNNIKEKCLFVSPTSYFDSFK---SKNKHVLEYVLPDFQTSFIG 285
            T  F + +   E  +V  IKEK  +++     ++ K   ++ K   ++ LPD       
Sbjct: 205 NTGLFMYSS--SEREIVRTIKEKVCYIATDYNLETEKYLFNEEKMASQFKLPD------- 255

Query: 286 YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIV 345
                           + + ++   +T  E  F PE+       + E   +S+  +   +
Sbjct: 256 ---------------GKMLNISQGKYTSTEILFRPELIGSEFDSLPEICYQSIKKVDSDL 300

Query: 346 RPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVP 388
           R  +  NIV +GG    P F  RL +ELQ     D    +  P
Sbjct: 301 RLPLYSNIVLSGGTTMCPGFGSRLLKELQTLTGYDTKIRIIAP 343

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 72/156 (46%), Gaps = 9/156 (5%)

Query: 286 YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLS----ML 341
           ++R P   DS    +   + L  E   +PE  F P I    + GI E     LS      
Sbjct: 591 FLRGPRPHDSENIHEQHQLHLNVERIRVPEILFQPIIGGQDQAGISELCETILSNKFGSK 650

Query: 342 PEIVRPLMIG---NIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWE 398
           P  +    +G   NI  TGG+  LP   +R+ +E    LP      V + + + +L  W 
Sbjct: 651 PRELSETSLGMAKNIWLTGGHSKLPGLRERIVKEFTGFLPVGTKLGVKMSK-NPSLDAWY 709

Query: 399 VMSQFAKTES-YQRARVTREEYYEHGPDWCTKHRFG 433
            M + A+ E+ Y+ + +++++Y E+G ++  +H+ G
Sbjct: 710 GMRKLAQNEADYKDSIISKKDYEEYGAEYIKEHKLG 745

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 88/434 (20%), Positives = 166/434 (38%), Gaps = 94/434 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNKMP----FRALNALAKDKFGTS------YLSNHIKNIKDISS 54
           PIV+DNGS  +K G   +  P    +  +     DK          ++ N  +  + +  
Sbjct: 13  PIVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVEKGKFVGNLAQEYRGL-- 70

Query: 55  VTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P + G +  WE    +WD+ +F     D   +     H LV +E+ +      + 
Sbjct: 71  LKLRYPMDHGIIENWEHMETVWDH-IFK----DCLKVSNLGEHPLVVTEAPLNPKPNREK 125

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEP 174
             + +FE +   +L+ +  AV   +           SG+                     
Sbjct: 126 MCETLFESFNIPALYIANPAVLSLYA----------SGRTTGC----------------- 158

Query: 175 VDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFR 234
                          V+++G      +P+ +G     +++++DIGGR +T  L+  L  R
Sbjct: 159 ---------------VVEAGDGYCSSVPIYEGFALTPSIRRIDIGGRDITKHLQ--LQLR 201

Query: 235 HYNMM-----DETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRH 289
               M      E  +V  IKE   ++          S +K   E  L D +   I +   
Sbjct: 202 KSTGMWLYSSSEQEIVRLIKENGCYIC---------SNHKKEEEKFLLDQEKKSISF--- 249

Query: 290 PNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLM 349
                  LP D +++ +    F  PE  F+P +       + + I++S+S +   +R  +
Sbjct: 250 ------KLP-DGKNLVIGPGRFRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLRSKL 302

Query: 350 IGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSV---PEGDCTLF-GWEVMSQFAK 405
           + NI  +GG+     F  RL  EL      D T  V +   PE   + F G  +++  + 
Sbjct: 303 LNNITLSGGSTMFQGFCDRLITEL--DFSVDKTTKVRILAPPERKYSAFIGGSILANLS- 359

Query: 406 TESYQRARVTREEY 419
             +++   VT++++
Sbjct: 360 --TFRNMWVTKDQW 371

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 67/146 (45%), Gaps = 6/146 (4%)

Query: 292 EEDSPLPT----DAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRP 347
           EE +P+P+    ++     T++    P    +P  S +I PGIV+ I  S+      +R 
Sbjct: 356 EEPTPVPSKEGEESTPSDKTNDSGKRPMESENPTESSVI-PGIVDLIESSIMATDVDLRA 414

Query: 348 LMIGNIVCTGGNFNLPNFAQRLARELQRQLPT-DWTCNVSVPEGDCTLFGWEVMSQFAKT 406
            +  NIV TGG   +P F+ RL  EL ++LP   +    +    +     W   S  +  
Sbjct: 415 SLAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKFRVLTTGQTRERQYQAWLGGSILSSL 474

