Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_10.1688.256ON1220122057430.0
Skud_12.1528.256ON1220122146140.0
Smik_12.1438.256ON1220122044750.0
YLR084C (RAX2)8.256ON1220122044470.0
NCAS0B049808.256ON1204120925880.0
NDAI0B023808.256ON1219121325760.0
TDEL0F038308.256ON1195120824020.0
ZYRO0C01804g8.256ON1209120523120.0
KAFR0B026908.256ON1210120822750.0
Kpol_392.108.256ON1226121521880.0
SAKL0H17204g8.256ON1211122421800.0
TPHA0B032508.256ON1215121220980.0
KNAG0G020008.256ON1202122619750.0
TBLA0E043908.256ON1278126619660.0
KLTH0G13838g8.256ON1214122217680.0
Kwal_56.235898.256ON1213122117560.0
CAGL0L12144g8.256ON1156118717450.0
AGR095W8.256ON1201123717310.0
KLLA0F18975g8.256ON1200123317260.0
Ecym_43158.256ON1212125016530.0
ZYRO0G12276g5.164ON53265810.67
KLTH0F04598g1.174ON938124745.8
Smik_10.1541.279ON33259727.9
ZYRO0A13354g8.560ON82262729.4
Skud_10.1261.279ON33859719.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_10.168
         (1220 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] ...  2216   0.0  
Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] ...  1781   0.0  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...  1728   0.0  
YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}...  1717   0.0  
NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {...  1001   0.0  
NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {...   996   0.0  
TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {...   929   0.0  
ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} simil...   895   0.0  
KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {...   880   0.0  
Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON} (27006.....   847   0.0  
SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} sim...   844   0.0  
TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8....   812   0.0  
KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {...   765   0.0  
TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa]...   761   0.0  
KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} sim...   685   0.0  
Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] ...   681   0.0  
CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 a...   676   0.0  
AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic h...   671   0.0  
KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa...   669   0.0  
Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar ...   641   0.0  
ZYRO0G12276g Chr7 complement(969552..971150) [1599 bp, 532 aa] {...    36   0.67 
KLTH0F04598g Chr6 (406984..407006,407069..409862) [2817 bp, 938 ...    33   5.8  
Smik_10.154 Chr10 (260576..261574) [999 bp, 332 aa] {ON} YJL088W...    32   7.9  
ZYRO0A13354g Chr1 complement(1053647..1056115) [2469 bp, 822 aa]...    32   9.4  
Skud_10.126 Chr10 (236807..237823) [1017 bp, 338 aa] {ON} YJL088...    32   9.7  

>Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score = 2216 bits (5743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1126/1220 (92%), Positives = 1126/1220 (92%)

Query: 1    MFVHRXXXXXXXXXXXGSKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALS 60
            MFVHR           GSKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALS
Sbjct: 1    MFVHRLWTLALPLLTLGSKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALS 60

Query: 61   FYEYTGQQNFTKEIGSETNSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSG 120
            FYEYTGQQNFTKEIGSETNSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSG
Sbjct: 61   FYEYTGQQNFTKEIGSETNSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSG 120

Query: 121  SINGVPLGNQVLYNLSTLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGAL 180
            SINGVPLGNQVLYNLSTLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGAL
Sbjct: 121  SINGVPLGNQVLYNLSTLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGAL 180

Query: 181  VWDSTSNTTQLLPFGGFGEDSNVNSIVKLNDDNILFAGKFYXXXXXXXXXXXXXXXXXXX 240
            VWDSTSNTTQLLPFGGFGEDSNVNSIVKLNDDNILFAGKFY                   
Sbjct: 181  VWDSTSNTTQLLPFGGFGEDSNVNSIVKLNDDNILFAGKFYTLDDSSILTTSSTNTTNAS 240

Query: 241  XXXXXXXXELGQRIPLRYASWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPYE 300
                    ELGQRIPLRYASWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPYE
Sbjct: 241  STLNATTLELGQRIPLRYASWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPYE 300

Query: 301  VAPTKIRLYNSPNSDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLL 360
            VAPTKIRLYNSPNSDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLL
Sbjct: 301  VAPTKIRLYNSPNSDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLL 360

Query: 361  SASQNVSSSLDMISFIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGL 420
            SASQNVSSSLDMISFIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGL
Sbjct: 361  SASQNVSSSLDMISFIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGL 420

Query: 421  ELYQDTFSTYANNSLNEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTP 480
            ELYQDTFSTYANNSLNEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTP
Sbjct: 421  ELYQDTFSTYANNSLNEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTP 480

Query: 481  TVTFYPSIIHPGHYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNL 540
            TVTFYPSIIHPGHYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNL
Sbjct: 481  TVTFYPSIIHPGHYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNL 540

Query: 541  KYDKIYSGYLDFSPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRH 600
            KYDKIYSGYLDFSPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRH
Sbjct: 541  KYDKIYSGYLDFSPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRH 600

Query: 601  TPLNGILQYQRSNFTATTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNH 660
            TPLNGILQYQRSNFTATTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNH
Sbjct: 601  TPLNGILQYQRSNFTATTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNH 660

Query: 661  ISVIDFNDNLEVTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVS 720
            ISVIDFNDNLEVTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVS
Sbjct: 661  ISVIDFNDNLEVTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVS 720

Query: 721  NYSKAVENAINITLANNDLIVFNNDYIFNAXXXXXXXXXXXXXXXXXXAGNNDNDDVLFS 780
            NYSKAVENAINITLANNDLIVFNNDYIFNA                  AGNNDNDDVLFS
Sbjct: 721  NYSKAVENAINITLANNDLIVFNNDYIFNASSNSQISNSTSFSLSLWSAGNNDNDDVLFS 780

Query: 781  GAVSQMQFSDLSGSARFLNESTVEALNLNKGIVPYLGAYLNESTIAYAYKTNSLSKIYFX 840
            GAVSQMQFSDLSGSARFLNESTVEALNLNKGIVPYLGAYLNESTIAYAYKTNSLSKIYF 
Sbjct: 781  GAVSQMQFSDLSGSARFLNESTVEALNLNKGIVPYLGAYLNESTIAYAYKTNSLSKIYFS 840

Query: 841  XXXXXXXXXXXXITKMVYANNQTLLVIGSESSTTAELSILNLRNFTTIANETLGSNAKIN 900
                        ITKMVYANNQTLLVIGSESSTTAELSILNLRNFTTIANETLGSNAKIN
Sbjct: 841  NNVSPSWNWSNNITKMVYANNQTLLVIGSESSTTAELSILNLRNFTTIANETLGSNAKIN 900

Query: 901  AFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESEL 960
            AFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESEL
Sbjct: 901  AFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESEL 960

Query: 961  IISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSGGKLNSFTVTEESIVAWNDTSLLIYKD 1020
            IISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSGGKLNSFTVTEESIVAWNDTSLLIYKD
Sbjct: 961  IISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSGGKLNSFTVTEESIVAWNDTSLLIYKD 1020

Query: 1021 QKWNTTSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQG 1080
            QKWNTTSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQG
Sbjct: 1021 QKWNTTSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQG 1080

Query: 1081 LLFDSQNWTPYFTSETLEASSYNPTIFINRDVSADFNSQIPLSNSNMTVTXXXXXXXXXX 1140
            LLFDSQNWTPYFTSETLEASSYNPTIFINRDVSADFNSQIPLSNSNMTVT          
Sbjct: 1081 LLFDSQNWTPYFTSETLEASSYNPTIFINRDVSADFNSQIPLSNSNMTVTSPQSTSPLSP 1140

Query: 1141 XXXXXXXXXXXXXXXNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIKP 1200
                           NMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIKP
Sbjct: 1141 SSSASSEPNKKSKKKNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIKP 1200

Query: 1201 RIDENEMLDTVPPEKLMKFV 1220
            RIDENEMLDTVPPEKLMKFV
Sbjct: 1201 RIDENEMLDTVPPEKLMKFV 1220

>Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score = 1781 bits (4614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 887/1221 (72%), Positives = 1011/1221 (82%), Gaps = 2/1221 (0%)

Query: 1    MFVHRXXXXXXXXXXXGSKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALS 60
            MFVHR            SKASQLQ+IK+LLDIEDNVLP+LNISQDN NA+QILGGVDALS
Sbjct: 1    MFVHRLWTLIFPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALS 60

Query: 61   FYEYTGQQNFTKEIGSETNSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSG 120
             YEYTGQQNFTKEI   TNSRGLVYYSNNTYI +E+A +DTRIDKITPFGADSFILSGSG
Sbjct: 61   LYEYTGQQNFTKEISPGTNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSG 120

Query: 121  SINGVPLGNQVLYNLSTLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGAL 180
            +IN +P+GNQ+LYNLSTLSMA IF Q LGSVE+VL+N TSVYFGGNFSYNNGSMTGH AL
Sbjct: 121  TINNMPIGNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSAL 180

Query: 181  VWDSTSNTTQLLPFGGFGEDSNVNSIVKLNDDNILFAGKFYXXXXXXXXXXX-XXXXXXX 239
            +WDS SN TQLLPFGGFGE+SNVNSI+KLNDDNILFAGKFY                   
Sbjct: 181  IWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGSNNTTNS 240

Query: 240  XXXXXXXXXELGQRIPLRYASWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPY 299
                     ELGQRIPLRYA+WD QGSTTFES+ LVCP+ ++DAW+YP TSG+LVC LPY
Sbjct: 241  TSLLNATKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPY 300

Query: 300  EVAPTKIRLYNSPNSDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTL 359
            EV+PTK+RLYNS +SD +IS+FQILTNPS SIMNLTYLDP+SG+L++CDEFCPLYSR TL
Sbjct: 301  EVSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATL 360

Query: 360  LSASQNVSSSLDMISFIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSG 419
            LSASQNVSS +DMISF+DNNNTDVKWSSDFQDFAFANEL VT LKFTA+NSYG  VGLSG
Sbjct: 361  LSASQNVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSG 420

Query: 420  LELYQDTFSTYANNSLNEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPT 479
            LELYQDTFSTYANNSLNEYGCSALANDSSSS LS N WY+GL G+SYIA +YVPNQ +PT
Sbjct: 421  LELYQDTFSTYANNSLNEYGCSALANDSSSSTLSSNSWYNGLGGESYIATEYVPNQDEPT 480

Query: 480  PTVTFYPSIIHPGHYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNN 539
            P V FYP+I+HPGHY INTYTPGCVQD+TCSSRGIVNVTMWNPQN TMM+TY IYQNN+N
Sbjct: 481  PRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDN 540

Query: 540  LKYDKIYSGYLDFSPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKR 599
            LKYD+IYSGYLDFSPEI+++YVSGI+ SNTAT++VADQVN+IT  LD+FS+LSE+ + K 
Sbjct: 541  LKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKE 600

Query: 600  HTPLNGILQYQRSNFTATTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDN 659
            + PLNG+LQYQ+SNFT+TTSN TKI NTTLN+F+VDNYP NSS+FAD    +LILGG +N
Sbjct: 601  YIPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNN 660

Query: 660  HISVIDFNDNLEVTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESV 719
            HIS+I  NDNLEV  SE + IQGDV+GMTQT+QGLLIFGD+ SS+N+S+VL+FNGSFE+V
Sbjct: 661  HISIIGLNDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDLLSSNNQSSVLLFNGSFENV 720

Query: 720  SNYSKAVENAINITLANNDLIVFNNDYIFNAXXXXXXXXXXXXXXXXXXAGNNDNDDVLF 779
             NYS+ V +AINI+LANNDLIVF+NDYI N                   AG+N NDDVLF
Sbjct: 721  FNYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLF 780

Query: 780  SGAVSQMQFSDLSGSARFLNESTVEALNLNKGIVPYLGAYLNESTIAYAYKTNSLSKIYF 839
            SGAVS+MQF  L+GSARFL+E  V+ALNL+  +VPYL AYLNEST AYAY+TN L+KIYF
Sbjct: 781  SGAVSRMQFGGLNGSARFLSEDKVQALNLDNAVVPYLAAYLNESTTAYAYETNLLNKIYF 840

Query: 840  XXXXXXXXXXXXXITKMVYANNQTLLVIGSESSTTAELSILNLRNFTTIANETLGSNAKI 899
                         IT+M+YANNQ+LL +GSESSTTAELSI NL+NFT IANET+GSNAKI
Sbjct: 841  SNNVDPSWNWSTSITRMLYANNQSLLTVGSESSTTAELSIFNLKNFTMIANETMGSNAKI 900

Query: 900  NAFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESE 959
            NA VNFEKNSSLLVGG+FQMSKPNC+GLC+YNYESKSWSTFFNNT  GEITQL+F+  S+
Sbjct: 901  NALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSAASQ 960

Query: 960  LIISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSGGKLNSFTVTEESIVAWNDTSLLIYK 1019
            L+ISGLF TE+ QS+RL SFNLTNSTM+PLLTG+ GK+NSF VTEESIVAWNDTSLLIY+
Sbjct: 961  LVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAWNDTSLLIYR 1020

Query: 1020 DQKWNTTSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQ 1079
            DQ+WN TS+PGN SS+ SV+TI+TN     L +RAT +AE G+ILLL+GNFSIP YGNLQ
Sbjct: 1021 DQEWNITSVPGNDSSIGSVSTINTNAGPGTLNRRATNNAENGTILLLSGNFSIPDYGNLQ 1080

Query: 1080 GLLFDSQNWTPYFTSETLEASSYNPTIFINRDVSADFNSQIPLSNSNMTVTXXXXXXXXX 1139
            GLLFD + W+PYF SE+   S+ NPTIFINRDVS +FNSQIPLSN N+T T         
Sbjct: 1081 GLLFDFETWSPYFVSESSNTSNRNPTIFINRDVSTEFNSQIPLSNLNVTET-GPQSASSQ 1139

Query: 1140 XXXXXXXXXXXXXXXXNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIK 1199
                             +DRGFVVLIGLALALGTVSVLGI GVILAYVFKDPEGDY+PIK
Sbjct: 1140 FPSSSASSELKPKSKKRIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIK 1199

Query: 1200 PRIDENEMLDTVPPEKLMKFV 1220
            PRIDENEMLDTVPPEKLMKFV
Sbjct: 1200 PRIDENEMLDTVPPEKLMKFV 1220

>Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score = 1728 bits (4475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 863/1220 (70%), Positives = 994/1220 (81%)

Query: 1    MFVHRXXXXXXXXXXXGSKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALS 60
            MFVHR            SKASQLQ+IK+LLDIEDNVLP+LNISQ+N NA+QILGGVDA+S
Sbjct: 1    MFVHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAIS 60

Query: 61   FYEYTGQQNFTKEIGSETNSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSG 120
            FY+YTGQQNFTK I   TNS GLVYYSNNTYI LE+A +DTRIDKITPFG DSFILSGSG
Sbjct: 61   FYKYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSG 120

Query: 121  SINGVPLGNQVLYNLSTLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGAL 180
            +IN + +GNQ+LYNLSTLSMA IF QSLG VE VLVNDTSVYFGGNFSYNNGSM GH AL
Sbjct: 121  TINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSAL 180

Query: 181  VWDSTSNTTQLLPFGGFGEDSNVNSIVKLNDDNILFAGKFYXXXXXXXXXXXXXXXXXXX 240
            VWD+ S+T QLLPFGGFGE+SNVNSI+KLNDDNI+FAGKFY                   
Sbjct: 181  VWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLITSSNNGTNST 240

Query: 241  XXXXXXXXELGQRIPLRYASWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPYE 300
                    ELGQRI LRYASWDSQGSTT  S+ LVCP+ + +AWLYP TSGSLVC LPYE
Sbjct: 241  FSLNATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPYE 300

Query: 301  VAPTKIRLYNSPNSDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLL 360
            V+PTKIRLYNS ++ ++I+LFQILTNPS SIMNLTYLDP+SGEL++CDEFCPLYSR TLL
Sbjct: 301  VSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLL 360

Query: 361  SASQNVSSSLDMISFIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGL 420
            +ASQN SSS+DMI+FID NNTDVKWSSDFQDFAFANEL VTSLK  ALNSYG+ +GLSGL
Sbjct: 361  AASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGL 420

Query: 421  ELYQDTFSTYANNSLNEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTP 480
            ELYQ+TFSTYANNSLNEYGCSAL NDSSSSILS+N WY+GLTG+SYIA +Y+P+Q +P P
Sbjct: 421  ELYQNTFSTYANNSLNEYGCSALVNDSSSSILSNNSWYNGLTGESYIATNYIPDQNEPIP 480

Query: 481  TVTFYPSIIHPGHYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNL 540
             V FYP+IIH GHYTINTYTPGCVQDNTCSSRGIVNVT+WNPQNNTMM+TY IYQNN+NL
Sbjct: 481  RVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNL 540

Query: 541  KYDKIYSGYLDFSPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRH 600
            KYD+I+SGYLDFSPEIV++Y+SGIY+SNTAT++VAD+VN+IT SLD+F++LSE  +VKR 
Sbjct: 541  KYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQ 600

