Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_10.1678.254ON68468434110.0
YLR083C (EMP70)8.254ON66768429470.0
Skud_12.1518.254ON66468429000.0
Smik_12.1428.254ON66367228760.0
NDAI0B023708.254ON72268026740.0
NCAS0B049708.254ON66667525990.0
YDR107C (TMN2)8.254ON67268125410.0
KAFR0B026808.254ON66467125260.0
Suva_2.2678.254ON67267925060.0
Smik_4.3538.254ON69068124740.0
KNAG0G019908.254ON66767724390.0
Skud_4.3688.254ON67268424390.0
ZYRO0C01848g8.254ON64768023840.0
Kpol_543.358.254ON65867923180.0
SAKL0H17248g8.254ON66067023040.0
TBLA0E043708.254ON67667423000.0
CAGL0B01683g8.254ON69168822920.0
KLLA0F18931g8.254ON66567322760.0
Kwal_56.235778.254ON68367522710.0
KLTH0G13882g8.254ON68768622520.0
TPHA0A018408.254ON68568521870.0
NCAS0B038908.254ON66368421760.0
TBLA0H014508.254ON67368221610.0
TDEL0F038108.254ON65667120760.0
NDAI0J014208.254ON61963919290.0
AGR097W8.254ON65366919240.0
Ecym_43178.254ON60568415500.0
NCAS0A145207.411ON6707043924e-39
SAKL0F12914g7.411ON7077493756e-37
KNAG0C034307.411ON6807083642e-35
NDAI0A015107.411ON6797263614e-35
Smik_5.2587.411ON7067433534e-34
YER113C (TMN3)7.411ON7067383527e-34
TDEL0C027107.411ON6787133411e-32
KLLA0E20835g7.411ON6766913357e-32
Suva_5.2347.411ON7067383322e-31
Skud_5.2667.411ON7077393278e-31
ZYRO0B03784g7.411ON6586493062e-28
CAGL0G03487g7.411ON7047322922e-26
Ecym_71437.411ON6767362012e-15
KLTH0C06226g7.411ON6942941922e-14
KAFR0K019507.411ON6642401904e-14
Kwal_27.107467.411ON6902971895e-14
TPHA0K007307.411ON7332981451e-08
AGL295C7.411ON6572901441e-08
Kpol_1045.287.411ON6815901422e-08
TBLA0I003307.411ON7135261395e-08
KLTH0D07414g2.551ON74446761.6
Skud_13.4665.35ON13887703.3
SAKL0A09812g2.545ON75142716.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_10.167
         (684 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {...  1318   0.0  
YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON} ...  1139   0.0  
Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {...  1121   0.0  
Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {...  1112   0.0  
NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {O...  1034   0.0  
NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {O...  1005   0.0  
YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}  ...   983   0.0  
KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...   977   0.0  
Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...   969   0.0  
Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON...   957   0.0  
KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {O...   944   0.0  
Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON...   944   0.0  
ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} simila...   922   0.0  
Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}...   897   0.0  
SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} simi...   892   0.0  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...   890   0.0  
CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {...   887   0.0  
KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]...   881   0.0  
Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {...   879   0.0  
KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} simi...   872   0.0  
TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...   847   0.0  
NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254    842   0.0  
TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {O...   837   0.0  
TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {O...   804   0.0  
NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8....   747   0.0  
AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic ho...   745   0.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...   601   0.0  
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...   155   4e-39
SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]...   149   6e-37
KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.4...   144   2e-35
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...   143   4e-35
Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON...   140   4e-34
YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}  ...   140   7e-34
TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {O...   135   1e-32
KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]...   133   7e-32
Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON...   132   2e-31
Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C ...   130   8e-31
ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {...   122   2e-28
CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {...   117   2e-26
Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar t...    82   2e-15
KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} simila...    79   2e-14
KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {...    78   4e-14
Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113...    77   5e-14
TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7....    60   1e-08
AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON} S...    60   1e-08
Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON} (64237....    59   2e-08
TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411...    58   5e-08
KLTH0D07414g Chr4 (645479..647713) [2235 bp, 744 aa] {ON} simila...    34   1.6  
Skud_13.466 Chr13 (828310..828331,828415..828809) [417 bp, 138 a...    32   3.3  
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    32   6.5  

>Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {ON}
           YLR083C (REAL)
          Length = 684

 Score = 1318 bits (3411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 644/684 (94%), Positives = 644/684 (94%)

Query: 1   MAYIQLFLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSG 60
           MAYIQLFLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSG
Sbjct: 1   MAYIQLFLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSG 60

Query: 61  DKEHFLYSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCK 120
           DKEHFLYSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCK
Sbjct: 61  DKEHFLYSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCK 120

Query: 121 TVIPGDDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVD 180
           TVIPGDDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVD
Sbjct: 121 TVIPGDDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVD 180