Query: 407 ESYQRARVTREEYYEHGPDWCTKHRF 432
            ++ +  V ++EY E G D   K RF
Sbjct: 475 GTFHQLWVGKQEYEESGADRLLKDRF 500

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%)

Query: 189 LVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH 235
           LV+D G D   + PV+ G+   K+  +  I GRF+   +KE L  R 
Sbjct: 173 LVVDIGHDVASVSPVIDGMTLSKSSMRNFISGRFINEKIKEFLKPRE 219

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (46%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPT-DWTCNVSV 387
           GIV+ I +S+      +R  +  N+V TGG   +P  + R+  EL + LP   +    S 
Sbjct: 415 GIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKFRMLSSG 474

Query: 388 PEGDCTLFGWEVMSQFAKTESYQRARVTREEYYEHGPDWCTKHRF 432
              +    GW   S  A   ++ +  V REEY E GP+   K RF
Sbjct: 475 HLRERQYQGWLGGSILASLGTFHQLWVGREEYEEVGPERLLKDRF 519

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 57/144 (39%), Gaps = 17/144 (11%)

Query: 189 LVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILVNNI 248
           LV+D G D + + PV+ G+   K+  +  + G++L  L+ + L  R         +   +
Sbjct: 156 LVVDIGHDVSTVSPVIDGMTLSKSSTRNYVAGKYLNHLIAKNLKPREI-----VPIFQVL 210

Query: 249 KEKCLFVSPTSYFD------------SFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSP 296
           K+K  FV  T  FD             F  + K  L ++ P   +SF   +    +    
Sbjct: 211 KKKPDFVKRTLSFDVNESVINFANERQFFQEFKETLLHIAPKSLSSFKDELATQTKRSLE 270

Query: 297 LPTDAQSITLTDELFTIPETFFHP 320
            P   + I   D  ++  E  F P
Sbjct: 271 APWGEELIFDADTRYSFAEQLFRP 294

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 55/125 (44%), Gaps = 2/125 (1%)

Query: 309 ELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQR 368
           E   +P+     +I  II PGI + +  +++     +R  +  N++ TGG   +P  A R
Sbjct: 472 ENVDVPKKSDKKDIDNII-PGIADLVEATVNSSDVDLRATLAHNVILTGGTSLIPGLADR 530

Query: 369 LARELQRQLPT-DWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYYEHGPDWC 427
           L  EL ++LP   +    S    +     W   S      ++ +  V + EY E GPD  
Sbjct: 531 LMYELNKKLPALKFRILSSGHRRERKYQAWLGGSILTSLGTFHQLWVGKREYEEVGPDRL 590

Query: 428 TKHRF 432
            K RF
Sbjct: 591 LKDRF 595

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 37/183 (20%), Positives = 64/183 (34%), Gaps = 47/183 (25%)

Query: 53  SSVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELS 112
           S    +R  E G +  W++    W + L      D F     KG   + +E      +  
Sbjct: 157 SDYQVKRIIENGMVADWDIAEEQWSWALREKLYMDSF-----KGIPALLTEPVWNTVQNR 211

Query: 113 KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSK 172
           K + +V+ E+ EF++ + + +   V F     GK                          
Sbjct: 212 KKSLEVLLEKMEFEACYLTTIPTNVSFAA---GKPNC----------------------- 245

Query: 173 EPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232
                           LV+D G D   + PV+ G+   K+V++    GR+L  LL+  + 
Sbjct: 246 ----------------LVVDVGHDTCSVSPVIDGMTLTKSVRRNFFAGRYLNRLLENYIK 289

Query: 233 FRH 235
            R 
Sbjct: 290 PRE 292

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 47/105 (44%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPT-DWTCNVSV 387
           G+ + I  S+      +R  +  N+V TGG  +LP    R++ EL R LP   +    S 
Sbjct: 374 GLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELNRSLPALKFRMLTSG 433

Query: 388 PEGDCTLFGWEVMSQFAKTESYQRARVTREEYYEHGPDWCTKHRF 432
              +    GW   S  A   ++ +  V ++EY E G D   K RF
Sbjct: 434 QLRERQYQGWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 478

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 60/277 (21%), Positives = 102/277 (36%), Gaps = 59/277 (21%)

Query: 88  GFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKM 147
           G   K+ + H++V +   +   +  K  D  I  E  F++    P  +  P   S + + 
Sbjct: 62  GLPRKDYEIHNIVQNGEVVDWEKAEKQWDWAIRSELRFETNSGMPALLTEPIWNSEENRK 121

Query: 148 RTISGKDEDADVA----ISDSDDKTFTSKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPV 203
           +++    E  D +    +  +   +F    P              LV+D G D T + PV
Sbjct: 122 KSLEVLLESMDFSACYLVPTATAVSFAMGRPT------------CLVVDIGHDVTSVCPV 169