Query: 601  TPLNGILQYQRSNFTATTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNH 660
            TPLNGI QYQ+SNFT TTSN TK+ NTTLNLF V+NYPKN+S+  ++Y+ KLI+GG  N 
Sbjct: 601  TPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVSNR 660

Query: 661  ISVIDFNDNLEVTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVS 720
            IS ID N+N E+ SSEN+TIQGDVYG+T+T QGLLI+GD+RSSDN+STVL+FN SF  V 
Sbjct: 661  ISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKVP 720

Query: 721  NYSKAVENAINITLANNDLIVFNNDYIFNAXXXXXXXXXXXXXXXXXXAGNNDNDDVLFS 780
            NYSK V +A NI++A+N+L VF+N+YI NA                  AGNN N DVLFS
Sbjct: 721  NYSKRVNSATNISIADNELFVFDNNYIINASSNAQISNSTSFSLSLWAAGNNGNGDVLFS 780

Query: 781  GAVSQMQFSDLSGSARFLNESTVEALNLNKGIVPYLGAYLNESTIAYAYKTNSLSKIYFX 840
            G VS M+FS+L+GSA F NE  V+ALN+ +GIVPY GAYLNES  AYAY+T++L+KIYF 
Sbjct: 781  GTVSHMEFSNLNGSASFKNEDQVQALNIGRGIVPYFGAYLNESVSAYAYETDALNKIYFS 840

Query: 841  XXXXXXXXXXXXITKMVYANNQTLLVIGSESSTTAELSILNLRNFTTIANETLGSNAKIN 900
                        IT+M+YANNQT+LV+ SESS+TA+L+I NLRN TTIANETLGSNAK++
Sbjct: 841  NKVNPSWNWSNTITRMLYANNQTMLVVSSESSSTADLTIFNLRNMTTIANETLGSNAKVS 900

Query: 901  AFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESEL 960
            A VNFEKNSS+LVGGDFQ++KPNC+GLC+YNYE+KSWSTFFNNTI GE+TQL+  N SEL
Sbjct: 901  ALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSLANSSEL 960

Query: 961  IISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSGGKLNSFTVTEESIVAWNDTSLLIYKD 1020
            IISGLF T + QSIRLGSFNL N TMVPLL+GS GKLNSF VT+ S+VAWNDTSL IY +
Sbjct: 961  IISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTDNSLVAWNDTSLFIYGN 1020

Query: 1021 QKWNTTSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQG 1080
            QKWN TSLP + S + SV+TI TNT S  L KRAT +A  GSILLLNGNF++PQYGNLQ 
Sbjct: 1021 QKWNITSLPSDDSLIGSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTMPQYGNLQS 1080

Query: 1081 LLFDSQNWTPYFTSETLEASSYNPTIFINRDVSADFNSQIPLSNSNMTVTXXXXXXXXXX 1140
            LLFD Q WTPYF SE   +S+YNPT FINRDVS +FNSQI L N N+TVT          
Sbjct: 1081 LLFDFQAWTPYFISEISNSSNYNPTFFINRDVSTEFNSQITLPNLNITVTNPQSTSSQSP 1140

Query: 1141 XXXXXXXXXXXXXXXNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIKP 1200
                            +DRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDY+PIKP
Sbjct: 1141 STSATSESKSKSEKKKIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYKPIKP 1200

Query: 1201 RIDENEMLDTVPPEKLMKFV 1220
            RIDENEMLDTVPPEKLMKFV
Sbjct: 1201 RIDENEMLDTVPPEKLMKFV 1220

>YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}
            RAX2N-glycosylated protein involved in the maintenance of
            bud site selection during bipolar budding; localization
            requires Rax1p; RAX2 mRNA stability is regulated by Mpt5p
          Length = 1220

 Score = 1717 bits (4447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 863/1220 (70%), Positives = 998/1220 (81%)

Query: 1    MFVHRXXXXXXXXXXXGSKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALS 60
            MFVHR            SKASQL++IK+LLDIEDNVLP+LNISQ+N NA+QILGGVDALS
Sbjct: 1    MFVHRLWTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALS 60

Query: 61   FYEYTGQQNFTKEIGSETNSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSG 120
            FYEYTGQQNFTKEIG ET+S GLVYYSNNTYI LE+A +DTRIDKITPFG DSFILSGSG
Sbjct: 61   FYEYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSG 120

Query: 121  SINGVPLGNQVLYNLSTLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGAL 180
            +IN + +GNQ+LYNLSTLSM  IF QSLG+V+AVL +++S+YFGGNFSYNNGSMTG+ AL
Sbjct: 121  TINNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSAL 180

Query: 181  VWDSTSNTTQLLPFGGFGEDSNVNSIVKLNDDNILFAGKFYXXXXXXXXXXXXXXXXXXX 240
            +WDS SNTTQLLPFGGFGE+S+VNSIVKLN+DNILFAG+FY                   
Sbjct: 181  IWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSALISSSNNGTNST 240

Query: 241  XXXXXXXXELGQRIPLRYASWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPYE 300
                    ELGQRIPLRYASWDSQGSTTF S  LVCP+T++DAWLYP TSGSLVC LPYE
Sbjct: 241  SSLNATTLELGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPYE 300

Query: 301  VAPTKIRLYNSPNSDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLL 360
            V+PTKIRLYNS  SD++IS+FQILT+PS SIMNLTYLDP+SGEL++C EFCPLYSR TLL
Sbjct: 301  VSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLL 360

Query: 361  SASQNVSSSLDMISFIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGL 420
            SASQNVSSS+DMI+FIDNN TDVKW+SDFQDFAF NEL V+SLKF ALNSYG  VGLSGL
Sbjct: 361  SASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGL 420

Query: 421  ELYQDTFSTYANNSLNEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTP 480
            ELYQDTFSTYAN+SLNEYGCSAL NDSSSS LS N WY+GLTG+SYIA  YVP+Q +P P
Sbjct: 421  ELYQDTFSTYANDSLNEYGCSALTNDSSSSTLSSNDWYNGLTGESYIAAKYVPDQNEPIP 480

Query: 481  TVTFYPSIIHPGHYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNL 540
             V FYP+IIHPGHYTIN YTPGC+QDNTCS+RGIVNVTMWN QNNT+M+TYLIYQNN+NL
Sbjct: 481  RVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNL 540

Query: 541  KYDKIYSGYLDFSPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRH 600
            KYD+IYSGYLDFSPEIV++YVSGIY +NTAT++VADQVN+IT SLD+F++LS++++ K+ 
Sbjct: 541  KYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKE 600

Query: 601  TPLNGILQYQRSNFTATTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNH 660
            T LNGILQYQ+SNFT+T  N TK+ NTTLNLF V NYPKNSS++AD+YD KL++GG  N 
Sbjct: 601  TLLNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSNR 660

Query: 661  ISVIDFNDNLEVTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVS 720
            IS++D ND+ EVTSS+N+TIQGDV+G+T+TNQGLLIFGD+ SS+N+S V +FNGSFE+V 
Sbjct: 661  ISIVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENVF 720

Query: 721  NYSKAVENAINITLANNDLIVFNNDYIFNAXXXXXXXXXXXXXXXXXXAGNNDNDDVLFS 780
            N S+ V +A+NI+LANND IV +NDY+ NA                  AGNN + DVLFS
Sbjct: 721  NQSRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFS 780

Query: 781  GAVSQMQFSDLSGSARFLNESTVEALNLNKGIVPYLGAYLNESTIAYAYKTNSLSKIYFX 840
            GAVS MQ+ +L+GS RFLNE+ +E LNL  GIVPYLGAYLNES  AYAY+ +SL+KIYF 
Sbjct: 781  GAVSHMQYGNLNGSVRFLNENEIEPLNLEGGIVPYLGAYLNESATAYAYEVDSLNKIYFS 840

Query: 841  XXXXXXXXXXXXITKMVYANNQTLLVIGSESSTTAELSILNLRNFTTIANETLGSNAKIN 900
                        IT+M+YA+NQTLL + + SSTTAELSI +LRN T IANETLGSNA+IN
Sbjct: 841  NEVYPSWNWSSGITQMLYADNQTLLAVSAGSSTTAELSIFDLRNLTMIANETLGSNARIN 900

Query: 901  AFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESEL 960
            A VNFEKN S+LVGGDFQM++PNCTGLC+YNYESK+WSTF NNTI GEITQL+F N SEL
Sbjct: 901  ALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSFTNSSEL 960

Query: 961  IISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSGGKLNSFTVTEESIVAWNDTSLLIYKD 1020
            IISGLF T++ QSIRLGSFNLTNSTM+PLL+GS GKLNSFTVTE+SIVAWNDTSL IY++
Sbjct: 961  IISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTSLFIYRN 1020

Query: 1021 QKWNTTSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQG 1080
            Q+WN TSLPGN SS+SSV+ I T+ +S  L KR   +   GSILLLNGNF+I QYG LQ 
Sbjct: 1021 QEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGNFNISQYGYLQS 1080

Query: 1081 LLFDSQNWTPYFTSETLEASSYNPTIFINRDVSADFNSQIPLSNSNMTVTXXXXXXXXXX 1140
            LLFD Q WTPYF SET   S+YNP IFINRDVS +FNSQ PL+N N+TVT          
Sbjct: 1081 LLFDFQKWTPYFISETTNTSNYNPIIFINRDVSTEFNSQSPLANVNITVTSPQSTSSQPP 1140

Query: 1141 XXXXXXXXXXXXXXXNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIKP 1200
                            + RGFVVLIGLALALGTVSVLGI GVILAYVFKDPEGDY+PIKP
Sbjct: 1141 SSSASSESKSKSKKKKIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKP 1200

Query: 1201 RIDENEMLDTVPPEKLMKFV 1220
            RIDENEMLDTVPPEKLMKFV
Sbjct: 1201 RIDENEMLDTVPPEKLMKFV 1220

>NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1204

 Score = 1001 bits (2588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/1209 (45%), Positives = 780/1209 (64%), Gaps = 30/1209 (2%)

Query: 20   ASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSETN 79
            ASQL S++  L+I    +P+LN++ D DN+ ++LGG+D+LSFY YTGQQNFT  I   +N
Sbjct: 18   ASQLSSLQENLNITHINIPNLNLTTD-DNSFELLGGIDSLSFYRYTGQQNFTSGILPNSN 76

Query: 80   SRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLSTLS 139
            S GL YYSNNT+I L E   D+RI++I PFG+DSFILSG GS+ G  L NQ+L+NLS+ S
Sbjct: 77   SNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFILSGKGSLGGYSLSNQLLFNLSSFS 136

Query: 140  MARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFGGFGE 199
            + +IF Q+L SV ++LV+ T V FGGNF+ +  S+ GH   +W+ T+N+T LLPF GFGE
Sbjct: 137  LKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGE 196

Query: 200  DSNVNSIVKLNDDNILFAGKFYXXXXXXXXXXXXXXXXXXXXXXXXXXXELGQRIPLRYA 259
            +S +NSI KLNDDNILFAGKFY                            LGQ IPL  A
Sbjct: 197  NSLINSITKLNDDNILFAGKFYTLDNSTLLNVVNDTMRNISDI------NLGQLIPLSAA 250

Query: 260  SWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPYEVAPTKIRLYNSPNSDNDIS 319
            +W S GS  F+    VCPD + +AW   GTSG+L C LP++VAPTKIR+YNSP+ DN+IS
Sbjct: 251  TWSSTGSF-FDEETFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEIS 309

Query: 320  LFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMISFIDNN 379
            LF+I ++PS SIMNLTY+DP+ G+L+ CD FCPLY++  L SAS+NV+ S +MI  +++N
Sbjct: 310  LFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDN 369

Query: 380  NTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNSLNEYG 439
             +D++WS DFQ+FAF N+LS +SL+F ALNSYG  VGLS  ++YQD ++ +ANNSLNE  
Sbjct: 370  TSDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPS 429

Query: 440  CSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPGHYTINTY 499
            C++L + SSS  LS+N W  G+  Q+Y+   Y+P+Q    P VTF+P + + G Y+I  Y
Sbjct: 430  CNSLESFSSSD-LSNNTWTRGMDDQNYVKTTYIPHQ-GVLPEVTFHPDLKYSGQYSIELY 487

Query: 500  TPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDFSPEIVMK 559
            TPGC QDNTCSSRGIVNVT+WN  NN+++ T LIYQNN+ LKYD++YSGYL++SP+I + 
Sbjct: 488  TPGCQQDNTCSSRGIVNVTVWNTNNNSILSTTLIYQNNDQLKYDELYSGYLNYSPKITVT 547

Query: 560  YVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRHTPLNGILQYQRSNFTATTS 619
            Y SGIY+  TA  +V D++NI+ +SLD  + +  +T       LNG+ QYQ SNF+ ++ 
Sbjct: 548  YHSGIYSGTTAGTVVVDRLNIMINSLDILNEIHNST---NSLELNGLFQYQLSNFSTSSK 604

Query: 620  NGT--KIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNHISVIDFNDNLEVTSSEN 677
            + +  ++ANT++N  ++  +  N S+ A +Y+  L++G  D+ +S+ + N +L + SS  
Sbjct: 605  DSSIARVANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSSSQ 664

Query: 678  KTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVSNYSKAVENAINITLANN 737
            + I+G + G+   + G+L++GD  SS   S VL FNGSF+S+ N +  + N  NIT+ ++
Sbjct: 665  QGIEGKITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDDS 724

Query: 738  DLIVFNNDYIFNAXXXXXXXXXXXXXXXXXXAGNNDNDDVLFSGAVSQMQFSDLSGSARF 797
            +L+VF+N+ IFN                   +G+N N D LFSGA+SQ+QF++LSGS   
Sbjct: 725  ELLVFDNNLIFNVSSSSQISNTSSFSLSLWSSGSNSNGDTLFSGALSQVQFTNLSGSVSI 784

Query: 798  LNESTVEALNLNKGIVPYLGAYLNESTIAYAYKTN-SLSKIYFXXXXXXXXXXXXXITKM 856
             N   + A +L     PY   +LN+S   Y  K + S S++ F             +  M
Sbjct: 785  ANN--LSATSLRSIGSPYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSKAPWRWTGYVDSM 842

Query: 857  VYANNQTLLVIGSESSTTAELSILNLRNFTTIANETLGSNAKINAFVNFEKNSSLLVGGD 916
            +Y  NQ++L +GS SS   ELSILNL +F  +ANETL  N+ +   V+FE+NSS+LVGG+
Sbjct: 843  LYLTNQSMLAVGSSSSVNGELSILNLDSFKVLANETLNQNSSVKTMVHFERNSSILVGGN 902

Query: 917  FQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESELIISGLFATEKQQSIRL 976
            F +S   C GLC+YNY    W TF N TI G IT+L   N+S+LII+G+F T+ Q S+ L
Sbjct: 903  FSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSSVNL 962

Query: 977  GSFNLTNSTMVPLLTGSGGKLNSFTVTEESIVAWNDTSLLIYKDQKWNTTSLPGNGSSVS 1036
               NLT++ +V +  G    +  F   +++I AWN+TSL  Y    W    +  + SS  
Sbjct: 963  ALMNLTDNKLVLIRWGFKEPVKDFITIDDNIFAWNETSLFEYTSNSWVDIPISNSNSS-- 1020

Query: 1037 SVTTID----TNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQGLLFDSQNWTPYF 1092
              TTID    T T    L+KR  ++    ++L++ G      YG++Q ++++ + W PY 
Sbjct: 1021 --TTIDSIGWTTTTDNNLKKRDNSETSN-NVLIVKGQIYDNVYGHIQAMIYNFEEWIPYL 1077

Query: 1093 TSETLEASSYNPT-IFINRDVSADFNSQIPLSNSNMTVTXXXXXXXXXXXXXXXXXXXXX 1151
            +  +L +S+  P  +FI+RDVS  F+SQ+ L  SN T +                     
Sbjct: 1078 SINSLVSSANQPAELFIDRDVSKLFDSQLALQVSNTTASITASSSTPTPTSSPKKKLHQS 1137

Query: 1152 XXXXNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIKPRIDENEMLDTV 1211
                 +DRGFVVLIGLALALGT++VLGIVGVILAY F+D +GDY  I PR++E+EML TV
Sbjct: 1138 KKK--IDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRVNEDEMLKTV 1195

Query: 1212 PPEKLMKFV 1220
            PPEKLM+F+
Sbjct: 1196 PPEKLMEFI 1204

>NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1219

 Score =  996 bits (2576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/1213 (44%), Positives = 781/1213 (64%), Gaps = 21/1213 (1%)

Query: 19   KASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSET 78
            +ASQL +IK +L++ +  +P+LN++  ND+  Q+LG +D LSFY Y GQQNFT  I   +
Sbjct: 17   QASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKGQQNFTTGIIPGS 76

Query: 79   NSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLSTL 138
            NS GL+YYSNNT I LEE   DT I KITPFG+DSFILSG+GS++G  L NQ+LYNL+TL
Sbjct: 77   NSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFILSGTGSLSGYSLTNQLLYNLTTL 136

Query: 139  SMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFGGFG 198
            S+  IF  S+  V+ +L++D+ VYFGGNF+  NG+   H  ++WDSTS++T+ L FGGFG
Sbjct: 137  SIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTSSSTEFLNFGGFG 196

Query: 199  EDSNVNSIVKLNDDNILFAGKFYXXXXXXXXXXXXXXXXXXXXXXXXXXXELGQRIPLRY 258
            E+S +NSIVKLNDDNILFAG+FY                           ++GQ +PL  
Sbjct: 197  ENSIINSIVKLNDDNILFAGEFY--TLDEPDFLIQNTTSSQNNIFNSTTVDIGQLVPLSA 254

Query: 259  ASWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPYEVAPTKIRLYNSPNSDNDI 318
            ++WD+ G +TF+S   VCPDT++++W+  GT+GSL C LP+EVAPTKIR+YNSPN DN +
Sbjct: 255  STWDT-GESTFDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAPTKIRIYNSPNEDNQV 313

Query: 319  SLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMISFIDN 378
            SLF+ILTN +  IMNLTY+DPIS EL+ CD FCPLYS+  L  A  N +S  D I  + +
Sbjct: 314  SLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANTTSPSDTIHLLAD 373

Query: 379  NNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNSLNEY 438
            N TD+KW+ +FQ+FAF N++SV+S++F AL+SYGN V LS  +LYQ+ ++ +AN++LNE 
Sbjct: 374  NTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNAYAVFANDTLNEP 433

Query: 439  GCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPGHYTINT 498
             C+++ + SSSS+ + N W  GLTGQ+YI+  Y PNQ  P P V+F P I +PG Y+IN 
Sbjct: 434  NCNSIESSSSSSLSA-NDWEMGLTGQTYISTTYTPNQ-DPVPYVSFSPQIKYPGQYSINI 491

Query: 499  YTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDFSPEIVM 558
            YTPGC QD+TCSSR IVNVT+W+    +++ T LIYQNN  LKYD++YSGYL  SP + +
Sbjct: 492  YTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYSGYLSSSPRVTI 551

Query: 559  KYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRHTPLNGILQYQRSNFTATT 618
            +YVSG+YASNT   +VAD++N++ DSL+     S  T+      LNG+LQYQ SNF+ ++
Sbjct: 552  EYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLLQYQISNFSTSS 611

Query: 619  SNGT--KIANTTLNLFSVDNYPKNSSMFADVYDKK-LILGGKDNHISVIDFNDNLEVTSS 675
            S  T  KI NT+LN  S++ + KN+SM+AD+YD   L+LG  +  I V+  N+N+++ SS
Sbjct: 612  SETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVVKLNENMDIESS 671

Query: 676  ENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVSNYSK--AVENAINIT 733
               ++ G+  G +  + G+L +G+   S   + ++ +NG+F  + N++K  ++ N +N+T
Sbjct: 672  NEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFNKNSSITNVVNLT 731

Query: 734  LANNDLIVFNNDYIFNAXXXXXXXXXXXXXXXXXXAGNNDNDDVLFSGAVSQMQFSDLSG 793
            + + +L+V +N  I+N                   +G+N N D +FSGA++ + ++DL+G
Sbjct: 732  IHDTELLVIDNQAIYNVSSSSTITNSSALQLSLWSSGSNLNRDTVFSGAIALLDYTDLNG 791

Query: 794  SARFLNESTVEAL--NLNKGIVPYLGAYLNESTIAYAYKTNSLSKIYFXXXXXXXXXXXX 851
            S    N  TV  +  N++     Y G +LN+S   YA KT+S S++ F            
Sbjct: 792  SIAIGNNFTVTNITNNVSSTNSLYTGLFLNDSLSIYASKTDSYSELLFSNGYSAPWSFFE 851

Query: 852  XITKMVYANNQTLLVIGSES-STTAELSILNLRNFTTIANETLGSNAKINAFVNFEKNSS 910
             I  MVY+++QT+L + S   +  +ELSILNL  F TIANETL  N+KIN  +NFE NS+
Sbjct: 852  GINYMVYSSHQTMLAVASSDFNKNSELSILNLTTFETIANETLNVNSKINGLINFEHNST 911

Query: 911  LLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESELIISGLFATEK 970
            L+VGG+F + + NC+GLC+YNY+S  W TF N++I G I Q+   N ++L++SGLF  + 
Sbjct: 912  LIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELINGTQLLLSGLFNAQN 971

Query: 971  QQSIRLGSFNLTNSTMVPLLTGSGGKLNSFTVTEESIVAWNDTSLLIYKDQKWNTTSLPG 1030
              S+ L   +L+   +  +  G    L SF    + I+ WN   L  Y++  W+T  +  
Sbjct: 972  ISSVNLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITWNGIMLESYENGAWST--IQS 1029

Query: 1031 NGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQGLLFDSQNWTP 1090
            N +S +++ +I+       L+KR  T +  G   ++NGN    +YG +Q ++++ + W P
Sbjct: 1030 NFNSSTTIRSIEPIGFGPTLQKRDGTGSADG--FIINGNIYDTEYGTIQAMIYNFKEWRP 1087

Query: 1091 YFTSETLEASSYNPTIFINRDVSADFNSQIPLSNSN---MTVTXXXXXXXXXXXXXXXXX 1147
            Y+   +   S     IF+NRD SA +NSQ  L N N   +T                   
Sbjct: 1088 YYIISSTN-SQIAGQIFMNRDDSALYNSQSVLQNPNNATVTTPSSTSSGTPSATHSSQPH 1146

Query: 1148 XXXXXXXXNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIKPRIDENEM 1207
                     +DRGFVVLIGLALALGTVS+LGI+G++LAY+FKD +G +  + PR +E+EM
Sbjct: 1147 HQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDGSHDALNPRTNEDEM 1206

Query: 1208 LDTVPPEKLMKFV 1220
            L+TVPPEKLMKF+
Sbjct: 1207 LETVPPEKLMKFL 1219

>TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1195

 Score =  929 bits (2402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1208 (42%), Positives = 743/1208 (61%), Gaps = 32/1208 (2%)

Query: 18   SKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSE 77
            S ASQL+++K    I +   P L+   +   A+Q+ GG +AL+F +Y GQ+NFT  I + 
Sbjct: 15   SLASQLENLKNKHGIVNIGTPRLDFPGE---ALQLFGGFNALTFPQYEGQENFTGTINNN 71

Query: 78   TNSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLST 137
            T+SRG+VYYSN+T+I L     D+ ++KI PFG++SFIL GSGS+ G  LG Q+LYNLS 
Sbjct: 72   TDSRGIVYYSNDTFIKLINGSSDSYVEKIVPFGSESFILGGSGSLLGYELGRQLLYNLSD 131

Query: 138  LSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFGGF 197
            LS+  IF  SL  V  +L +    YFGGNFS++NGS  GH    W+S+SNTT LLPFGGF
Sbjct: 132  LSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWNSSSNTTSLLPFGGF 191

Query: 198  GEDSNVNSIVKLNDDNILFAGKFYXXXXXXXXXXXXXXXXXXXXXXXXXXXELGQRIPLR 257
            GE+S VNSI+KL+ DNILF G+FY                           E+ + +PLR
Sbjct: 192  GEESIVNSIIKLDSDNILFTGEFY----TLDDQTLLITNENTSKTNHSQSIEINELLPLR 247

Query: 258  YASWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPYEVAPTKIRLYNSPNSDND 317
             A+W++   ++F+SS  +CP++ K+AW  P TSGSL  +LPYE  P K+R+YNSP   N 
Sbjct: 248  AATWNTDSDSSFDSSAFICPNSQKEAWSVPSTSGSLEASLPYESYPKKVRIYNSPEEHNA 307

Query: 318  ISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMISFID 377
            +SLF+I+T PS  IMNLTY+DP+SGEL +CD FCPL  +D+L +A  N ++S   +  +D
Sbjct: 308  VSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTS--QVVRLD 365

Query: 378  NNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNSLNE 437
            NN TD++WS D+QDFAF N+++VT L+F AL+SYG+ VGLS  +LYQDT +TYANNSLNE
Sbjct: 366  NNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYANNSLNE 425

Query: 438  YGCSALAND-SSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPGHYTI 496
             GC   +ND +S+S LSD++W  GL GQSY+  D+   Q +  P VTFYP+I + G YT+
Sbjct: 426  VGCE--SNDIASTSALSDSEWQQGLFGQSYLVADFRTGQ-ETLPKVTFYPAINYAGQYTM 482

Query: 497  NTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDFSPEI 556
            N YTPGC  D TC+SR IVNVTMW+    +++ + L++QNN  +KYD++YSG+L+ +P +
Sbjct: 483  NLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETAPVL 542

Query: 557  VMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRHTPLNGILQYQRSNFTA 616
             ++Y S I  +N + ++VAD++ +I +S+D   + ++ T      PLNG+ QYQ SNFT 
Sbjct: 543  TLEYYSPISPNNPSNVVVADRLEVIVESVDILKNQTDET-----IPLNGMFQYQLSNFTN 597

Query: 617  TTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNHISVIDFNDNLEVTSSE 676
            +T +   IANTTLN ++V N+PKN+S+F+ +Y+  L +GG  + ++ ++ +++L V+S+ 
Sbjct: 598  STDSKPSIANTTLNSYTVQNFPKNASLFSSMYNNTLWVGGSVSGVAAVELDEDLHVSSTA 657

Query: 677  NKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVSNYSKAVENAINITLAN 736
                 G V G++  + G+++FG    S    + L FNG F S  N    +    N++   
Sbjct: 658  KYATGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRTYTNVSFQQ 717

Query: 737  NDLIVFNNDYIFNAXXXXXXXXXXXXXXXXXXAGNNDNDDVLFSGAVSQMQFSDLSGSAR 796
            ++L+VFNN+Y+FN                   AG N  DD LFSGAV++ QF  L GSA 
Sbjct: 718  DELLVFNNEYVFNLSSNSYISNSSTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSAS 777

Query: 797  FLNESTVEALNLNKGIVPYLGAYLNESTIAYAYKTNSLSKIYFXXXXXXXXXXXXXITKM 856
              + S+V   +L  G  PY   +LN+S  AYAY+  S+S++YF             I  M
Sbjct: 778  IYSNSSVAHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGKEGPWTWFGTINSM 837

Query: 857  VYANNQTLLVIGSESSTTAE-LSILNLRNFTTIANETLGSNAKINAFVNFEKNSSLLVGG 915
             Y+ N T+L IG++ ST    LS+ NL +F  +AN T+  N  I++ V F++NSSLLVGG
Sbjct: 838  RYSKNSTILAIGTDGSTDEPILSLFNLTSFDVLANTTISENGTISSMVFFDRNSSLLVGG 897

Query: 916  DFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESELIISGLFATEKQQSIR 975
            D+ +S  +C+GLC+YNY+ K W+ F NN+I G IT++  +   +L+ISG      + S+ 
Sbjct: 898  DYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMNVANKTSVN 957

Query: 976  LGSFNLTNSTMVPLLTGSGGKLNSFTVTEESIVAWNDTSLLIYKDQKWNTTSLPGNGSSV 1035
            L SFN++N  + PL+  S G + SF   +  I+ WN+TSL  Y D  W       N S +
Sbjct: 958  LLSFNMSNYEVNPLVWDSNGPIKSFIAEDNDIITWNETSLSGYSDGDWQNLEF-DNSSLI 1016

Query: 1036 SSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQGLLFDSQNWTPYFTSE 1095
            S V  I   T+  AL KR T  +   +IL+   N++  +Y   Q  +++ Q W PY+ + 
Sbjct: 1017 SIVDVIAVKTEP-ALDKRQTFSSTFDAILVAGQNYA--EYP--QASIYNFQRWLPYYVAN 1071

Query: 1096 TLEASSYNP---TIFINRDVSADFNSQIPLSNSNMTVTXXXXXXXXXXXXXXXXXXXXXX 1152
              +A   +P   T F N+D S  ++SQ  L +     T                      
Sbjct: 1072 --KADDEDPSRTTFFTNQDDSQLYDSQ-NLLSDPTRTTTSSSSSTTSSSQTSPSKGSLVR 1128

Query: 1153 XXXNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIKPRIDENEMLDTVP 1212
                ++RGFVVLIGLALALGTV ++GI GV+LA VF    G Y  + PR DE+EM+DTVP
Sbjct: 1129 KSGKINRGFVVLIGLALALGTVVIIGITGVLLALVFNGHSG-YEQVDPRADESEMIDTVP 1187

Query: 1213 PEKLMKFV 1220
            PEKL+KF+
Sbjct: 1188 PEKLLKFL 1195

>ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} similar to
            uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1209

 Score =  895 bits (2312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/1205 (40%), Positives = 713/1205 (59%), Gaps = 17/1205 (1%)

Query: 20   ASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSETN 79
             SQL  ++ LL+  +  +P L+++   + A+++LG    L+FY+YTGQ+NFT  + S T+
Sbjct: 18   GSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNSSTD 77

Query: 80   SRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLSTLS 139
            S GL+YYSN+T++ L     DT I +I P G DSFILSGSG I+G  L  Q+ YNL+ LS
Sbjct: 78   SHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLTDLS 137

Query: 140  MARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFGGFGE 199
               IF + L  V ++LV+   VYFGGNF+++NGS TGH  ++W+S  N+T LLPF GFG+
Sbjct: 138  FKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIGFGQ 197

Query: 200  DSNVNSIVKLNDDNILFAGKFYXXXXXXXXXXXXXXXXXXXXXXXXXXXELGQRIPLRYA 259
            +S VNSI++L+ DNILFAG FY                           ELG  IPL+ A
Sbjct: 198  NSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDVELGLAIPLQNA 257

Query: 260  SWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPYEVAPTKIRLYNSPNSDNDIS 319
            +W S  S+ F++   +CPD  +++WL  GTSGSL C+LP E  P KIR+YNSP  DN++S
Sbjct: 258  NWTSS-SSQFDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIRIYNSPVEDNEVS 316

Query: 320  LFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMISFIDNN 379
            LF+IL  P+  I+NL+Y+DP  GEL+ CD FCPLY+R  L  AS N SS  +M +F DNN
Sbjct: 317  LFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEASSNSSSVENMTTFSDNN 376

Query: 380  NTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNSLNEYG 439
             TD+KW  DFQ+FAF N + ++S++F AL+SYG+ VGLS  + +Q   S YANNSLN+  
Sbjct: 377  TTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLNQPA 436

Query: 440  CSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPGHYTINTY 499
            C  + + S+++I S+N W  GL GQ+Y++  YV +Q    P VTF+P I +PG+Y+I  Y
Sbjct: 437  CGKMQSYSNATI-SNNDWRQGLNGQTYLSTSYVEDQGN-IPRVTFHPQIQYPGNYSIKLY 494

Query: 500  TPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDFSPEIVMK 559
            TPGC+ D TC+ R IVNVT+W+  +N  + + +IY+NNN LKYD+++ G+L  SP++ ++
Sbjct: 495  TPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPKVTLE 554

Query: 560  YVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRHTPLNGILQYQRSNFTATTS 619
            Y S IY +N  +++VAD +++   S D F         K+   LNGI QYQ SNFT   +
Sbjct: 555  YHSPIYPNNPTSVVVADYISLEAKSFDHFEKH------KKDITLNGIFQYQISNFTKNIT 608

Query: 620  NGTKIANTTLNLFSVDNYPKNSSMFADVYDKK-LILGGKDNHISVIDFNDNLEVTSSENK 678
              + I NT+L++F +  +  NSS+FA +Y+   L+L    +  + I  + N  V SS++ 
Sbjct: 609  KES-IGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSSKSF 667

Query: 679  TIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVSNYSKAVENAINITLANND 738
             +   V G+   + GL++FGD  SS  +   L FNGSF S    +++VE   NI L   +
Sbjct: 668  NLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVERFTNIDLKGTE 727

Query: 739  LIVFNNDYIFNAXXXXXXXXXXXXXXXXXXAGNNDNDDVLFSGAVSQMQFSDLSGSARFL 798
            L+VF+N++ +N                   AG N N D++FSGAVS   + +L G     
Sbjct: 728  LLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPVSLF 787

Query: 799  NESTVEALNLNKGIVPYLGAYLNESTIAYAYKTNSLSKIYFXXXXXXXXXXXXXITKMVY 858
               +  + N+   I PY+GAYLN++  AYAYK  S S+I F             I  M+Y
Sbjct: 788  QNGSAVSSNIKDNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNGDEGPWRWTNSIETMIY 847

Query: 859  ANNQTLLVIGS-ESSTTAELSILNLRNFTTIANETLGSNAKINAFVNFEKNSSLLVGGDF 917
             N   LL +G+  S +  +LS+LNL     +ANETL   A++N+ + F KNS+LL+GG+F
Sbjct: 848  RNRDALLALGTSSSPSLPQLSVLNLTTSEVLANETLDKGAEVNSMILFGKNSTLLIGGNF 907

Query: 918  QMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESELIISGLFATEKQQSIRLG 977
              S  +C GLC+YNY++K WSTF N++I G++TQ+   N SEL+I+G         + L 
Sbjct: 908  SFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAGSLRVNGTSDVNLV 967

Query: 978  SFNLTNSTMVPLLTGSGGKLNSFTVTEESIVAWNDTSLLIYKDQKWNTTSLPGNGSSVSS 1037
            S N+T   M  LL G  G L SF V+E+ +V WNDTSL+ Y +  W   S   N +S + 
Sbjct: 968  SVNITGQGMKTLLRGWEGPLRSFVVSEDRLVVWNDTSLMAYDNTSWRHIS-TSNSTSFTK 1026

Query: 1038 VTTIDTNTDSYALRKRATTDAEKG-SILLLNGNFSIPQYGNLQGLLFDSQNWTPYFTSET 1096
            +  I   +  ++L KRA + +      LL+ GN    Q  + Q  ++D  +WTP F + +
Sbjct: 1027 LQDIHQVSLEHSLEKRANSSSNSNLDGLLVYGN-DKTQGDSYQASIYDYYSWTPLFIANS 1085

Query: 1097 L-EASSYNPTIFINRDVSADFNSQIPLSNSNMTVTXXXXXXXXXXXXXXXXXXXXXXXXX 1155
              E S+  P IF+N+DVS  F S+  L N     T                         
Sbjct: 1086 KSENSNSGPNIFMNQDVSDFFISEQMLPNP-TNHTSSRSSSSSSSAVTSNSGDKKHRASH 1144

Query: 1156 NMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIKPRIDENEMLDTVPPEK 1215
             +DRG+VVLIGLALA+GTV V+G+ G+++AY+F +  G Y  + P  +  +  +T PP K
Sbjct: 1145 KVDRGYVVLIGLALAIGTVVVIGVFGILIAYMFGEDIGGYEFLSPPAEGTKAAETAPPAK 1204

Query: 1216 LMKFV 1220
              KF+
Sbjct: 1205 SSKFL 1209

>KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1210

 Score =  880 bits (2275), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/1208 (42%), Positives = 748/1208 (61%), Gaps = 20/1208 (1%)

Query: 18   SKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSE 77
            S ASQL  ++  L I+    P+L  S +ND+++Q+LG  DALS Y YTGQQNF+ +I  +
Sbjct: 18   SLASQLSQLENSLGIQTFAPPALIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITPD 77

Query: 78   TNSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLST 137
            TNS GLVYYSNNT I L +  +DTRI+ I P G+DSFILSGSGS+N   L NQ+ YNLS+
Sbjct: 78   TNSNGLVYYSNNTLIQLNQGLDDTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSS 137

Query: 138  LSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFGGF 197
            LS+  IF  +L  VE++LV++  VYFGGNF+++NG+  GH   VW+ TSN+T LLPF GF
Sbjct: 138  LSVYPIFNTTLEQVESILVDEDLVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGF 197

Query: 198  GEDSNVNSIVKLNDDNILFAGKFYXXXXXXXXXXXXXXXXXXXXXXXXXXXELGQRIPLR 257
            GE+S++N+I++LNDDNILFAG+FY                           EL   +PL 
Sbjct: 198  GENSSINNILRLNDDNILFAGEFY-----TLDDASLLTSNTSNATTNIYDLELSPLLPLN 252

Query: 258  YASWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPYEVAPTKIRLYNSPNSDND 317
             A+W S  S  F++S  +C +   DAW   GT+G+L C+LPY+ A TKIR+YNSP+S N 
Sbjct: 253  EATWSSDVS-DFDASSFICVNPDSDAWFVSGTTGTLACSLPYDSALTKIRIYNSPDSQNQ 311

Query: 318  ISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMISFID 377
            IS F+++++PSGSIMN+TY+DP +G L+ CD +CPL SRDTL SAS   +S  +M   + 
Sbjct: 312  ISEFRLISDPSGSIMNMTYIDPRTGNLEHCDSYCPLLSRDTLSSASD-AASVSEMARLLS 370

Query: 378  NNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNSLNE 437
            +N T +KWS+++Q+F F N +S T L+F ALNSYG+ V L+G  LYQD ++ +ANNSLN 
Sbjct: 371  DNATVIKWSAEYQEFGFVNVVSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNG 430

Query: 438  YGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPGHYTIN 497
              C++  +D +SS LSDN W  G +GQ+Y+   Y      P P VTF  ++ + G Y IN
Sbjct: 431  ASCTSNNSDYTSSTLSDNDWVFGASGQTYVTTFYTEGD-DPIPQVTFNANLPYSGDYVIN 489

Query: 498  TYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDFSPEIV 557
             YTPGC  D TCS+RG+VNVT+++  +++++ T  IYQNN  LKYD+++SGYL  S  IV
Sbjct: 490  LYTPGCSDDGTCSTRGLVNVTVYDESDDSILSTVEIYQNNEALKYDELFSGYLKNSVRIV 549

Query: 558  MKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRHTPLNGILQYQ-RSNFTA 616
            ++YVSGI + +T T +VAD+ NI   SLD    +S + +      LNG+ QYQ  +  + 
Sbjct: 550  LEYVSGISSDSTGTTVVADRSNIYVTSLDILGQISSSKN-GSTVALNGLFQYQLSNFSST 608

Query: 617  TTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNHISVIDFNDNLEVTSSE 676
              S+  K+  T LN + +D +  NSS+FA  YD  L++GG +  +  ++ +++L  ++S+
Sbjct: 609  FNSSSAKVGKTFLNQYPLDIFNTNSSLFASTYDNYLLVGGAEQSVYALESSNDLNFSTSD 668

Query: 677  NKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVSNY-SKAVENAINITLA 735
            N  ++G    M   ++G+ ++G+   S      + +NGSF   + Y + +++   N+T  
Sbjct: 669  NSGVEGQFKNMQPFSEGIFLYGNFNLSGVTEGAVTYNGSFNPFTQYGNSSIDTFKNVTFG 728

Query: 736  NNDLIVFNNDYIFNAXXXXXXXXXXXXXXXXXXAGNNDNDDVLFSGAVSQMQFSDLSGSA 795
            N++++VFNN Y++N                   AG N N D+LF+GA SQM +S  + S 
Sbjct: 729  NSEILVFNNAYLYNVSSSTLMSNSSSLSLSLWSAGANANGDLLFNGASSQMSYSFNNESI 788

Query: 796  RFLNESTVEALNLNKGIVPYLGAYLNESTIAYAYKTNSLSKIYFXXXXXXXXXXXXXITK 855
                 + V+ LN N+ I PYLG Y+N S  AY Y+ +  +++YF             +  
Sbjct: 789  NIGANNIVQGLNFNESIDPYLGLYMNTSHGAYFYQDDDNTRVYFTNGSQPSWQWPNDVVA 848

Query: 856  MVYANNQTLLVIGSESSTTAE--LSILNLRNFTTIANE-TLGSNAKINAFVNFEKNSSLL 912
             +Y++NQ+LL+ G+ SS  +   L++LN   +  IANE      ++I+  VNF  N++ +
Sbjct: 849  AIYSDNQSLLIAGTSSSLESSSFLTVLNTTTYDVIANESLSSQQSQISGIVNFASNATAI 908

Query: 913  VGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESELIISGLFATEKQQ 972
            +GG+F M   NC GLC++NY + +WS+F + +I G +  +   NESELI+SGLF+T+   
Sbjct: 909  IGGNFSMPNVNCFGLCLFNYGNSTWSSFADASINGTVDHMQLFNESELIVSGLFSTKNIS 968

Query: 973  SIRLGSFNLTNSTMVPLLTGSGGKLNSFTVTEESIVAWNDTSLLIYKDQKWNTTSLPGNG 1032
            SI + S NL N+ +  L +G      SFTV ++ IVAWN+T+L IY+D  W T     N 
Sbjct: 969  SITMASLNLKNNKITALKSGESNTFKSFTVADQKIVAWNNTALSIYEDNVW-TVERISNI 1027

Query: 1033 SSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQGLLFDSQNWTPYF 1092
            +S S V  ++  T + AL KR T+ ++    +L++G      YG++Q +++D  +W PY 
Sbjct: 1028 NSSSVVDNLNYVTLASALSKRDTSSSDA---ILVSGQLYDNSYGHIQAMVYDFSSWVPYL 1084

Query: 1093 TSETLEASSYNPTIFINRDVSADFNSQIPLSNSNMTVTXXXXXXXXXXXXXXXXXXXXXX 1152
               +   SS N   FI+RD+S+  N+Q+ L  ++ TV+                      
Sbjct: 1085 LINSESDSSINA--FIDRDMSSFTNTQVALLTNSGTVSNSSSSTTSPGASASATSIPNKT 1142

Query: 1153 XXXNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIKPRIDENEMLDTVP 1212
                +DRGFVVL+GLALALGTV+VLGI GVI+AYVF+D  G Y PI PRIDENEM++TVP
Sbjct: 1143 HKRKIDRGFVVLLGLALALGTVAVLGIAGVIMAYVFRDDNGAYEPINPRIDENEMIETVP 1202

Query: 1213 PEKLMKFV 1220
            PEKLMK++
Sbjct: 1203 PEKLMKYI 1210

>Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON}
            (27006..30686) [3681 nt, 1227 aa]
          Length = 1226

 Score =  847 bits (2188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/1215 (39%), Positives = 722/1215 (59%), Gaps = 17/1215 (1%)

Query: 18   SKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSE 77
            S+ASQL ++K  L I    +P +N    N N IQIL  ++ L+FY+Y GQQNFT  I + 
Sbjct: 17   SQASQLTNVKDSLGINTVNIPQINFGNTN-NEIQILSNIEGLTFYQYQGQQNFTGSIDTN 75

Query: 78   TNSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLST 137
            +N+ GL+YYSN+T I L E  ++T+ID+I P   D+FILSGSG++ G  L NQ+LYNLS 
Sbjct: 76   SNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTLGGFQLENQLLYNLSD 135

Query: 138  LSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFGGF 197
            LS+  +F   L +++++LV+   VYFGGNFSY + + T +  + W+  +    +LPF GF
Sbjct: 136  LSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKNVDMLPFIGF 195

Query: 198  GEDSNVNSIVKLNDDNILFAGKFYX---XXXXXXXXXXXXXXXXXXXXXXXXXXELGQRI 254
            G++S VNSI+KL++DN+LF G F                               EL Q+I
Sbjct: 196  GKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVSNITTYTQQNSTSSSSTETNLELEQQI 255

Query: 255  PLRYASWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPYEVAPTKIRLYNSPNS 314
             L+YASW S G     S+  +CP+   +AW   GT+G + C L +E + +KIR++NSP  
Sbjct: 256  SLKYASWASLGDLK-SSTQFICPNGQNEAWSSAGTTGEITCNLAFEASLSKIRIFNSPYE 314

Query: 315  DNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMIS 374
             + I+ F+I+T PS  IMNLTYLDP++ E++ CD FCPLYS + L ++S+N ++S    +
Sbjct: 315  QDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQASSENATTSASTSA 374

Query: 375  FIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNS 434
            FI+ N T++ WS+D+Q+FAF N++ VT+L+  AL SYG+ VGLSG +LYQ+++S +ANNS
Sbjct: 375  FINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSIFANNS 434

Query: 435  LNEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPGHY 494
            LNE  C +      SS LS+N WY GL  QSYIA  Y P    P+P V FYPSI   G+Y
Sbjct: 435  LNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGD-DPSPLVNFYPSINRIGNY 493

Query: 495  TINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDFSP 554
            T+N YTPGC  D TCS RGIVNVT+W+   N ++ T LIYQNNN +KYD+++ G+LD++P
Sbjct: 494  TVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGFLDYAP 553

Query: 555  EIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRH--TPLNGILQYQRS 612
            ++ ++Y SGI   N+  ++VAD V+++  +++   ++   TS       PLNG+ QYQ S
Sbjct: 554  KVTLEYYSGINDENSPVVVVADNVDLVPINIELDETIGNVTSSTEELKVPLNGMFQYQLS 613

Query: 613  NFTATTSNGT-KIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNHISVIDFNDNLE 671
            NFT++ +N T K+ NT+LNLF V  +  + S++   Y++ L+LGG    +  +  ++   
Sbjct: 614  NFTSSNNNSTLKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGGSIAGVYALSLSNYTN 673

Query: 672  VTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVSNYSKAVENAIN 731
            + S+      G+V G      G+++FG+   S+   + L +NG+F+S  N +  +    N
Sbjct: 674  IRSTRIVETGGEVTGTGAYAGGVVLFGNFNISNRIVSSLSYNGTFDSFGNVNSNIATFSN 733

Query: 732  ITLANNDLIVFNNDYIFNAXXXXXXXXXXXXXXXXXXAGNNDNDDVLFSGAVSQMQFSDL 791
            +T   ++++ FNN+Y FN                   AG+ND  D LFSG +++ +F +L
Sbjct: 734  LTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGLITRNEFPNL 793

Query: 792  SGSARFLNESTVEALNLNKGIVPYLGAYLNESTIAYAYKTNSLSKIYFXXXXXXXXXXXX 851
            + SA      T ++L L  GI PYLG YLN+S  AY Y ++S S I F            
Sbjct: 794  NNSAVLTGNGTAQSLQLRNGIQPYLGVYLNDSLTAYLYDSSSNSNILFSNGLQGNWNLPR 853

Query: 852  XITKMVYANNQTLLVIGSESS--TTAELSILNLRNFTTIANETLGSNAKINAFVNFEKNS 909
             ++   Y++N+T+ V  S S+  + AEL +LN      + NET   N+ IN+ V+F +NS
Sbjct: 854  SVSSAYYSDNETMFVGSSLSNGDSGAELFVLNFTTMDLLYNETFDVNSSINSIVSFGRNS 913

Query: 910  SLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESELIISGLFATE 969
            SLLVGGDF     NC+ LC+ N  +  WS+F +N   G IT L F N+S L+ISG +  E
Sbjct: 914  SLLVGGDFTAPNTNCSNLCLLNLGNNQWSSF-SNKFDGTITGLEFANDSRLLISGSYRFE 972

Query: 970  KQQSIRLGSFNLTNSTMVPLLTGSGGKLNSFTVTEESIVAWNDTSLLIYKDQKWNTTSLP 1029
             Q  I LG  +L N     LL+ S  K+NSF     +IVAW+ +++  Y+   W+   +P
Sbjct: 973  NQSGISLGYIDLNNQEFKSLLSDSQ-KVNSFNYNNGTIVAWDSSTIYSYRGDSWSNHQIP 1031

Query: 1030 GNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQGLLFDSQNWT 1089
               SS S       +  + +L    T++     ++L+ G      YG +Q + +D QNW 
Sbjct: 1032 NTNSSTSIKNVQIVSKLNNSLSTNNTSNNLNDELILVFGELYSEDYGFVQAMFYDFQNWI 1091

Query: 1090 PYFTSETLEA-SSYNPTIFINRDVSADFNSQIPLSNSNMTVTXXXXXXXXXXXXXXXXXX 1148
            PY+ ++   + ++   ++F+N+D+S  + SQ+ L N N T++                  
Sbjct: 1092 PYYITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNSTISISSTSSSSATTRSSSTSS 1151

Query: 1149 XXXX---XXXNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIKPRIDEN 1205
                       + RG+VVLIGLALA+GTV++LGI GV +AY+F D +G+Y  IKPRIDE+
Sbjct: 1152 TSLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSDDKGEYVRIKPRIDEH 1211

Query: 1206 EMLDTVPPEKLMKFV 1220
            EMLDTVPPEKLMKF+
Sbjct: 1212 EMLDTVPPEKLMKFI 1226

>SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1211

 Score =  844 bits (2180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/1224 (40%), Positives = 715/1224 (58%), Gaps = 55/1224 (4%)

Query: 20   ASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSETN 79
             SQL S+K  L+I+D  +P +++S   ++ + +LG  + L+FY YTGQ+NFT  I +ET 
Sbjct: 20   GSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQENFTGSI-TET- 77

Query: 80   SRGLVYYSNNTYILLEE-ADEDTR--IDKITPFGADSFILSGSGSI-NGVPLGNQVLYNL 135
             + L+YYSN T+I L+  +DE+    I+ I PFG DSFILSG+G++  G  L  Q+LYNL
Sbjct: 78   EKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLPGGHNLEQQLLYNL 137

Query: 136  STLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFG 195
            S+L    IF QS+ +V  +L +D  VYFGG F Y  G+ TGH  ++W+ST+N  QLLPF 
Sbjct: 138  SSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWNSTTNEIQLLPFK 197

Query: 196  GFGEDSNVNSIVKLNDDNILFAGKFYXXXXXXXXXXXXXXXXXXXXXXXXXXXELGQRIP 255
            GFG DS VNSI++L++DNI+FAGKF                            E  Q IP
Sbjct: 198  GFGLDSVVNSILRLDNDNIVFAGKF----NTLDDNTLLKQIRGSNSSKNATDIEFDQLIP 253

Query: 256  LRYASWDSQGSTTFESSYLVCPDTSKDAWLYPGTS-GSLVCTLPYEVAPTKIRLYNSPNS 314
            L++A W SQGS   E S L+CP    D W   GT+ G    +L  ++ P+K+R+YN+ +S
Sbjct: 254  LKHAGWSSQGS--LEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLRPSKLRIYNAFDS 311

Query: 315  DNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMIS 374
            D  +SLF+I+T+P+  IMNLTYLDP +GEL  CD +CPL S + L  A  NV+ S D ++
Sbjct: 312  DYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVTISSDSVA 371

Query: 375  FIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNS 434
            +I NNNT++KW+S +Q+FAF NE+SV SL F AL+SYG+ VGL G E+YQ+ + T+AN++
Sbjct: 372  YIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGYPTFANDT 431

Query: 435  LNEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPGHY 494
            LN+  C  + + S +   S  +W  G    SYI   Y  + T   P+V FYP+I + G Y
Sbjct: 432  LNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTY--DGTGDLPSVNFYPNITYAGDY 489

Query: 495  TINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDFSP 554
            T+N  TPGC  D +CSSRGIVNVT+W+  N+T++ T LIYQNNN+ KYD +YSGYL+ +P
Sbjct: 490  TLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSGYLESAP 549

Query: 555  EIVMKYVSGIYASNTATIMVADQVNIITDSLDS----FSSLSETTSVKRHTPLNGILQYQ 610
            +I +K+   I   ++ +IMVAD+V++I DS+D       +++ET        LNG+ QYQ
Sbjct: 550  KITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTINET--------LNGLFQYQ 601

Query: 611  RSNFTATTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNHISVIDFNDNL 670
             SNFT  +++  KI NTT+N +S++N P NS +FA  Y+  L++ G  N I+V+  ND+L
Sbjct: 602  ISNFTTISNDSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIAVLQLNDDL 661

Query: 671  EVTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVSNYSKAVENAI 730
             + S +     G   G+   + GLL  GD   S  + + L +NG+F S  N    +    
Sbjct: 662  NIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTNITRFN 721

Query: 731  NITLANNDLIVFNNDYIFNAXXXXXXXXXXXXXXXXXXAGNNDNDDVLFSGAVSQMQFSD 790
            NIT+ +++L+VFNN YIFN                   AG+N  +D +  GAVSQ Q+++
Sbjct: 722  NITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQYTE 781

Query: 791  LSGSARFLNESTVEALNLNK--GIVPYLGAYLNESTIAYAY--KTNSLSKIYFXXXXXXX 846
            L+G+    + +++  + L    G   Y   Y+N+S+ AYAY  K +S   +         
Sbjct: 782  LNGAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKNDSTHHVLIARGNRSE 841

Query: 847  ---XXXXXXITKMVYANNQTLLVIGSESSTT--AELSILNLRNFTTIANETLGSNAKINA 901
                     +  M+Y  + +LL +G+ +  T    LS+ N+ N   I  E LG+ + +NA
Sbjct: 842  DLPVSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENLGAKSSVNA 901

Query: 902  FVNFEKNSSLLVGGDFQMSKPN--CTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESE 959
             V F KNSSLLVGGDF + K +  C+GLC+YNY +  WS F+NN+I G IT L F N ++
Sbjct: 902  IVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFFNGTQ 961

Query: 960  LIISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSG--GKLNSFTVTEESIVAWNDTSLLI 1017
            L+ISG   TE +  I L   N+ ++ +  L  GS       +F  T + ++  +D  +  
Sbjct: 962  LLISGNLYTENETGINLAKLNMASNEVTILRHGSTMVQSFVTFDHTTDELITQSDNEISY 1021

Query: 1018 YKDQKW-NTTSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYG 1076
            Y + +W N TS   N S       I        L++ ++        LL+NG+     YG
Sbjct: 1022 YTNGEWKNLTSEDFNDSLYMGAQLI-------PLKQTSSKRDVSNRALLVNGDLKHSTYG 1074

Query: 1077 NLQGLLFDSQNWTPYFTSETLEASSYNPTIFINRDVSADFNSQIPLSNSNMTVTXXXXXX 1136
            ++  +L+D ++W PYF  +  E +     IF+N+D+S+ + +Q  L  SN + +      
Sbjct: 1075 SVSAMLYDFEDWMPYFIVDG-ENAGRASNIFMNKDLSSLYTTQTILQGSNTSTS------ 1127

Query: 1137 XXXXXXXXXXXXXXXXXXXNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYR 1196
                                +DRGFVVLIGLALA+GTV+VLG  G I+AY F   +G Y 
Sbjct: 1128 TTSSNMPSETSDKNESSSDKIDRGFVVLIGLALAIGTVAVLGGAGAIIAYFFAGNKGQYE 1187

Query: 1197 PIKPRIDENEMLDTVPPEKLMKFV 1220
            P+KPR+DE +M+DTVPPEKLMKFV
Sbjct: 1188 PLKPRVDEGDMIDTVPPEKLMKFV 1211

>TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8.256
            YLR084C
          Length = 1215

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/1212 (38%), Positives = 699/1212 (57%), Gaps = 25/1212 (2%)

Query: 18   SKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSE 77
            + AS L +I  LL+I++  LP+LN + +  N+IQ+LG V+ L FY Y GQQNFT +  S 
Sbjct: 20   ATASSLSNILKLLNIQEFELPNLNFN-NTSNSIQLLGDVENLQFYHYEGQQNFTDDGNSG 78

Query: 78   TNS-RGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLS 136
             +S   L+YYS++  I LE    DT I KI P G DSF+LSGSG +NG  LG Q+LYNL+
Sbjct: 79   ISSTNNLIYYSDDVLIQLEVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLT 138

Query: 137  TLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFGG 196
            TLS+  IF Q LG++ ++LV++  VYFGG F+Y   S      + W+ TS+    LPF G
Sbjct: 139  TLSIKPIFDQDLGNITSILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQG 198

Query: 197  FGEDSNVNSIVKLNDDNILFAGKF--YXXXXXXXXXXXXXXXXXXXXXXXXXXXELGQRI 254
            FG DS VNSI+KLNDDNILF G F                              +L Q+I
Sbjct: 199  FGSDSKVNSILKLNDDNILFVGMFDTLGNSSLLTYNTTSNFSNFTNSTENSSTIQLEQQI 258

Query: 255  PLRYASWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPYEVAPTKIRLYNSPNS 314
             L+YA+WD+ G+  F+ +  VC   S +AW+  G SG+L    P  V+P+KIR+YN+  +
Sbjct: 259  SLKYATWDA-GTAYFDQNNFVCEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTA 317

Query: 315  DNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMIS 374
            ++ +SLF+I+T+PS  IMNLTY+DP++G+L+ CD FCPL +   L +AS N +S      
Sbjct: 318  EDGVSLFRIVTSPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRV 377

Query: 375  FIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNS 434
            FI+NN T V WS  +Q+FAF N + V++L   A +SYG+K  LSG+EL+QD+ + YANN+
Sbjct: 378  FINNNTTSVTWSESYQEFAFINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNT 437

Query: 435  LNEYGCSALANDS-SSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPGH 493
            LN+ GC   +    SSS+LSDN WY GL   SYIA +Y  + + P PTV FYP+I   G 
Sbjct: 438  LNQPGCDTESTSLFSSSVLSDNGWYKGLDSDSYIAANY-QSDSSPLPTVQFYPNIQAVGD 496

Query: 494  YTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDFS 553
            ++I  YTPGC+ D TC SR IVNVT+ +P + T++ T LIYQNNN +KYD+I++G L  S
Sbjct: 497  FSIKMYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVS 556

Query: 554  PEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRHTPLNGILQYQRSN 613
            PEI + + S I     + I+VAD+V++    ++    L ++        LNG+ QYQ SN
Sbjct: 557  PEITLTFYSTILPDLDSAIIVADRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSN 616

Query: 614  FTATTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNHISVIDFNDNLEVT 673
            FT+ T   TK+ N +++  ++  +P + S+  + ++  + L G  ++I  +  N +LE+ 
Sbjct: 617  FTSDTK--TKVGNNSIHQLALSQFPSSVSLIGNTFNNSIFLAGSTSNIVQLQLNSDLELR 674

Query: 674  SSENKTIQGDVYGMTQTNQGLLIFGDVR-SSDNKSTVLMFNGSFESVSNYSKAVENAINI 732
            ++      G+   +   +QGLL FG    SS N    L FNG+F S S     V    N 
Sbjct: 675  NTVVVDNGGETTRIENYSQGLLFFGQYNISSTNVVDNLSFNGTFSSFSQLGDNVTTFANF 734

Query: 733  TLANNDLIVFNNDYIFNAXXXXXXXXXXXXXXXXXXAGNNDNDDVLFSGAVSQMQFSDLS 792
            T   ++L+ FNNDY++N                    G N N+D L  G + + ++S+ +
Sbjct: 735  TYEGSELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFN 794

Query: 793  GSARFLNESTVEALNLNKGIVPYLGAYLNESTIAYAYKTNSLSKIYFXXXXXXXXXXXXX 852
               +    S++E+L  +  IVPY   +LN++   YAYK    SKI +             
Sbjct: 795  EPLKLYGNSSLESLTFSSSIVPYAAVFLNDTANLYAYKDGENSKIIYGNNMTTSLDFSGT 854

Query: 853  ITKMVYANNQTLLVIGSESST-TAELSILNLRNFTTIANETLGSNAKINAFVNFEKNSSL 911
            + K+ ++NN +LL   + ++  ++ L I N+ +  ++A+E L +   I + ++F  N+++
Sbjct: 855  LNKLSFSNNSSLLFANAITNNGSSSLVISNISDGMSLASENLNNYGYITSMIDFNSNNTI 914

Query: 912  LVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESELIISGLFATEKQ 971
            LV G+F +   +C G+C+YNY +K WS F N+TI G I ++   N  +++ISGLF+ +  
Sbjct: 915  LVSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNY 974

Query: 972  QSIRLGSFNLTNSTMVPLLTGSGGKLNSFTVTEESIVAWNDTSLLIYKDQKWNTTSLPGN 1031
             SI L S ++    +  L   S  +++SF    +SI  W++ +++ YK +KWN  S P  
Sbjct: 975  SSITLASLDIKGYNISVLSDDSKIEISSFIHDGQSITVWSNDTIMEYKSEKWNEISFPNT 1034

Query: 1032 GSS-VSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQGLLFDSQNWTP 1090
             S  + SV  +  +       + +T++  K  IL   G F+   YG L  +LF + +W P
Sbjct: 1035 TSKYIESVEAVSID------LQNSTSNVSK--ILFAYGEFNSTLYGRLNAMLFRAGDWKP 1086

Query: 1091 YFTSETLEASSYNP--TIFINRDVSADFNSQIPLSNSNMTVTXXXXXXXXXXXXXXXXXX 1148
            YF+    + +  +P  T+F NRD+S+ FNS+  L  +N+T                    
Sbjct: 1087 YFSINNFQVNE-DPAITLFENRDLSSLFNSKNSLP-ANITSAETSSRSTVSSATATTVVN 1144

Query: 1149 XXXXXXXNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIKPRIDENEML 1208
                    +DRGFVVLI LALA+GTV++LG+ GV +AY+F+D E  Y  IKPRID  EML
Sbjct: 1145 KIEGKHSKIDRGFVVLIALALAVGTVALLGLFGVTIAYIFRD-EQKYESIKPRIDGQEML 1203

Query: 1209 DTVPPEKLMKFV 1220
            DTVPPEKLMKF+
Sbjct: 1204 DTVPPEKLMKFI 1215

>KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1202

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/1226 (37%), Positives = 703/1226 (57%), Gaps = 70/1226 (5%)

Query: 18   SKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSE 77
            ++AS L++++ +L+  +  +P+ ++   N N  QIL  ++ +SFYEY GQQNFT +  + 
Sbjct: 16   TRASNLENVRRILNATEVTVPTFDVGNKN-NQFQILDDINGISFYEYLGQQNFTTD-ANV 73

Query: 78   TNSRGLVYYSNNTYILLEEA-DEDTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLS 136
            T+ + L+YYSN T++ L ++   + +I  I P G DSFILSG G IN V L +Q+++N++
Sbjct: 74   TDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGMINNVSLASQLVFNMT 133

Query: 137  TLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFGG 196
             LS+ +IF   L S+E V V+   VYF GNF++NN +    GA++WDS   +  LLPF G
Sbjct: 134  DLSITKIFDTPLRSIEGVTVDGPLVYFMGNFTFNNNT----GAIMWDSRDRSINLLPFHG 189

Query: 197  FGEDSNVNSIVKLNDDNILFAGKFYXXXXXXXXXXXXXXXXXXXXXXXXXXXELGQRIPL 256
            FG  +N+NSI+KLNDDNILFAG F                             L   +PL
Sbjct: 190  FGPYANINSILKLNDDNILFAGHF---STVWNSSLLLQSNVSEESVRNTTSLLLNPSVPL 246

Query: 257  RYASWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPYEVAPTKIRLYNSPNSDN 316
            +Y+ W + G    +SS L+CPD SKD+W    T+G   C LP+++ P+KIR+YNSP+ D+
Sbjct: 247  QYSQWKTNGE--LDSSQLICPDPSKDSWSVSATTGDFTCELPFQITPSKIRIYNSPDKDS 304

Query: 317  DISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMISFI 376
             +SLF+ LT P+GSIMNLTYLDP+SG + SCD FCPLYS+  L S   N + + + ++ I
Sbjct: 305  QVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDNTAEA-NTVAII 363

Query: 377  DNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNSLN 436
            +NN+T+++W+ ++Q+FA  + ++ TSL+F AL SYGN +GL+G ++YQ +FS + NNS N
Sbjct: 364  NNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAFGNNSFN 423

Query: 437  EYGCSALANDS----SSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPG 492
               C+    DS    +SS LS N W     G+ Y+ + Y PN+  P P VT+   I H G
Sbjct: 424  TPNCNNNDKDSNNTFTSSSLSPNNWTS--VGE-YLTVGYTPNE-NPVPKVTYKIDIQHSG 479

Query: 493  HYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDF 552
             Y+IN +TPGC  DNTCS+RGIVN T+++   N M+ T LIYQNN+ +KYD +YSG L+ 
Sbjct: 480  EYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYSGQLNS 539

Query: 553  SPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRHTPLNGILQYQRS 612
            S EI M Y SG+YASNT T +VAD+V++   S+D    LS  T V +   LNG+ QYQ S
Sbjct: 540  SCEITMTYYSGLYASNTVTTIVADRVDLNIISMD----LSHRTEVSK-LALNGLFQYQIS 594

Query: 613  NFTATTSNGTKIANTTLNLFSVDNYPKNSSMFA-DVYDKKLILGGKDNHISVIDFNDNLE 671
            NFT   S   KIANT+LN F+++N+  + S+ A  + +  ++L G + ++  I+ N +L 
Sbjct: 595  NFT-NDSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSINLNTDLS 653

Query: 672  VTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVSNYSKA--VENA 729
            V +S       +       + GL++       D +  V +F  +F++++         + 
Sbjct: 654  VQNSTRLISTENFTTFQPYSNGLVML------DGQGNVSLFKDNFKNLNTTMDGSLATDV 707

Query: 730  INITLANNDLIVFNNDYIFNAXXXXXXXXXXXX-XXXXXXAGNNDNDDVLFSGAVSQMQF 788
             NITL  ++L+VFNN YI+N                    AG N  +D +F G V Q Q+
Sbjct: 708  ANITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGKVVQWQY 767

Query: 789  SDLSGSARF---LNESTVEALNLNKGIVPYLGAYLNESTIAYAYKTNSLSKIYFXXXXXX 845
            +  + SA+     N+  +E ++L    VP  G +LN+ +  Y YK ++ SK+Y       
Sbjct: 768  AIANQSAQVNADFNDG-IEQMSLPSNTVPSRGIFLNDDSTGYFYKESNKSKLYITNSNST 826

Query: 846  XXXXXXXITK-MVYANNQTLLVIG--SESSTTAELSILNLRNFTTIANETLGSNAKINAF 902
                     + +VY  N TLL++G  ++++ ++ LS+ NL +F  I  E L   + I++ 
Sbjct: 827  SGLEWYGEPETVVYDKNDTLLMVGYYNDNTFSSTLSLTNLTSFDVIKEENLNVGSSISSL 886

Query: 903  VNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESELII 962
            + F KN +LLV GDF+ S  NC+ LC+YNY+S  W +  NN++ G +  L       +++
Sbjct: 887  LYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSVAALQLYQNDTILV 946

Query: 963  SGLFATEKQQSIRLGSFNLTNSTMVPLLTGSGGKLN--SFTVTEESIVAWNDTSLLIYKD 1020
             G     +   + +   NL+N+ +  L+      +N  S  V+   IVAWNDT L  +  
Sbjct: 947  LGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLHSMIVSNSRIVAWNDTVLFSFDG 1006

Query: 1021 QKWNTTSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQG 1080
              W   S+PG  SS +S++++        +    T DA     LLL G F   ++G+++ 
Sbjct: 1007 NSWTRVSVPGTDSSATSISSVQ------FISMEGTDDA-----LLLLGEFRHSEFGDIKS 1055

Query: 1081 LLFDSQNWTPY--FTSETLEASSYNPTIFINRDVSADFNSQIPLSNSNMTVTXXXXXXXX 1138
            ++++ ++W PY  +     + + +   +F+NRD+S    +QIPL NS   +T        
Sbjct: 1056 IVYNFRDWIPYLLYVDGPRQGTGH---LFMNRDISLHNIAQIPLLNSTRVLTNQSFASST 1112