Query: 181 SETEQVQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFD 240
           SETEQVQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFD
Sbjct: 181 SETEQVQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFD 240

Query: 241 IKIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEE 300
           IKIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEE
Sbjct: 241 IKIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEE 300

Query: 301 SPTSWATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLD 360
           SPTSWATRWDKYLHVYDPSIQW                      RALKSDFARYNELNLD
Sbjct: 301 SPTSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLD 360

Query: 361 DDFQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSL 420
           DDFQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSL
Sbjct: 361 DDFQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSL 420

Query: 421 ATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFV 480
           ATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFV
Sbjct: 421 ATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFV 480

Query: 481 HSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYL 540
           HSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYL
Sbjct: 481 HSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYL 540

Query: 541 KTLPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITY 600
           KTLPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFG                  MITY
Sbjct: 541 KTLPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTVMITY 600

Query: 601 HSLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCL 660
           HSLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCL
Sbjct: 601 HSLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCL 660

Query: 661 VTGSIGFISSMFFIRKIYSSIKVD 684
           VTGSIGFISSMFFIRKIYSSIKVD
Sbjct: 661 VTGSIGFISSMFFIRKIYSSIKVD 684

>YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON}
           EMP70Protein with a role in cellular adhesion,
           filamentous growth, and endosome-to-vacuole sorting;
           similar to Tmn2p and Tmn3p; member of Transmembrane Nine
           family of proteins with 9 transmembrane segments
          Length = 667

 Score = 1139 bits (2947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/684 (80%), Positives = 590/684 (86%), Gaps = 21/684 (3%)

Query: 1   MAYIQLFLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSG 60
           MA++QL LLYF VS  +AFYLPGVAPTTY+END IPLLVNHLTPSM YQH+DEDGNNVSG
Sbjct: 5   MAHVQLLLLYFFVSTVKAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSG 64

Query: 61  DKEHFLYSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCK 120
           DKE+FLYSYDYYY++FHFC+PE VEKQPESLGS+IFGDRIYNSPF+LNMLQEKEC SLCK
Sbjct: 65  DKENFLYSYDYYYNRFHFCQPEKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCK 124

Query: 121 TVIPGDDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVD 180
           TVIPGDDAKFINKLIKNGFFQNWLIDGLPAAREV+DGRTKT FYGAGF LGFV+V     
Sbjct: 125 TVIPGDDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQV----- 179

Query: 181 SETEQVQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFD 240
                          TQ  D +  P+  +++++ +EL+ R+  +NMVKT E PYFANHFD
Sbjct: 180 ---------------TQGTDIEATPKGAETTDKDVELETRND-RNMVKTYELPYFANHFD 223

Query: 241 IKIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEE 300
           I IEYHDRGEGNYRVVGVIV P+SIKRSSPGTCET GSPL+LDE NDNEVYFTYSVKF E
Sbjct: 224 IMIEYHDRGEGNYRVVGVIVEPVSIKRSSPGTCETTGSPLMLDEGNDNEVYFTYSVKFNE 283

Query: 301 SPTSWATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLD 360
           S TSWATRWDKYLHVYDPSIQW                      RALKSDFARYNELNLD
Sbjct: 284 SATSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLD 343

Query: 361 DDFQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSL 420
           DDFQEDSGWKLNHGDVFR PSQSL LSILVGSGVQ+FLMVTCSIFFAALGFLSPSSRGSL
Sbjct: 344 DDFQEDSGWKLNHGDVFRSPSQSLTLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSL 403

Query: 421 ATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFV 480
           ATVMFILYALFGFVGSYTSMGIYKFF+GPYWKAN+I+TPLL+PGAILL+IIALNFFLMFV
Sbjct: 404 ATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLILTPLLVPGAILLIIIALNFFLMFV 463

Query: 481 HSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYL 540
           HSSGVIPASTLFFMVFLWFLFSIPLSFAGSL+ARK+CHWDEHPTKTNQIARQIPFQPWYL
Sbjct: 464 HSSGVIPASTLFFMVFLWFLFSIPLSFAGSLIARKRCHWDEHPTKTNQIARQIPFQPWYL 523

Query: 541 KTLPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITY 600
           KT+PATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFG                  +ITY
Sbjct: 524 KTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTSSLVTILITY 583

Query: 601 HSLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCL 660
           HSLCLENWKWQWRGF +GG GCALYVFIHSILFTKFKLGGFTTIVLY+GYSSVISLLCCL
Sbjct: 584 HSLCLENWKWQWRGFIIGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCL 643

Query: 661 VTGSIGFISSMFFIRKIYSSIKVD 684
           VTGSIGFISSM F+RKIYSSIKVD
Sbjct: 644 VTGSIGFISSMLFVRKIYSSIKVD 667

>Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {ON}
           YLR083C (REAL)
          Length = 664