Query: 204 LKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--------------------------- 236
           + G+   K+  +  I G  L  L++  L+ R                             
Sbjct: 170 VDGMTLSKSSMRSYIAGSLLNELIRSQLAPRKVIPLFQVAQRRPVFMERKFDYEIHPSLQ 229

Query: 237 NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSP 296
             ++E       KE  L V+PTS    FKS           + +T+    +  P  E+  
Sbjct: 230 KFVNERQFFQEFKETMLQVAPTS-ISKFKS-----------EIETTSKRSIEAPWGEE-- 275

Query: 297 LPTDA-QSITLTDELFTIPETFFHPEISQIIKPGIVE 332
           L  D+ Q +   ++LFT P+    PE   I K G+VE
Sbjct: 276 LVYDSLQRLEFAEQLFT-PDLSQFPEDWPISKDGVVE 311

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 71/325 (21%), Positives = 120/325 (36%), Gaps = 82/325 (25%)

Query: 189 LVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLT-----------------------G 225
           LV+D G D   + PV+ G+ + K+ ++  I G++L                         
Sbjct: 179 LVVDIGHDIISVSPVVDGMTFSKSTRRNVISGKYLNVLINDFLKPREIVPLFEIKQRKPT 238

Query: 226 LLKETLSFRHYNMM----DETILVNNIKEKCLFVSPTSYFDSFK------SKNKHVL--- 272
           L+K+T  F  ++ +    ++  +   IKE    VSP S  + +K      SK K+     
Sbjct: 239 LVKKTFDFPIHDSLKTYANDRGIYQEIKEALCRVSPNSSLEKYKPELEKMSKRKYETLWN 298

Query: 273 ---------------------EYVLP-DFQTSFIGYV----------------------R 288
                                E  +P D+ TS  G V                      +
Sbjct: 299 EDIVFDNETIYGFGEQLFIPKENDIPVDWNTSKDGIVETWHNDYIPLKRNKPAGTVKTDK 358

Query: 289 HPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPL 348
              EE +P   +A     T++    P      E  +II PGIV+ I  S++     +R  
Sbjct: 359 EATEELTPAVDNATPSEDTNDNGKRPIGNEGEEKEKII-PGIVDLIESSINAADVDLRTS 417

Query: 349 MIGNIVCTGGNFNLPNFAQRLARELQRQLPT-DWTCNVSVPEGDCTLFGWEVMSQFAKTE 407
           +  N+V TGG   +P  + R+  EL ++LP   +    +    +     W   S  +   
Sbjct: 418 LAHNVVLTGGTSCIPGLSDRILLELNKRLPALKFRVLANGQTRERQYQSWLGGSILSSLG 477

Query: 408 SYQRARVTREEYYEHGPDWCTKHRF 432
           ++ +  V ++EY E G D     RF
Sbjct: 478 TFHQLWVGKQEYEEIGADRLLTDRF 502

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/242 (22%), Positives = 85/242 (35%), Gaps = 55/242 (22%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKN-IKDISSVTFRRP 60
           E   IVID GSY    G S +  P   + +       T+   N  K  +    S+   RP
Sbjct: 11  EITSIVIDPGSYTTNIGYSGSDCPESIIPSSYGQYKDTAKEENQKKTKVFSEQSIGLARP 70

Query: 61  H-------ELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113
                   E G++  W+     WD+ L N        LK   G  ++ +E      E  K
Sbjct: 71  DYEIKRIVENGEIADWDTAQEQWDWVLKNE-----LFLKSNSGIPVLLTEPIWNSVENRK 125

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173
            + +V+ E  +F++ + SPV+  V F                                  
Sbjct: 126 KSLEVLLEGMDFEACYLSPVSTCVSFAAGRPN---------------------------- 157

Query: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                          LV+D G D T + PV+ G+   K+  +  I GR++  L++  L  
Sbjct: 158 --------------CLVVDIGHDTTSVSPVIDGMTLSKSSTRNFIAGRYINHLIETYLKP 203

Query: 234 RH 235
           R 
Sbjct: 204 RE 205

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 43/105 (40%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPT-DWTCNVSV 387
           GI + +  S+      +R  +  N+V TGG   +P    RL  EL ++LP   +    + 
Sbjct: 410 GIADLVQRSILDSDVDLRASLAHNVVITGGTSCIPRLNDRLMYELSKRLPALKFRILTTG 469

Query: 388 PEGDCTLFGWEVMSQFAKTESYQRARVTREEYYEHGPDWCTKHRF 432
              +     W   S      ++ +  V +EEY E G D     RF
Sbjct: 470 HLREKQYQAWLGGSILTSLGTFHQLWVGKEEYKEVGADRLLVDRF 514