Query: 1139 XXXXXXXXXXXXXXXXXN-------MDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDP 1191
                             +       +DRGFVVLIGLALAL TVSV+G+ GV+LAY+F+D 
Sbjct: 1113 SSSVSSTSTTLPKVSTTHSKPGRRIVDRGFVVLIGLALALATVSVMGVAGVLLAYIFRDN 1172

Query: 1192 EGD-YRPIKPRIDENEMLDTVPPEKL 1216
             GD Y+ + PR+DEN M++T+PPEKL
Sbjct: 1173 VGDSYQTLNPRMDENAMVNTLPPEKL 1198

>TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1278

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/1266 (36%), Positives = 695/1266 (54%), Gaps = 76/1266 (6%)

Query: 20   ASQLQSIKALLDIEDNVLPSLNISQDNDNAIQIL--GGVDALSFYEYTGQQNFTKEIGSE 77
            A+QL  +K +L+IE+   P  N+    + ++Q+L   G D L+F  Y GQQNFT+ I S 
Sbjct: 23   ANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQNFTQPIISS 82

Query: 78   TNSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLST 137
            + +  L+YYSN+TYI L +    TRI  I P+G D+FILSG+GS+NG  L NQ++YNL+ 
Sbjct: 83   SQNH-LIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGTGSLNGFELSNQLVYNLTD 141

Query: 138  LSMARIFTQSLGSVEAVLVNDTS---VYFGGNFSYN-NGSMTGHGALVWDSTSNTTQLLP 193
            LS+  IF   L      +  D     VYFGGNFSY    S   +G ++WDS+SN T    
Sbjct: 142  LSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGLIIWDSSSNDTISYE 201

Query: 194  FGGFGEDSNVNSIVKLNDDNILFAGKFYXXXXXXXXX-----XXXXXXXXXXXXXXXXXX 248
            FGGFG +S +N+I+KLN +++LF+G+FY                                
Sbjct: 202  FGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPNNTSSLLSQQNVSTF 261

Query: 249  ELGQRIPLRYASWDSQGSTTF-ESSYLVCPDTSKDAWLYPGTSGSLVCTLPYEVAPTKIR 307
            EL QRIPL +  + +  +  +   + L+CP +  +AW     +GSL  TLP+ + P+KIR
Sbjct: 262  ELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSKAGSLQITLPFSIRPSKIR 321

Query: 308  LYNSPNSDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVS 367
            ++NSP+ D++++ F+I      SIM+L YLDP+ G+L+ C EFCPLY+R+ L   + N +
Sbjct: 322  IFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLYNRNQLKLFNSNDN 381

Query: 368  SSLDMISFIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQDTF 427
                +I+ +DNN TD+KWS+ +Q+FAF N+  +T+L+F AL+SYG++VGLSGL L+Q   
Sbjct: 382  LKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGSRVGLSGLSLFQSDI 441

Query: 428  STYANNSLNEYGC---SALAND------------SSSSILSDNKWYDGLTGQSYIAIDYV 472
            + +AN S N+  C   +A  N+            SS SILSDN WY  L    Y+A  Y+
Sbjct: 442  AVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWYTPLPNSDYLACTYL 501

Query: 473  PNQTKPTPTVTFYPSIIHPGHYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYL 532
             + +K  PTVTFYP++++ G+YT++  TPGC  DN+C SRGIVNVTMWN  ++++++T L
Sbjct: 502  -SSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSSILQTSL 560

Query: 533  IYQNNNNLKYDKIYSGYLDFSPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLS 592
            IYQ N N K+D+I++GYLD   +I M + SG+Y++     +VAD++N+I +SLD  ++ S
Sbjct: 561  IYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRINLIINSLDFVTTTS 620

Query: 593  ETTSVKRHTPLNGILQYQRSNFTATTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKK- 651
                   +  LNG+ QY   N  +  +      N+T+N ++  NYP N S+ A  YDK  
Sbjct: 621  SNEIDIYNVTLNGLFQYPEYN--SVNNLNENYTNSTINQYAYSNYPANVSLIAAAYDKDT 678

Query: 652  LILGGKDNHISVIDFNDNLEVTSSENKTIQ-GDVYGMTQTNQGLLIFGDVRSSDNKSTVL 710
            L++GG  N +       N +  S +N       V G+   + GL+ +GD+  S      +
Sbjct: 679  LLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSDGLIAYGDIMDSSGSYKAI 738

Query: 711  MF-NGSFESVSNYSKAVENAINITLANN-DLIVFNNDYIFNAXXXXXXXXXXXXXXXXXX 768
             F N  F ++ N++  +++  NI+L  + +++ FNN Y +N                   
Sbjct: 739  TFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFKNTSTFELSLWS 798

Query: 769  AGNNDNDDVLFSGAVSQMQFSDLSGSARFLNESTVEALNLNKGIVPYLGAYLNESTIAYA 828
            AG N  +D++FSG VS+ +  +L+G         ++ LNL   I PY   +LN+S+  YA
Sbjct: 799  AGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKELNLGNNIYPYSAVFLNDSSTIYA 858

Query: 829  Y--KTNSLSKIYFXXXXXXXXXXXXXITKMVYANNQTLLVIG--SESSTTAELSILNLRN 884
            Y      L+++               I+ M +  N++LL +G  S+       SILNL +
Sbjct: 859  YMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLSVGTISDKDVFPSFSILNLTS 918

Query: 885  FTTIANETLGSNAKINAFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNT 944
               IANETL  N++I++ + F KNSS+LVGG+F  S   C+GLC++NYE+K+WSTF NNT
Sbjct: 919  NKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLFNYETKNWSTFMNNT 978

Query: 945  IVGEITQLAFNNESELIISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSGGKLNSFTVTE 1004
            + G +++L   N S ++ISG  +T K  +I L   NL    +  LL  +   L SF  T 
Sbjct: 979  LEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNVSILLQNT--NLTSFEFTG 1036

Query: 1005 ESIVAWNDTSLLIYKDQKWNTTSLPGNGSSVS----SVTTIDTNTDSYALRKRATTDAEK 1060
              I AWN ++L  Y ++ W+   LP    S+     S+  I     S  L KRA  D   
Sbjct: 1037 NQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKNSSSILEKRALRDT-- 1094

Query: 1061 GSILLLNGNFSIPQYGNLQGLLFDSQNWTPYF----TSETLEASSYNPTIFINRDVSADF 1116
             +I++  G F     G +Q L + S  W PYF    T+    ++S N  IF N+D+S+  
Sbjct: 1095 -NIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSIN--IFPNKDISSKI 1151

Query: 1117 NSQIPLSNSNMTVT----------------------XXXXXXXXXXXXXXXXXXXXXXXX 1154
             S   L N N  ++                                              
Sbjct: 1152 ISDFVLKNWNFNLSDVGNSTNTTNSTNTTSTTNLTSPSNTTSPQPSSSIIPIIGKQQNKK 1211

Query: 1155 XNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIKPRIDENEMLDTVPPE 1214
              + RGFVVLIGLAL+L TV++LGI G++L+++F+D  GDY  +KPR  E+EM D VPPE
Sbjct: 1212 HKIQRGFVVLIGLALSLATVALLGIFGILLSFIFRDSRGDYESLKPRTTEHEMFDAVPPE 1271

Query: 1215 KLMKFV 1220
            KLM FV
Sbjct: 1272 KLMPFV 1277

>KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1214

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/1222 (34%), Positives = 672/1222 (54%), Gaps = 48/1222 (3%)

Query: 20   ASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSETN 79
             S L ++++ L +E   +P+L++S+  +N +Q+LG    ++  +Y+GQ+NFT E+ S   
Sbjct: 20   GSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNFTGEV-SGNP 78

Query: 80   SRGLVYYSNNTYILL---EEADEDTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLS 136
               L+YYSN T++ +    ++ E   +D I PF  D+FILSG+GSI+G  L  Q+L+NLS
Sbjct: 79   ENALIYYSNETFLEIYSSSDSSEVFSVDHIVPFKDDAFILSGAGSISGHQLSRQLLFNLS 138

Query: 137  TLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFGG 196
            +L    IF Q L  V  +  N   V+FGG+F Y   + T H  LVWDS  +  ++LPFGG
Sbjct: 139  SLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIKDGVEVLPFGG 198

Query: 197  FGEDSNVNSIVKLNDDNILFAGKFYXXXXXXXXXXXXXXXXXXXXXXXXXXXELGQRIPL 256
            FG++S VNSI+ L++ NILFAG F                            ELG +I L
Sbjct: 199  FGKNSTVNSILNLDNSNILFAGNF-----SAVDNTQQLNNINVSNTSNTSVPELGHQISL 253

Query: 257  RYASWDSQGSTTFESSYLVCPDTSKDAWLYPG-TSGSLVCTLPYEVAPTKIRLYNSPNSD 315
            + A+W S G  T + S + CP T    WL  G T G     +P E  P+K+R++N+ +SD
Sbjct: 254  QSAAWVSDG--TLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPSKLRVFNARDSD 311

Query: 316  NDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMISF 375
              +SLF+I+T PS  IMNLTYLDP +GEL SCD +CPL S   L   S   S   D + +
Sbjct: 312  EQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDISSK-SYPGDQVQY 370

Query: 376  IDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNSL 435
             +N  T ++WS  FQDFAF N + V+ L F AL+SYG+ VGL+G+ELY+  +S YANN+L
Sbjct: 371  FENRTT-LQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAYSVYANNTL 429

Query: 436  NEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPGHYT 495
            N   C+  +  S++ + + + W  G +  +Y++     ++T P   V FYPSII+PG YT
Sbjct: 430  NAPNCAQGSATSNALLSNSSAWDSGSSEGNYLSTSVQDSETNPF--VIFYPSIIYPGVYT 487

Query: 496  INTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDFSPE 555
            I+  TPGC++D++C +RGI+N T+ + QNNT++++  IYQNN+  K+D +YSG+LD   +
Sbjct: 488  IDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSGFLDSEVK 547

Query: 556  IVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRHTPLNGILQYQRSNFT 615
            + +++   I +     +MVA ++ +  +  D     + T+       +NG+L Y  SN +
Sbjct: 548  VTLEFDGAINSGTEVPVMVASKIVVNIEDFDQSVFENNTSGF-----INGLLHYSTSNTS 602

Query: 616  ATTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNHISVIDFNDNLEVTSS 675
            +  S     + T L  +SV   PK+S++FA++++  L+L   D  ++ +   +NL +   
Sbjct: 603  SFLSELGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLANNLSIEEY 662

Query: 676  ENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVSNYSKAVENAINITLA 735
              +TI  D+  +++ + GL+I G    S ++     FNG+F +++ ++  V    N+TL 
Sbjct: 663  TFETIGKDISTISEYSGGLIIVGTFNGS-SEPAARGFNGTFFNLTEFNSTVRTFSNLTLG 721

Query: 736  NNDLIVFNNDYIFNAXXXXXXXXXXXXXXXXXXAGNNDNDDVLFSGAVSQMQFSDLSGSA 795
              ++++F+ + I N                   AG N  +D LF G V Q  +++L+GS 
Sbjct: 722  QTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDYTNLNGS- 780

Query: 796  RFLNESTVEALNLN----KGIVPYLGAYLNESTIAYAY-----KTNS--LSKIYFXXXXX 844
             F   +  E ++ N     G +PY  A+++ ST AYAY      +NS  +S +       
Sbjct: 781  -FFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMNDSGSTV 839

Query: 845  XXXXXXXXITKMVYANNQTLLVI-GSESSTTAELSILNLRNFTTIANETLGSNAKINAFV 903
                    +  M  + N +LL I G +  T ++L + N  +  ++A+    S   +N+ +
Sbjct: 840  QLSAWSGKVGAMASSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYKWDSEISLNSII 899

Query: 904  NFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESELIIS 963
             F +N+S+LVGG F+++   C+GLC++NY+ K WS F NN+I G I ++   N S L+I+
Sbjct: 900  FFARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLLIA 959

Query: 964  GLFATEKQQSIRLGSFNLTNSTMVPLLTGSGGKLNSFTVTEES---IVAWNDTSLLIYKD 1020
            G F   +   + L S  L +S+   L  G+   LN F   + S   +VA++DTSLL  + 
Sbjct: 960  GSFRLNETDGVSLASICLKDSSSEILHEGN-ITLNGFVSMDGSSNNVVAFSDTSLLQLES 1018

Query: 1021 QKWNTTSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQG 1080
             KW   S   N +  S    +D        RK+    + K  +LL+ G+    ++G++  
Sbjct: 1019 GKWQQIST--NFTENSKFKGLDVFPLKDTTRKQKRDSSSK--VLLITGSLQHAKFGSINA 1074

Query: 1081 LLFDSQNWTPYFTSETLEASSYNPT--IFINRDVSADFNSQIPLSNSNMTVTXXXXXXXX 1138
              +DS  WTP+ +S    +SS   T  +F+NRD+S   + +  L  +  + T        
Sbjct: 1075 AFYDSGEWTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQGTFSSNT--SSGTSG 1132

Query: 1139 XXXXXXXXXXXXXXXXXNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPI 1198
                              +DRGF+VLI LALALGT++VLG++GVI +Y F D    Y+  
Sbjct: 1133 TPSPSGSSPSNLQRKKKKIDRGFIVLISLALALGTLAVLGLLGVIFSYFFGDSGDGYQLS 1192

Query: 1199 KPRIDENEMLDTVPPEKLMKFV 1220
            KPR DENEM+DTVPPEKLM+F+
Sbjct: 1193 KPRTDENEMIDTVPPEKLMRFI 1214

>Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] {ON}
            YLR084C (RAX2) - YLR084C [contig 176] FULL
          Length = 1213

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/1221 (35%), Positives = 664/1221 (54%), Gaps = 47/1221 (3%)

Query: 20   ASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSETN 79
             + L +I++ L +++  +PSL++S  N+  IQ+LG    L++Y YTGQ NFT  I  E  
Sbjct: 20   GTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRYTGQDNFTG-ISDEKA 78

Query: 80   SRGLVYYSNNTYILL---EEADEDTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLS 136
               L+Y+SN T + L   + ++E   +D + P   DSFILSG+G+I+G  L +QV++NLS
Sbjct: 79   RESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISGAVLDHQVVFNLS 138

Query: 137  TLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFGG 196
             LS   IF QSL  V A+ VN    YFGG+F +       HG +VWD   N  + LPFGG
Sbjct: 139  DLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIVWDFVKNEVETLPFGG 198

Query: 197  FGEDSNVNSIVKLNDDNILFAGKFYXXXXXXXXXXXXXXXXXXXXXXXXXXXELGQRIPL 256
             G+DSNVNSI+ L+D+NILFAG F                            EL  +IPL
Sbjct: 199  LGKDSNVNSILVLDDNNILFAGNF-----STIDEKSALNSTLGINSTSDSAPELSHKIPL 253

Query: 257  RYASWDSQGSTTFESSYLVCP-DTSKDAWLYPGTSGSLVCTLPYEVAPTKIRLYNSPNSD 315
            + A W S GS   +   LVCP +++  AWL  GT+G    ++ + + P+K+RL+N+   D
Sbjct: 254  KTAKWTSDGS--LQKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIRPSKLRLHNARTLD 311

Query: 316  NDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMISF 375
             ++SLF+++T PS  IMNLTYLDP SGEL++CD +CPL S   L +A+++ ++S D + F
Sbjct: 312  EEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNL-TAAKSKAASTDQVEF 370

Query: 376  IDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNSL 435
            + NN T V+WS  +QDFAF N + VTS+ F AL+SYG+ VG++G ELY+D FS YAN+S 
Sbjct: 371  L-NNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYEDDFSVYANDSF 429

Query: 436  NEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPGHYT 495
            N   CS+ +N S +S LS ++W  G + + Y+    +   ++  P+VTFYP I++ G YT
Sbjct: 430  NVPDCSSTSNYSKAS-LSASQWDQGSSDEDYVYT--LVENSQEAPSVTFYPQIVYSGLYT 486

Query: 496  INTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDFSPE 555
            IN  TPGC+ D +C SR +VN ++W+  N T++ +  IYQNN+  KYD +YSGYL+   +
Sbjct: 487  INVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLYSGYLENEVK 546

Query: 556  IVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRHTPLNGILQYQRSNFT 615
            +V++Y   I  +  + +MVA Q+++ TD  DS    S  T   +   LNG+L Y  SN +
Sbjct: 547  VVLEYEGAIGNTEGSPMMVAGQISVNTDEFDS----SVFTDKYKTGKLNGLLHYSLSNSS 602

Query: 616  ATTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNHISVIDFNDNLEVTSS 675
            +   N     +T L  +SV N+ KNS+ F D +   ++L      +S ++ +   +V + 
Sbjct: 603  SYLQNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVSKLEIDQQFDVRTV 662

Query: 676  ENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVSNYSKAVENAINITLA 735
              + +  +V G+   ++GL + G    S   +    +NGSF  +      V    N TL 
Sbjct: 663  TTEEVGDEVSGVFAFSEGLGVIGTFDGSTKGAK--FYNGSFFDIPLSHSNVTTFTNFTLD 720