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 94/464 (20%), Positives = 149/464 (32%), Gaps = 134/464 (28%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPFRAL-NALAKDKFGTSYLSNHIKNIKDI---SSVTF 57
           E   +VID GS+    G S    P   L +     K   +   +  K+   +    S+TF
Sbjct: 13  EITAVVIDPGSFTTNIGYSGTDCPQAILPSCYGHHKTNENADGDDEKSKPKVFAEQSLTF 72

Query: 58  RRPH-------ELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPE 110
            RP        E G +  W+     WD+ L N        L+  KG   + +ES     E
Sbjct: 73  PRPDYEIKPIVENGLVVDWDAAQEQWDWALRNV-----LHLESNKGVPALMTESIWNTME 127

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFT 170
               + +V+ E  +F++ + S     V F                               
Sbjct: 128 NKTKSLEVLLETLDFEACYISSTPTCVSFATGRPN------------------------- 162

Query: 171 SKEPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                             LV+D G D     PV+ G+   ++ ++  I G+F+  L+ + 
Sbjct: 163 -----------------CLVVDVGHDTASSSPVVDGMTLSRSTRRNFISGKFVDQLIGKY 205

Query: 231 LSFRH---------------------------YNMMDETILVNNIKEKCLFVSPTSYFDS 263
           L  R                            YN  +E       KE    ++PT+  D 
Sbjct: 206 LQPREIIPLFEIAQRRPEFKKKNFEFNIDPSLYNFANERGFFQECKETLCQIAPTT-LDK 264

Query: 264 FK----SKNKHVLEYVLPD-------FQTSFIGYVRHPNEEDSP--LPTDAQSITLTDEL 310
           FK    S  K  +E    +        +  F   + +P  ED P   P     I  T   
Sbjct: 265 FKPELESTAKRSIEAPWTEEIVFDNPSRYGFAEQLFYPQSEDIPEGWPVSKDGIVETWHN 324

Query: 311 FTIPETFFHPEISQIIKP-----------------------------------GIVEAIL 335
             +P     P  S+  KP                                   GI + + 
Sbjct: 325 DYVPLKRNKPSGSKPEKPNGEETPSGEDQASTSETTNEHGKRPMEDSESSELAGISDLVH 384

Query: 336 ESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPT 379
            S++     +R  +  NIV TGG+ ++P F+ RL  EL ++LP 
Sbjct: 385 SSITSADVDLRATLAHNIVLTGGSSSVPGFSDRLMNELTKKLPA 428

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 59/142 (41%), Gaps = 13/142 (9%)

Query: 286 YVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVE---AIL------E 336
           ++R P   DS        + L  E   +PE  F P +    + GI+E    IL      E
Sbjct: 591 FLRGPRPHDSEDIHQQHQMHLNVERIRVPEILFQPSMGGQDQAGIIELCETILTKKFGSE 650

Query: 337 SLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFG 396
              + P  +   M  N+  TGGN  LP   +R+ +E    LP     NV     + +L  
Sbjct: 651 QRKLSPTAL--AMANNLWITGGNSKLPGMKERIVKEFTGFLPVGTAFNVK-QSYNPSLDA 707

Query: 397 WEVMSQFA-KTESYQRARVTRE 417
           W  M++    +E Y+   ++++
Sbjct: 708 WNGMAKLTLNSEDYKNTIISKK 729

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 189 LVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH 235
           LVID G + T +IPV++G       K+++ GGR     L + L+ ++
Sbjct: 183 LVIDCGNEETDVIPVVEGAGMLTDAKRINWGGRQAVDYLNDLLTLKY 229

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 1/89 (1%)

Query: 345 VRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPT-DWTCNVSVPEGDCTLFGWEVMSQF 403
           +R  +  NIV TGG  ++P F+ RL  EL ++LP   +    +    +     W   S  
Sbjct: 391 LRATLAHNIVLTGGTSSIPGFSDRLMSELNKKLPALKFRILTTGHLRERQYQAWLGGSIL 450

Query: 404 AKTESYQRARVTREEYYEHGPDWCTKHRF 432
               S+ +  V ++EY E GPD     RF
Sbjct: 451 TSLGSFHQLWVGKQEYEEVGPDRLLSDRF 479

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 46/105 (43%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPT-DWTCNVSV 387
           G+ + I  S+      +R  +  N+V TGG+ ++P    R+  EL + LP   +    S 
Sbjct: 375 GLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPALKFRMLTSG 434

Query: 388 PEGDCTLFGWEVMSQFAKTESYQRARVTREEYYEHGPDWCTKHRF 432
              +     W   S  A   ++ +  V ++EY E G D   K RF
Sbjct: 435 QAREKQYQSWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 479

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 67/171 (39%), Gaps = 41/171 (23%)

Query: 189 LVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH------------- 235
           LV+D G D T + PV+ G+   K+  +  I G  L  L++ +L  R              
Sbjct: 156 LVVDIGHDITSVSPVIDGMTLSKSSMRSFIAGGLLNELIRTSLKPREILPLFQVAKKRPE 215

Query: 236 --------------YNMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQT 281
                          N ++E       KE  L V+PTS    FKS+ + + +        
Sbjct: 216 FVKRSFDYEIHPSLLNFVNERQFFQEFKETMLQVAPTS-LTKFKSELEQLSKR------- 267

Query: 282 SFIGYVRHPNEEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVE 332
                +  P  ED    ++ +   + ++LF  PET   PE   I K G+VE
Sbjct: 268 ----SIEAPWGEDLVFDSETR-FNIAEQLFR-PETAKFPEDWPISKDGVVE 312

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 49/237 (20%), Positives = 86/237 (36%), Gaps = 58/237 (24%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTF-RRP 60
           E   +VID GSY    G S +  P   L ++    +G        KNI    S+   R+ 
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGKKNIFSEQSIGIPRKD 68

Query: 61  HEL------GQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +EL      G +  W+     W + L N        L    G   + +E      E  K 
Sbjct: 69  YELKPIVKDGLVIDWDTAQEQWQWALKNE-----LYLNSNSGTPALLTEPVWNSTENRKK 123

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEP 174
           + +V+ E  +F++ + +P +  V F           +G+                     
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFA----------AGRPN------------------- 154

Query: 175 VDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                         LV+D G D   + P++ G+   K+ ++  + G+F+  L+K+ L
Sbjct: 155 -------------CLVVDIGHDTCSVSPIVDGMTLSKSTRRNFLAGKFINHLIKKAL 198

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 46/108 (42%), Gaps = 7/108 (6%)

Query: 329 GIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPT----DWTCN 384
           G+   +  S+      +R  +  N+V TGG   +P  + RL  EL + LP+      T  
Sbjct: 384 GLAHLVYSSIMSSDVDLRATLAHNVVLTGGTSLIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 385 VSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYYEHGPDWCTKHRF 432
            ++     +  G  +++      ++ +  V ++EY E G +     RF
Sbjct: 444 HTMERQYQSWLGGSILTSLG---TFHQLWVGKKEYEEVGVERLLNDRF 488

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 48/105 (45%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPT-DWTCNVSV 387
           G+ + +  +++     +R  +  N+V TGG+ ++P    RL  EL ++LP   +    S 
Sbjct: 376 GLADLVNTAITATDVDLRATLAHNLVVTGGSSSIPGLTDRLMTELNKKLPALKFRILTSG 435

Query: 388 PEGDCTLFGWEVMSQFAKTESYQRARVTREEYYEHGPDWCTKHRF 432
              +     W   S  +   ++ +  V R+EY E G +   K RF
Sbjct: 436 HLRERQSRAWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 48/239 (20%), Positives = 79/239 (33%), Gaps = 53/239 (22%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPFRALNAL-----AKDKFGTSYLSNHIKNIKDISSVT 56
           E   +VID GSY    G S    P   + +      A  K G    ++    I       
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQLNIPSCYGQYTAGGKEGQKSFNDQFM-IMPRPDFE 71

Query: 57  FRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHAD 116
            +R  E G +  WE     W + + +  +F+ F     KG     +E+     E  K + 
Sbjct: 72  IKRILENGCVVDWEAAQEQWAWAIRDELKFESF-----KGTPAFLTEAIWNPEENRKKSL 126

Query: 117 QVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVD 176
           +V+ E  EF++ + +P A    F                                     
Sbjct: 127 EVLLEGMEFEACYIAPTATCTSFAMG---------------------------------- 152

Query: 177 ETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH 235
                       LV+D G D   + PV+ G+   K+  +  + G+ L  L++  L  R 
Sbjct: 153 --------RPTCLVLDIGHDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIENHLKPRE 203

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 49/237 (20%), Positives = 86/237 (36%), Gaps = 58/237 (24%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTF-RRP 60
           E   +VID GSY    G S +  P   L ++    +G S      K I    S+   R+ 
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKSTSDKDSKTIFSEQSIGIPRKD 68

Query: 61  HEL------GQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +EL      G +  W+     W + L N    D        G   + +E      E  K 
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALKNELYLDS-----NSGIPALLTEPVWNSTENRKK 123

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEP 174
           + +V+ E  +F++ + +P +  V F           +G+                     
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFA----------AGRPN------------------- 154