Query: 736  NNDLIVFNNDYIFNAXXXXXXXXXXXXXXXXXXAGNNDNDDVLFSGAVSQMQFSDLSGSA 795
              +L+   N Y  N                   AG N+  + +F G++++ +++DL+GS 
Sbjct: 721  GAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGSLTRNEYTDLNGSF 780

Query: 796  RFLNESTVEA-LNLNKGIVPYLGAYLNESTIAYAY----KTNSLSKIYFXXXXXXXXXXX 850
               + S   + L  ++G + Y   Y++ ST  YA+     TN    +             
Sbjct: 781  FISSNSQSSSRLRGSQGRIWYDATYIDNSTTGYAFYDPSSTNGSYGVSIYKDMAKERDLS 840

Query: 851  XXITKMV----YANNQTLLVIGSESSTTA-ELSILNLRNFTTIANETLGSNAKINAFVNF 905
               T MV    Y+ N +LL +G ++ T + +L + NL      A     +N  IN+ + F
Sbjct: 841  YRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNLTTGEDTATFEWKTNVSINSLIFF 900

Query: 906  EKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESELIISGL 965
            ++N+S+LVGGDF  S+ NC+GLC+++YE K WS FF+N I G I  +   N+S L++ G 
Sbjct: 901  DQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIHSMKIFNKSSLVLGGF 960

Query: 966  FATEKQQSIRLGSFNLTNSTMVPLLTGSGGKLNSFTV--TEESIVAWNDTSLLIYKDQKW 1023
            F     + + L S +LT+ +   L  G+   L+   V    +++VA +   L    +  W
Sbjct: 961  FDINDTKQVNLASMSLTDGSYNILHQGTETILDFIFVDGKVDNLVAVSANDLFRLTNNNW 1020

Query: 1024 NTTSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQGLLF 1083
             + S   + SSV    +          +KR   + EK S LL+ G+     YG +   L+
Sbjct: 1021 ESISAQFDDSSVFGGLSEFPIQQGGQNKKR---EEEKNS-LLITGDLLHKTYGKISAALY 1076

Query: 1084 DSQNWTPYFTSETLEASSYN----PTIFINRDVSADFNSQIPLSNSNMTVTXXXXXXXXX 1139
            D  +W PYF+  T  A+S +      I+ N+D+S+ FN Q  L +S              
Sbjct: 1077 DFNDWIPYFS--TTPATSTDGLGQSRIYSNKDISSAFNYQGVLQSSRG--GNSSSVPSGT 1132

Query: 1140 XXXXXXXXXXXXXXXXNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIK 1199
                             + RGFVVLIGLALA+GT++V+G++G+ L + F      Y+ ++
Sbjct: 1133 SSPTSSSPSQLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALTFFFGKSSDKYQSLE 1192

Query: 1200 PRIDENEMLDTVPPEKLMKFV 1220
            PR DE+EM+DTVPPEKLM+F+
Sbjct: 1193 PRADESEMIDTVPPEKLMRFI 1213

>CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084c
          Length = 1156

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/1187 (35%), Positives = 652/1187 (54%), Gaps = 38/1187 (3%)

Query: 40   LNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSETNSRGLVYYSNNTYILLEEADE 99
            LN S   +N IQ+LG ++  ++Y Y GQQNFT    S+ N   L+YYSNNT + L+    
Sbjct: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTASSSQ-NELELIYYSNNTLLRLDAVPT 60

Query: 100  DTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLSTLSMARIFTQSLGSVEAVLVNDT 159
            D  +  I PF  D FILSG G+I+G+ L  Q+L NL+ LS   IF + LG V+++ V++ 
Sbjct: 61   DVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNE 120

Query: 160  SVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFGGFGEDSNVNSIVKLNDDNILFAGK 219
             VYFGG+ +YNN  ++G   + W+ST+N++ LLPFGGFG +S VNSI++L ++N+LF G+
Sbjct: 121  VVYFGGDITYNNNGVSGRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLENNNLLFTGQ 180

Query: 220  FYXXXXXXXXXXXXXXXXXXXXXXXXXXXELGQRIPLRYASWDSQGSTTFESSYLVCPDT 279
            F                            E+GQ+I LR A+W++  +   ++   +CP++
Sbjct: 181  F---AKLENNSFVSKTNRTRNFSISMEDSEVGQQISLRQATWNANSNLDVDA--FICPNS 235

Query: 280  SKDAWLYPGTSGSLVCTLPYEVAPTKIRLYNSPNSDNDISLFQILTNPSGSIMNLTYLDP 339
             + AW   G+ G + C  P  +  +KIR+YN+P +DN ISLF+++  P   I+NLTYLDP
Sbjct: 236  DQQAWYSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDP 295

Query: 340  ISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMISFIDNNNTDVKWSSDFQDFAFANELS 399
            IS +++ C E CPL++R+TLL+A  NV+   D+I FI+NN+T++KW+  +Q+FAF N+L 
Sbjct: 296  ISHDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLP 355

Query: 400  VTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNSLNEYGCSALANDSSSSI-LSDNKWY 458
            +TSL+F A NSY   VGLSG ++YQD+F  + NNS NE  C + +ND +S + LS N W+
Sbjct: 356  ITSLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPS-SNDIASYVKLSGNGWF 414

Query: 459  DGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPGHYTINTYTPGCVQDNTCSSRGIVNVT 518
                  SY+A  Y+PNQ    P++T++  I  PG Y +N  TPGC +DNTCS+RGIVNVT
Sbjct: 415  TVANDNSYLANSYIPNQ-GTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVT 473

Query: 519  MWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDFSPEIVMKYVSGIYASNTATIMVADQV 578
             ++  N  ++ + LIYQNNNNLKYD+I++G L+ S  + ++Y SGI  +NT T  V   V
Sbjct: 474  TFDNSNGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGI-NTNTGTATVVVGV 532

Query: 579  NIITDSLDSFSSLSETTSVKRHTPLNGILQYQRSNFTATTSNGT-KIANTTLNLFSVDNY 637
              +     S   +S+     R   LNGI +Y  SNFT      T KI  T L+ F V N+
Sbjct: 533  VDVVRVSISSEFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNF 592

Query: 638  PKNSSMFADVYDKKLILGGKDNHISVIDFNDNLEVTSSENKTIQGDVYGMTQTNQGLLIF 697
             K +S+FA   ++ L LG  +  +  ++  +   V S+EN  + G + GM    +GL+IF
Sbjct: 593  NKGASIFAVDQNQNLYLGSTNGSVYELNSLNGSSVPSTENN-LSGLINGMYSVEEGLVIF 651

Query: 698  GDVRSSDNKSTVLMFNGS---FESVSNYSKAVENAINITLANNDLIVFNNDYIFNAXXXX 754
            G +     +   ++ N S    + V+N   +++ + N TL  ++L+VF+N  IFN     
Sbjct: 652  GSIAHRGREYGAVILNKSITPLDIVAN--DSIQASFNSTLFGSNLLVFDNSTIFNMTSFM 709

Query: 755  XXXXXXXXXXXXXXAGNNDNDDVLFSGAVSQMQFSDLSGSARFLNESTVEALNLNKGIVP 814
                          AG N NDD+L  G +     +  + S    +  T    +L+     
Sbjct: 710  VFENTSYRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTI 769

Query: 815  YLGAYLNESTIAYAYKTNSLSKIYFXXXXXXXXXXXXXITKMVYANNQTLLVIGSESSTT 874
                YLN++   Y+  + +++                 +  + Y+N Q LL    E+S  
Sbjct: 770  EGAIYLNDTKALYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLLGAIQENSNK 829

Query: 875  AELSILNLRNFTTIANETLGSNAKINAFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYES 934
            +++ +++L +   I +    +  KINA VNF  N++ LVGGDF +S P C GLC+YNY +
Sbjct: 830  SQIVLIDLFSSQVINDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACVGLCLYNYNN 889

Query: 935  KSWSTFFNNTIVGEITQLAFNNESELIISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSG 994
             +WS+F NN+I G I+Q+ F N++++++SG     K   I L S NLT++    LL  + 
Sbjct: 890  SNWSSFLNNSITGNISQIKF-NDTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNS 948

Query: 995  GKLNSFTVTEESIVAWNDTSLLIYKDQKWNTTSLPGNGSSVSSVTTIDTNTDSYALRKRA 1054
              L+ F +    +V WN T + I    +W+  ++  +G++ +             + +  
Sbjct: 949  VVLDDFILVRNLVVGWNSTDIFIRNVTQWSNLNIFDDGTNAT-------------INRIE 995

Query: 1055 TTDAEKGSILLLNGNFSIPQYGNLQGLLFDSQNWTPYFTSETLEASSYNPTIFINRDVSA 1114
               A+    L++ G F   +YG +  +++D  +W PYF  + +  ++  P  F +RD S+
Sbjct: 996  NFGADSNPALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVVSQTA-TPLFFADRDQSS 1054

Query: 1115 DFNSQIPLSNSNMTVTXXXXXXXXXXXXXXXXXXXXXXXXXNMDRGFVVLIGLALALGTV 1174
              N++  + +  +  +                          + RGFVVLIGLALAL T+
Sbjct: 1055 YGNTRHVVPDHIIVSSSHSSSAPSSSSSHKTNEKPYK-----IRRGFVVLIGLALALATL 1109

Query: 1175 SVLGIVGVILAYVFKDP-EGDYRPIKPRIDENEMLDTVPPEKLMKFV 1220
             VLGI GV++A +F     GDY  IK    +N     + PEKL++ +
Sbjct: 1110 IVLGITGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIRVL 1156

>AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR084C (RAX2)
          Length = 1201

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/1237 (33%), Positives = 645/1237 (52%), Gaps = 89/1237 (7%)

Query: 19   KASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSET 78
            + S L+S+    DI+    P L++S   +  + +     A  +Y Y GQQ FT +   + 
Sbjct: 19   RGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFEYYNYKGQQLFTGQEQHQG 78

Query: 79   NSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLSTL 138
            +S  L+YYS  TY+ L + D+DT + +I PFG+DSFILSG+G +    L +Q++YNLSTL
Sbjct: 79   SS--LIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTGKLQDQRLEHQLMYNLSTL 136

Query: 139  SMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFGGFG 198
             +  I  QSL SV  +LV+   VYFGG F+Y++G+ +GH A+ W++TS TT LLPFGGFG
Sbjct: 137  EVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQWNATSRTTSLLPFGGFG 196

Query: 199  EDSNVNSIVKLNDDNILFAGKFYXXXXXXXXXXXXXXXXXXXXXXXXXXXELGQRIPLRY 258
              S+VN+I+KL+   +LF G+F                            E      LRY
Sbjct: 197  RGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEKPQLNVTTIETNALTSLRY 256

Query: 259  ASWDSQGSTTFESSYLVCPDTSKDAWLYPGT-----SGSLVCTLPYEVAPTKIRLYNSPN 313
            ++  S G    +    +CP ++ D+W  P +      G L   + + + P+KIR+YNS  
Sbjct: 257  STITSDGH--LDKGKFICPTSNDDSWFVPHSGDGPARGELNIKVLHRIIPSKIRIYNSKK 314

Query: 314  SDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMI 373
            + N+I LF+I+T+PS SIMN+TY+DP +GEL +CD +CPL  R  L S +   S   D+ 
Sbjct: 315  NGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNLTSKAAE-SGPADVA 373

Query: 374  SFIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYANN 433
              +++    +KW+ D+Q+FAF N++ +  +KF AL+SYGN VGL G+EL+Q  +  Y N+
Sbjct: 374  RLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGVELFQTEYDAYVNS 433

Query: 434  SLNEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPGH 493
            +LN+  C        S+  + N W+ G T  SY++ + V    +  P V   P I H G 
Sbjct: 434  TLNQPNCGEQQLSPFST--TANIWHQGATDASYLSANVV----ESNPMVNVKPVIPHSGT 487

Query: 494  YTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDFS 553
            YT+N YTPGC  D TC  RGIVNVT+      T+M T  IYQNN  LKYD +Y+G+LD +
Sbjct: 488  YTLNLYTPGCEDDGTCDYRGIVNVTLLASNGTTLM-TRWIYQNNYRLKYDPLYTGHLDPN 546

Query: 554  PEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRHTPLNGILQYQRSN 613
            P + M++VS I ++    IMVAD+V+ I DSLD    +       R   LNG+ QY    
Sbjct: 547  PTVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRH----PREKSLNGLFQY---- 598

Query: 614  FTATTSNGTKIANTTLNLFSVD---NYPKNSSMFADVYDKKLILGGKD-NHISVI----- 664
                T  G+ + N      + D   + P+  S+   VYD KLILG K   HI+V+     
Sbjct: 599  ----TPAGSSLDNGIQKYINKDPQTDMPEGVSLVGQVYDGKLILGVKSTGHIAVVTPKGT 654

Query: 665  DFNDNLEVTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVSNYSK 724
            D+ND ++VT  +   + G + G++  ++GL+  G    S   S+ L ++G+F S  + + 
Sbjct: 655  DWND-VDVTRQD---VPGSLNGISPYSKGLVFTGKFNLSSGPSSALHYDGNFGSFFDLNS 710

Query: 725  AVENAINITLANNDLIVFNNDYIFNAXXXXXXXXXXXXXXXXXXAGNNDNDDVLFSGAVS 784
               + IN+T+  ++L++FNN +I+N                   A N++ND +LF+G+++
Sbjct: 711  ETSSIINMTIDGSELLLFNNKFIYNTSTSQMLTSSMFQLSALSAAANSNND-LLFTGSIA 769

Query: 785  QMQFSDLSGSARFLNESTV--EALNLNKGIVPYLGAYLNESTIAYAYKTNSLSK------ 836
             ++     G+     E  +         G   + G YLN++  AYAY + S +       
Sbjct: 770  DIKHGSAHGAVALDAEGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVATGG 829

Query: 837  --IYFXXXXXXXXXXXXXITKMVYANNQTLLVIGSES--STTAELSILNLRNFTTIANET 892
              I               + +M+Y      LVI +     T   L + +LR    +A E 
Sbjct: 830  VVIETPGNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEVAREK 889

Query: 893  LGSNAKINAFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQL 952
            L    +IN+ V F ++++LLVGG F+  K  C  LC+YN+  +SWS F +  I GEI QL
Sbjct: 890  LNPGERINSIVLFGEDNTLLVGGSFE--KDGCHDLCLYNFVKRSWSAFASGLISGEIKQL 947

Query: 953  AFNNESELIISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSGGK-LNSFTVTEES---IV 1008
             F N   LI  G    + + +I   +F+L  S +V       G+  NS     +S    V
Sbjct: 948  QFVNNRNLIAVGSMTVQSRPNILFLNFDLVRSRVVEQHEQPNGRAFNSVLTIGDSGDEYV 1007

Query: 1009 AWNDTSLLIYKDQKWNT-TSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLN 1067
            A +   +  Y   +W T T L G    +  ++ +  N +  +  KR     E   +++++
Sbjct: 1008 AEDGKQVWHYSGSEWKTVTPLSGGQIRIDGISLLMLN-NPRSQNKRNRVGNE---LVVIH 1063

Query: 1068 GNFSIPQYGNLQGLLFDSQNWTPYF----TSETLEASSYNPTIFINRDVSADFNSQIPLS 1123
            G  +  +YG +  + ++ +NW PY+    +S   E +     IF+N+D+S    + +PL 
Sbjct: 1064 GQMNSSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQDISRQTTTSLPLE 1123

Query: 1124 NSNMTVTXXXXXXXXXXXXXXXXXXXXXXXXXNMDRGFVVLIGLALALGTVSVLGIVGVI 1183
                                             + +G+VVLI L LAL T+++LGI+GVI
Sbjct: 1124 ------------------VVVSDSPPTAEPKRKLAKGYVVLIALGLALATIALLGIIGVI 1165

Query: 1184 LAYVFKDPEGDYRPIKPRIDENEMLDTVPPEKLMKFV 1220
            LAY F D    Y+P+KPRI+E+EML TVPPEKLMKF+
Sbjct: 1166 LAYAFGD-HNAYQPLKPRINEDEMLKTVPPEKLMKFI 1201

>KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084C RAX2 N-glycosylated protein involved in the
            maintenance of bud site selection during bipolar budding
            localization requires Rax1p
          Length = 1200

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/1233 (34%), Positives = 680/1233 (55%), Gaps = 82/1233 (6%)

Query: 19   KASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSET 78
            + SQL +I+ LL+I     P+ + S D    +  +   + L+   YTGQQNFT +     
Sbjct: 19   RGSQLSNIEKLLNISRYEAPNWD-SPD----LTYMNNFEELTVISYTGQQNFTVQ----A 69

Query: 79   NSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLSTL 138
            N   L+YYSN+T++ L E   +T +  I P   DSFILSG+G INGV L  Q+L NL++L
Sbjct: 70   NESSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVALEQQILLNLTSL 129

Query: 139  SMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFGGFG 198
            + + IF  ++ +V  +L  + +V F GNFS +  + TGHGA++WD  +NTT+L PF GFG
Sbjct: 130  TTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVANTTELFPFKGFG 189