Query: 175 VDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                         LV+D G D   + P++ G+   K+ ++  I G+F+  L+K+ +
Sbjct: 155 -------------CLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAI 198

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 45/105 (42%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPT-DWTCNVSV 387
           G+ + +  S+      +R  +  N+V TGG  ++P  + RL  EL + LP+  +    + 
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 388 PEGDCTLFGWEVMSQFAKTESYQRARVTREEYYEHGPDWCTKHRF 432
              +     W   S      ++ +  V ++EY E G D     RF
Sbjct: 444 HTRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGVDRLLNDRF 488

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 328 PGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPT 379
           PGIV+ I  S+S     +R  +  N+V TGG+  +P  + R+  EL  + P 
Sbjct: 387 PGIVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPA 438

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%)

Query: 189 LVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH 235
           L++D G D   + PV+ G+   K+ +     GRFL  LL + L  R 
Sbjct: 168 LIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPRE 214

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 37.0 bits (84), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 49/237 (20%), Positives = 85/237 (35%), Gaps = 58/237 (24%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTF-RRP 60
           E   +VID GSY    G S +  P   L ++    +G        K I    S+   R+ 
Sbjct: 13  EVSAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGNKKIFSEQSIGIPRKD 68

Query: 61  HEL------GQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +EL      G +  W+     W + L N        L    G   + +E      E  K 
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALQNE-----LYLNSNSGIPALLTEPVWNSTENRKK 123

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEP 174
           + +V+ E  +F++ + +P +  V F           +G+                     
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFA----------AGRPN------------------- 154

Query: 175 VDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                         LV+D G D   + P++ G+   K+ ++  I G+F+  L+K+ L
Sbjct: 155 -------------CLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAL 198

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 48/108 (44%), Gaps = 7/108 (6%)

Query: 329 GIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPT----DWTCN 384
           G+ + +  S+      +R  +  N+V TGG  ++P  + RL  EL + LP+      T  
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 385 VSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYYEHGPDWCTKHRF 432
            ++     +  G  +++      ++ +  V ++EY E G +     RF
Sbjct: 444 HTIERQYQSWLGGSILTSLG---TFHQLWVGKKEYEEVGVERLLNDRF 488

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 44/105 (41%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPT-DWTCNVSV 387
           G+ + I  S+      +R  +  N+V TGG  ++P    R+  EL + LP   +    S 
Sbjct: 392 GLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNKSLPALKFRMLTSG 451

Query: 388 PEGDCTLFGWEVMSQFAKTESYQRARVTREEYYEHGPDWCTKHRF 432
              +     W   S  +   ++ +  V ++EY E G     K RF
Sbjct: 452 HLKERQYQSWLGGSILSSLGTFHQLWVGKQEYEEVGASRLLKDRF 496

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 1/89 (1%)

Query: 345 VRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPT-DWTCNVSVPEGDCTLFGWEVMSQF 403
           +R  +  N+V TGG+ ++   A RL  EL ++LP   +    S    +     W   S  
Sbjct: 392 LRATLAHNLVVTGGSSSILGLADRLMTELNKKLPALKFRILTSGHLRERQSRAWLGGSIL 451

Query: 404 AKTESYQRARVTREEYYEHGPDWCTKHRF 432
           +   ++ +  V R+EY E G +   K RF
Sbjct: 452 SSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 49/240 (20%), Positives = 82/240 (34%), Gaps = 55/240 (22%)

Query: 2   EAPPIVIDNGSYEIKFG------PSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSV 55
           E   +VID GSY    G      P  N +P         +K G    ++    +      
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQIN-IPSSYGQYTGGEKEGKKSFNDQFMGMAR-PDF 70

Query: 56  TFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHA 115
             +R  E G +  WE     W + + +  +F  F     KG     +E+     E  K +
Sbjct: 71  EIKRILEDGCVVDWEAAQEQWTWAIRDELKFGSF-----KGTPAFLTEAIWNSEENRKKS 125

Query: 116 DQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPV 175
            +V+ E  EF++ + +P A  V                              +F    P 
Sbjct: 126 LEVLLEGMEFEACYIAPTATCV------------------------------SFAMGRPT 155

Query: 176 DETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH 235
                        LV+D G D   + PV+ G+   K+  +  + G+ L  L+++ L  R 
Sbjct: 156 ------------CLVVDIGHDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIEKHLEPRE 203

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 47/113 (41%), Gaps = 1/113 (0%)

Query: 321 EISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPT- 379
           EI++    G+ + +  S+      +R  +  N+V TGG   +P  + RL  EL  +LP  
Sbjct: 372 EITKGSLLGVADLVHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELNSRLPAL 431

Query: 380 DWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYYEHGPDWCTKHRF 432
            +    +    +     W   S      ++ +  V +EEY + G D     RF
Sbjct: 432 KFRMITTGHTRERQYQSWLGGSVLTSLGTFHQLWVGKEEYQDVGVDRLLADRF 484

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 38/84 (45%), Gaps = 2/84 (2%)

Query: 342 PEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEG-DCTLFGWEVM 400
           PE +   ++ NIV TG    +P   QR+  EL  Q P     + + P   D  L  W+  
Sbjct: 333 PEQIHAALLTNIVITGSTSLVPGVEQRIVNELSYQFPQYKLSSFANPMVLDRKLQSWQGG 392

Query: 401 SQFAKTESYQRAR-VTREEYYEHG 423
              +   S++    +TR+EY  +G
Sbjct: 393 VTMSNLPSWELGNWITRQEYDANG 416

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 47/237 (19%), Positives = 86/237 (36%), Gaps = 58/237 (24%)

Query: 2   EAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTF-RRP 60
           E   +VID GSY    G S +  P   L ++    +G      + K +    S+   R+ 
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKLTADENSKKMFSEQSIGIPRKD 68

Query: 61  HEL------GQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +EL      G +  W+     W + L N    D        G   + +E      E  K 
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALRNELYLDS-----NSGIPALLTEPVWNSMENRKK 123

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEP 174
           + +V+ E  +F++ + +P +  V F           +G+                     
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFA----------AGRPN------------------- 154

Query: 175 VDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                         LV+D G D   + P++ G+   K+ ++  I G+F+  L+++ L
Sbjct: 155 -------------CLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIQKAL 198

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%)

Query: 345 VRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPT 379
           +R  +  N+V TGG  ++P  + RL  EL + LP+
Sbjct: 399 LRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPS 433

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 345 VRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLP 378
           +R  +  N+V TGG+ ++P  + RL  EL R+LP
Sbjct: 408 LRASLAHNVVLTGGSSSIPGLSDRLILELNRRLP 441

>KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12406 Saccharomyces cerevisiae
           YPR034W ARP7 Actin-related protein involved in
           transcriptional regulation subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 399

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 45/210 (21%), Positives = 87/210 (41%), Gaps = 20/210 (9%)

Query: 189 LVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILVNNI 248
           LV+D G   + + P++ G     AV +    G FL   + E L+       +E    NN 
Sbjct: 138 LVVDVGAAKSTVTPIIDGTVVQTAVARSKFAGDFLDMQVNELLTKIAPIKDEEEGDPNNR 197

Query: 249 KEKCLFV--SPTSYFDSFKSKNKHVLEYVLPDFQTSFIG-----YVRH--PNEEDSPLPT 299
           K+  L +  +  ++   FK+    V    L D  ++ +      Y+++    ++ +   T
Sbjct: 198 KDPSLTLWRNSRTWIQEFKTYMLQVAPSRLQDLDSAALDMMGLTYIKNFLLQKQKTISLT 257

Query: 300 DAQSITLTDELF---TIPETFFHPE-ISQIIKPGIVEAILESLSML-------PEIVRPL 348
             Q   L + LF   ++ + F   E +S+I+   + +A   + +         PE     
Sbjct: 258 QKQCCELAEGLFQPRSVSQQFVAAEGLSEIVAKSVKKAGASTATSSSATNVTTPEQTHAA 317

Query: 349 MIGNIVCTGGNFNLPNFAQRLARELQRQLP 378
           ++ NI+ TG +  +    QR+  +L  Q P
Sbjct: 318 LLTNILITGSSSLISGLEQRIVNDLSYQFP 347

>Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {ON}
           YPR034W (ARP7) - actin related protein, subunit of the
           chromatin remodeling Snf/Swi complex [contig 35] PARTIAL
          Length = 351

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 46/214 (21%), Positives = 82/214 (38%), Gaps = 32/214 (14%)

Query: 189 LVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILVNNI 248
           L++D G     + PV+ G     A+ +    G FL   + + LS +      E       
Sbjct: 94  LIVDLGAAKATVTPVIDGTVVQAAIGRSRFAGDFLDLQVGKLLSEKDDKQNGEESHEPTP 153

Query: 249 KEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFI-----GYVRHPNEEDSPLPTDAQS 303
            E  L+ +  ++   FKS    V    L D  ++ +      YV++       L    ++
Sbjct: 154 LE--LWRNSRTWIQDFKSYMLQVAPSKLQDLDSAALDMMGLSYVKNF------LYRRQKT 205