Query: 199  EDSNVNSIVKLNDDNILFAGKFYXXXXXXXXXXXXXXXXXXXXXXXXXXXELGQRIPLRY 258
            E+S VNS+VKLN DNILFAG F                            +  Q +PL+ 
Sbjct: 190  ENSIVNSVVKLNSDNILFAGSF--QEIQNASLLQEFGNATNSSHEDLTSLQFDQSVPLKL 247

Query: 259  ASWDSQGSTTFESSYLVCPDTSKDAW-LYPGTSGSLVCTLPYEVAPTKIRLYNSPNSDND 317
            +S   +     +S  L+CP   ++ W        +L   L  E+ P+K+R+YNS   +++
Sbjct: 248  SSITGEN---VQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIYNSVEENSE 304

Query: 318  ISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMISFID 377
            ISLF+I+T PS  IMNLTYLDP SGEL+ CD +CPL S + L   SQN +++   +  I+
Sbjct: 305  ISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAAPKSVG-IN 363

Query: 378  NNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNSLNE 437
            NN+T++KWS  +Q+FAF N++ VT L+F AL SYG+   L  +E+++  F  YANNS NE
Sbjct: 364  NNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMVYANNSYNE 423

Query: 438  YGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPGHYTIN 497
              C ++   S + + SDN WY      +YI+ +   N     P VTF+P+I +PG YT N
Sbjct: 424  PNCESVTEYSKAELSSDN-WYTTDESDTYISTNIDDN----IPYVTFHPNITYPGRYTFN 478

Query: 498  TYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDFSPEIV 557
             YTPGC+QDN+CS RGIVNVTM +   N ++ + LIYQ NN  K+D +Y+G L  +PEI+
Sbjct: 479  IYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSLGSAPEII 538

Query: 558  MKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRHTPLNGILQYQRSNFTAT 617
            + +   I  S+  ++MV D++ +IT+ +D+ S  S  T+      LNG+ QY  +N TA+
Sbjct: 539  VTWDKAIGESD--SVMVVDRLGVITEYIDTISISSNDTTFH----LNGLFQYNTANVTAS 592

Query: 618  TSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNHISVIDFNDNLEVTSSEN 677
              +     N T N +++ N+P +++++A   +  +++GG  N I+ ++ ND   ++SS+ 
Sbjct: 593  IFS----TNDTFNDYALYNFPLDANLYAASLNNDILIGGNFNGIAKVELNDEALISSSQK 648

Query: 678  KTIQGDVYGMTQTNQGLLIFGDVR-SSDNKSTVLMFNG-SFESVSNYSKAVENAINITLA 735
                G   G+ + + GLL+ G  +  +D++  +L ++G +F S     + ++  +N T+ 
Sbjct: 649  LGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEPIDRIVNFTID 708

Query: 736  NNDLIVFNNDYIFNAXXXXXXXXXXXXXXXXXXAGNNDNDDVLFSGAVSQMQFSDLSGSA 795
             ++L++F+N YIFN                   AG N  +D L  G+  +    +L+G A
Sbjct: 709  GHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLKRSVGELNGLA 768

Query: 796  RFLNESTVEALNLNK---GIVPYLGAYLNESTIAYAYKTNSLSKIYFXXXXXXXXXXXXX 852
               ++  V +  L +    + PY  AY+N+++ AYA +  S   +               
Sbjct: 769  SLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVLITNTNSSSHM 828

Query: 853  --------ITKMVYANNQTLLVIGSESSTTA-----ELSILNLRNFTTIANETLGSNAKI 899
                    I   +Y N   +L IG+  S ++     + SILNL  +  +A     +N ++
Sbjct: 829  LQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENVARVNFSTNERV 888

Query: 900  NAFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESE 959
            N+ V+F  N+S+LVGG +++   NC  LC+YNY++K W++F N++I G+I Q+ F +E +
Sbjct: 889  NSMVSFSSNNSILVGGSYEID--NCNDLCLYNYQTKEWTSFLNDSITGDIRQMQFADEGK 946

Query: 960  -LIISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSGGKLNSFTVTEES---IVAWNDTSL 1015
             L++ GL  T  + +I+L S  + ++    + +G+   L SF   ++S   I+A  ++ +
Sbjct: 947  TLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTEPLL-SFVPIDDSTDNIIAQMNSEI 1005

Query: 1016 LIYKDQKWNTTSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQY 1075
            L  +   W++     N  S+ S   + + T+S   +KR     E   I+LL G  +  ++
Sbjct: 1006 LRLESGTWSSFGPQLNNDSIVSGFKVLSGTES---KKR----DEGSHIVLLEGTLNSSEW 1058

Query: 1076 GNLQGLLFD--SQNWTPYFT------SETLEASSYNPTIFINRDVSADFNSQIPLSNSNM 1127
            GNL  +++D  +Q W PYF        E+L +SS+    F N +     +SQ  L ++N 
Sbjct: 1059 GNLTSVVYDGSTQKWQPYFVISDPKEQESLPSSSF----FQNVNDLYLSSSQTVLQSNN- 1113

Query: 1128 TVTXXXXXXXXXXXXXXXXXXXXXXXXXNMDRGFVVLIGLALALGTVSVLGIVGVILAYV 1187
                                         +DRGF+VLIGLALAL TV+V+G++G ++ Y 
Sbjct: 1114 -----SDTSASSTPTPSTTSSSHSTKDKKIDRGFIVLIGLALALATVAVIGLIGALICYF 1168

Query: 1188 FKDPEGDYRPIKPRIDENEMLDTVPPEKLMKFV 1220
            F +  G Y  +KPRI+++EMLDTVPPEKLMKF+
Sbjct: 1169 FINNNG-YESLKPRINQDEMLDTVPPEKLMKFI 1200

>Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar to
            Ashbya gossypii AGR095W
          Length = 1212

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/1250 (35%), Positives = 670/1250 (53%), Gaps = 68/1250 (5%)

Query: 1    MFVHRXXXXXXXXXXXGSKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALS 60
            M++H+            ++ SQ+  +    +I     P L++S   ++ + I        
Sbjct: 1    MYIHKYTLLVLSFVAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFD 60

Query: 61   FYEYTGQQNFTKEIGSETNSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSG 120
            +Y Y GQQ FT       NS  L+YYSNNTY+ L E  +   I KI P+G DSFILSG G
Sbjct: 61   YYTYKGQQIFTGLADERKNS--LIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRG 118

Query: 121  SINGVPLGNQVLYNLSTLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGAL 180
               G  L +Q++YNLS+  +  I  + L  V  +L +   VYFGG F+YN+G+++GH  +
Sbjct: 119  VFEGHRLEHQLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVV 178

Query: 181  VWDSTSNTTQLLPFGGFGEDSNVNSIVKLNDDNILFAGKFYXXXXXXXXXXXXXXXXXXX 240
             WD+T  ++ LLPF GFG+ S VN+I+KL+D NILF GKF                    
Sbjct: 179  KWDATDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSFLS 238

Query: 241  XXXXXXXXELGQRIPLRYASWDSQGSTTFESSYLVCPDTSKDAWLYP-GTSGSLVCTLPY 299
                     L     LR++S    G  T  SS  VCP+ S D+W  P  T G L   +  
Sbjct: 239  NSTNIETNALAS---LRFSSLVHDG--TLNSSAFVCPEGSADSWTIPHSTMGELTIRVIN 293

Query: 300  EVAPTKIRLYNSPNSDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTL 359
            ++ P+KIR+YNS +S+N ++LF+I+T+PS SIMN+TY+DPI+G L  CD +CPL     L
Sbjct: 294  QMTPSKIRIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVL 353

Query: 360  LSASQNVSSSLDMISFIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSG 419
             + ++N +SS+ M +F +NNN  VKW++ +Q+FAF N + +  L F A++S+G+ VGL G
Sbjct: 354  SNLAENSTSSV-MAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLG 412

Query: 420  LELYQDTFSTYANNSLNEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPT 479
            +EL+Q  + TY NN+LN+  C +  N  +S +  D  WY GL  QSY+A  +    T   
Sbjct: 413  IELFQAEYDTYVNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSF----TAGK 468

Query: 480  PTVTFYPSIIHPGHYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNN 539
            P+VT  PSI +PG YT+N  TPGC+ DNTC+ RGIVNVT+   QN T +    IYQNN N
Sbjct: 469  PSVTLTPSIPYPGIYTLNLVTPGCLTDNTCAFRGIVNVTI-RAQNGTHLMNRWIYQNNEN 527

Query: 540  LKYDKIYSGYLDFSPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKR 599
            LKYD ++ GYLD SP +V++++  I  +    +MVAD+V  I DS++     + T++   
Sbjct: 528  LKYDPLFRGYLDDSPNVVLEWIGPIDPAAANNVMVADRVTSIIDSIEDLEMKNGTSNSNL 587

Query: 600  HTPLNGILQYQRSNFTATTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKD- 658
               LNG+ QY  SNFT  T+  T + +T ++ + V N P +SS+F  +Y+  L +G    
Sbjct: 588  ---LNGLFQYAASNFT-NTNLSTLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSI 643

Query: 659  NHISVI-----DFNDNLEVTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSD-NKSTVLMF 712
            + ++ I     D+ND   +   +    +G V G+   + GL +   V S+  N ++ L F
Sbjct: 644  DGLAKISRRKDDWND--IIVDPQLIDTEGPVTGIFPYSNGLAL--TVHSNQTNMASSLSF 699

Query: 713  NGSFESVSNYSKAVENAINITLANNDLIVFNNDYIFNAXXXXXXXXXXXXXXXXXXAGNN 772
            NGS  ++   +    + +N+T+  ++++VF+N Y++N                   AG N
Sbjct: 700  NGSISTIFRSNAPSLSILNLTIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGAN 759

Query: 773  DNDDVLFSGAVSQMQFSDLSGSARF---LNESTVEAL-NLNKGIVPYLGAYLNESTIAYA 828
              DD++ +G V   +    +G+       NE     L +++ GI+ Y G ++N+S+ AYA
Sbjct: 760  LEDDLILAGNVQSTKHFVPNGAIAIDADSNEVVTSGLPSVDDGII-YRGLFINDSSSAYA 818

Query: 829  YKTNSLSK------IYFXXXXXXXXXXXXXITKMVYANNQTLL--VIGSESSTTAELSIL 880
            Y + SL        +Y              +  M+Y  +  LL  V    S   A L I 
Sbjct: 819  YYSKSLGSSKGGIVVYGEHEPEYLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIH 878

Query: 881  NLRNFTTIANETLGSNAKINAFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTF 940
            +L        ET      IN  V F +N +LLVGG F  ++  C  LC+YNY + +W+ F
Sbjct: 879  DLSADFAPIKETFEIGEVINTMVLFGRNYTLLVGGTF--TRNGCRDLCLYNYATNNWTRF 936

Query: 941  FNNTIVGEITQLAFNNESELIISGLFATEKQQSIRLGSFNLTNSTMVPLLTG--SGGKLN 998
             +  I G+I QL F + + L+++GL A+   + ++L   +L+N  ++  L G  +G   +
Sbjct: 937  MDGNITGDIRQLQFLDGNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQH 996

Query: 999  SFTVTEES--IVAWNDTSLLIYKDQKWNTTSLPGNG-SSVSSVTTIDTN-TDSYALRKRA 1054
              TV   S  ++A +   +  + D +W   S   +G + ++ +T + T+ +   ++ KR 
Sbjct: 997  VLTVGNSSSELIAHDGNQVFHFVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKR- 1055

Query: 1055 TTDAEKGSILLLNGNFSIPQYGNLQGLLFDSQNWTPYFTSETLEASS----YNPTIFINR 1110
              D     ++++NGNFS P YG++  + +D   W PY+ S   E++S        +F+N+
Sbjct: 1056 --DRVGNELVVINGNFSSPDYGDINAMYYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNK 1113

Query: 1111 DVSADFNSQIPLSNSNMTVTXXXXXXXXXXXXXXXXXXXXXXXXXNMDRGFVVLIGLALA 1170
            DVS   +SQI LSN N                              + + FVVLI LALA
Sbjct: 1114 DVSFTSSSQIYLSNDN----------DNDDTPAASEPATHEKHTKKLAKIFVVLIALALA 1163

Query: 1171 LGTVSVLGIVGVILAYVFKDPEGDYRPIKPRIDENEMLDTVPPEKLMKFV 1220
            L TV+VLG+VGV+ AY+F D    Y P+KPRI+E EML TVPPEKLMKF+
Sbjct: 1164 LATVAVLGVVGVLFAYLFGD-HNAYEPLKPRINEAEMLKTVPPEKLMKFI 1212

>ZYRO0G12276g Chr7 complement(969552..971150) [1599 bp, 532 aa] {ON}
           weakly similar to uniprot|P47072 Saccharomyces
           cerevisiae YJL016W
          Length = 532

 Score = 35.8 bits (81), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 4/65 (6%)

Query: 869 SESSTTAELSILNLRNFTTIANETLGSNAKINAFVNFEKNSSLLVGGDF----QMSKPNC 924
           SE S ++E + L + +FT++ NE +  N +  +  +F+K SS L  G+     Q+ +PN 
Sbjct: 458 SEGSDSSETTALAMSHFTSLLNECIQRNPERESHFHFQKLSSTLGSGNHEKPSQIPQPNA 517

Query: 925 TGLCV 929
            G  V
Sbjct: 518 NGRAV 522

>KLTH0F04598g Chr6 (406984..407006,407069..409862) [2817 bp, 938 aa]
           {ON} similar to uniprot|P36048 Saccharomyces cerevisiae
           YKL173W SNU114 involved in splicing U5 snRNP- specific
           protein related to EF-2
          Length = 938

 Score = 33.1 bits (74), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 50/124 (40%), Gaps = 8/124 (6%)

Query: 298 PYEVAPTKIRLYNS-----PNSDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCP 352
           P E+   K  LY       P  + D   F  L       MN+T L P+     S  +   
Sbjct: 80  PAEINVKKQALYTESIKHLPRVNYDRDYFSTLHEIPERTMNVTILGPLHSGKTSLVDLLI 139

Query: 353 LYSRDTLLSASQNVSSSLDMISFIDNNNTDVKWSSDFQ--DFAF-ANELSVTSLKFTALN 409
           L +   L   S+NV      + ++DN   +++    ++   F+F A +L   S+  T L+
Sbjct: 140 LQAHKKLPGTSKNVREGWKPLKYMDNTKLEIERGISYKLNGFSFLATDLQQKSVALTVLD 199

Query: 410 SYGN 413
             G+
Sbjct: 200 CPGH 203

>Smik_10.154 Chr10 (260576..261574) [999 bp, 332 aa] {ON} YJL088W
           (REAL)
          Length = 332

 Score = 32.3 bits (72), Expect = 7.9,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 347 CDEFCPLYSRDTLLSASQNVSSSLDMISFIDNNNTDVKWSSDFQDFAFANELSVTSLKF 405
           CD+F PL +   LL+  +N   SLD+++   N+   + W  D  +    N++ +  LKF
Sbjct: 135 CDKFHPLQAICDLLTIVENFDISLDVVNKGTNSKLKIAWIGDANN--VINDMCIACLKF 191

>ZYRO0A13354g Chr1 complement(1053647..1056115) [2469 bp, 822 aa]
           {ON} similar to uniprot|P48582 Saccharomyces cerevisiae
           YPL084W BRO1 Cytoplasmic class E vacuolar protein
           sorting (VPS) factor that coordinates deubiquitination
           in the multivesicular body (MVB) pathway by recruiting
           Doa4p to endosomes
          Length = 822

 Score = 32.3 bits (72), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 10/62 (16%)

Query: 926 GLCVY---NYESKSWSTFFNNTIVGEITQLAFNNESELIISGL-------FATEKQQSIR 975
           GL  Y   +Y S  WS F+N+ + GE+  L  N   EL +  L       +A  +Q  +R
Sbjct: 21  GLVSYLKRSYGSAQWSQFYNDKLAGELNHLRNNANGELALEALLEQNFIYYAFLEQLHLR 80

Query: 976 LG 977
           +G
Sbjct: 81  IG 82

>Skud_10.126 Chr10 (236807..237823) [1017 bp, 338 aa] {ON} YJL088W
           (REAL)
          Length = 338

 Score = 32.0 bits (71), Expect = 9.7,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 347 CDEFCPLYSRDTLLSASQNVSSSLDMISFIDNNNTDVKWSSDFQDFAFANELSVTSLKF 405
           CD+F PL +   LL+  +    SLD I+   N+   + W  D  +    N++S+  LKF
Sbjct: 141 CDKFHPLQAICDLLTIVEKFDISLDAINKGTNSKLKIAWIGDANN--VINDMSIACLKF 197

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 130,011,038
Number of extensions: 6033659
Number of successful extensions: 17070
Number of sequences better than 10.0: 129
Number of HSP's gapped: 17474
Number of HSP's successfully gapped: 151
Length of query: 1220
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1099
Effective length of database: 39,606,813
Effective search space: 43527887487
Effective search space used: 43527887487
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 72 (32.3 bits)