Query: 304 ITLTD-ELFTIPETFFHPE-----------ISQIIKPGIVEAILESL-------SMLPEI 344
           I+L   E   + E  F P            +S+I+   + +A   +        +  PE 
Sbjct: 206 ISLMQKECCALAEGLFQPSYVSQQFASSEGLSEIVAKAVKKAGASTATNSSATNATTPEQ 265

Query: 345 VRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLP 378
           +   ++ NIV TG +  +P   QR+  +L  Q P
Sbjct: 266 IHAALLTNIVITGSSSLIPGLEQRIVNDLSYQFP 299

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 43/105 (40%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPT-DWTCNVSV 387
           G+ + +  S+      +R  +  N+  TGG   +P  + RL  EL  +LP   +    + 
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELNARLPALKFRILTTG 459

Query: 388 PEGDCTLFGWEVMSQFAKTESYQRARVTREEYYEHGPDWCTKHRF 432
            + +     W   S      ++ +  V R+EY E G D     RF
Sbjct: 460 HKKEREYQSWLGGSVLTSLGTFHQLWVGRQEYEEVGADRLLNDRF 504

>TPHA0E00640 Chr5 complement(113447..116662) [3216 bp, 1071 aa] {ON}
            Anc_7.436 YPR030W
          Length = 1071

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 73/182 (40%), Gaps = 41/182 (22%)

Query: 17   FGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRR--------PHELGQLTL 68
            F   TN    RA+       F    LS+H+   KD+SS+   R        P  L   + 
Sbjct: 897  FASPTNSPRMRAM-------FSNDDLSDHLSLSKDVSSLNLNRTGEFVSTNPFHLNYSSN 949

Query: 69   WELESCI-----------WDYCLFNPSEFDGFD---LKEGKGHHLVASES--CMTLPELS 112
             ++ S +            D  L +P + DG D   +K G    LVA +   C+  P+  
Sbjct: 950  TDIASMVKSSQQFTTFDNLDDLLGSPKK-DGIDENLVKSGDSDSLVAIDVPYCLYSPDKK 1008

Query: 113  KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSK 172
            K   ++   E + + LFKS  + F P     KG   ++SG DE     +     K+FT  
Sbjct: 1009 K---KLTINESQPEGLFKSDYS-FKP-----KGSNHSLSGSDEIYHEVLGPDLKKSFTKS 1059

Query: 173  EP 174
            +P
Sbjct: 1060 DP 1061

>CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034w ARP7
           Actin-like protein
          Length = 529

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 339 SMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLP 378
           ++ PE V  L++ N++ TGG   +    QR+ REL  + P
Sbjct: 433 NITPEHVYSLLLTNVIITGGTSLIDGMEQRIIRELSIRFP 472

>KNAG0G02680 Chr7 (600934..602760) [1827 bp, 608 aa] {ON} Anc_8.699
           YPL169C
          Length = 608

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 56/135 (41%), Gaps = 14/135 (10%)

Query: 83  PSEFDGFDLKEGKGHHLVASESC--MTLPELSKHADQVIFEEYEFD---------SLFKS 131
           PS  DG D     G++L  S +C  ++ P+L +    + FE              SL +S
Sbjct: 321 PSTVDGADQNPSFGYYLPVSRNCTKVSTPKLLQERLSIGFEAIGAAFQSIPKTKHSLLES 380

Query: 132 PV--AVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNSNNDYHDFQL 189
           P   ++ V       G   T+ G+ ++ D  ++D+ +K    K  V       +    + 
Sbjct: 381 PTDYSMEVLAFPQVSGFTVTLHGEFQETDKPLADTINKQVNKKSYVGRNKKYGNNTTNKR 440

Query: 190 VIDSGFDCTW-IIPV 203
           +    FD TW IIPV
Sbjct: 441 LSKKSFDRTWVIIPV 455

>ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR034W
           (ARP7)
          Length = 401

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 34/85 (40%), Gaps = 2/85 (2%)

Query: 339 SMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEG-DCTLFGW 397
           S  PE +   ++ N+V  GG   L    QRL  +L  Q P       + P   D  L  W
Sbjct: 313 SATPEQIHAALLTNVVIIGGTSLLQGLEQRLVNDLSLQFPQYKLSTYATPAHVDRQLQSW 372

Query: 398 EVMSQFAKTESYQRAR-VTREEYYE 421
           +          ++    VT++EY E
Sbjct: 373 QGGVNMCHLPDWKLGSWVTKQEYLE 397

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,990,599
Number of extensions: 2426325
Number of successful extensions: 8360
Number of sequences better than 10.0: 162
Number of HSP's gapped: 8337
Number of HSP's successfully gapped: 241
Length of query: 438
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 325
Effective length of database: 40,524,141
Effective search space: 13170345825
Effective search space used: 13170345825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)