 Score = 1121 bits (2900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/684 (79%), Positives = 586/684 (85%), Gaps = 20/684 (2%)

Query: 1   MAYIQLFLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSG 60
           MAYIQL LLYF VSA +AFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQH+DE GN+VSG
Sbjct: 1   MAYIQLLLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSG 60

Query: 61  DKEHFLYSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCK 120
           DKE+FLYSYDYYYD+FHFC+P+HVEKQPESLGS+IFGDRIYNSPFELNMLQEKECV LC 
Sbjct: 61  DKENFLYSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCN 120

Query: 121 TVIPGDDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVD 180
           T IPG+DAKFINKLIKNGFFQNWLIDGLPAAREV+DGRTKT+FYGAGF LG VEV+Q   
Sbjct: 121 TTIPGNDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTR 180

Query: 181 SETEQVQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFD 240
           S                    KT P++ +++NEG+EL  R +  ++V+T E PYFANHFD
Sbjct: 181 S--------------------KTAPKQAETTNEGLELGTRAEDYSIVETFEHPYFANHFD 220

Query: 241 IKIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEE 300
           I IEYHDRG G+YRVVGVIVNPLSIKRS  GTCET+ SPL+LDE  DNEV FTYSVKF+E
Sbjct: 221 IMIEYHDRGGGDYRVVGVIVNPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKE 280

Query: 301 SPTSWATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLD 360
           S TSWATRWDKYLHVYDPSIQW                      RALKSDFARYNELNL+
Sbjct: 281 SATSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLE 340

Query: 361 DDFQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSL 420
           DDFQEDSGWKLNHGDVFRPPS SL+LSILVGSGVQ+FLMVTCSIFFAALGFLSPSSRGSL
Sbjct: 341 DDFQEDSGWKLNHGDVFRPPSHSLLLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSL 400

Query: 421 ATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFV 480
           ATVMFILYALFGFVGSYTSMGIYKFF+GPYWKAN+++TPLL+PGAILL+I+ALNFFLM V
Sbjct: 401 ATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVV 460

Query: 481 HSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYL 540
           HSSGVIPA TLFFMVFLWFLFSIPLSF GSL+ARKKC WDEHPTKTNQIARQIPFQPWYL
Sbjct: 461 HSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYL 520

Query: 541 KTLPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITY 600
           KT+PATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFG                  +ITY
Sbjct: 521 KTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITY 580

Query: 601 HSLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCL 660
           HSLCLENWKWQWRGF VGGVGCALYVFIHSILFTKFKLGGF TIVLY+GYS VISLLCCL
Sbjct: 581 HSLCLENWKWQWRGFIVGGVGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCL 640

Query: 661 VTGSIGFISSMFFIRKIYSSIKVD 684
           VTGSIGFISSMFF+R+IYSSIKVD
Sbjct: 641 VTGSIGFISSMFFLRRIYSSIKVD 664

>Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {ON}
           YLR083C (REAL)
          Length = 663

 Score = 1112 bits (2876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/672 (80%), Positives = 574/672 (85%), Gaps = 21/672 (3%)

Query: 13  VSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYY 72
           VS A+AFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQH+DE+GNNVSGDKE+FLYSYDYY
Sbjct: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72

Query: 73  YDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFIN 132
             +FHFCKPE VEKQPESLGSIIFGDRIYNSPF+L ML+EKECVSLCK  IPG+DAKFIN
Sbjct: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132

Query: 133 KLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGE 192
           KLIKNGFFQNWLIDGLPAAR V D RTKT FYGAGF LGFVEV Q   SE          
Sbjct: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEAT-------- 184

Query: 193 TEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGN 252
                       P   +++N+G+ELD RD G NMV+T E PYF NH+DI+IEYHDRGEGN
Sbjct: 185 ------------PNTAETTNQGVELDTRD-GHNMVQTYEHPYFTNHYDIRIEYHDRGEGN 231

Query: 253 YRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSWATRWDKY 312
           YRVVGVIVNP+SIKRS P TCET+GSPL+LDE NDNEVYFTYSVKF ES TSWATRWDKY
Sbjct: 232 YRVVGVIVNPVSIKRSDPETCETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKY 291

Query: 313 LHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLN 372
           LHVYDPSIQW                      RALKSDFARYNELNLDDDFQEDSGWKL+
Sbjct: 292 LHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLS 351

Query: 373 HGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFG 432
           HGDVFR PS+SL LSILVGSGVQ+F MVTCSIFFAALGFLSPSSRGSLATVMF+LYALFG
Sbjct: 352 HGDVFRAPSRSLTLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFG 411

Query: 433 FVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGVIPASTLF 492
           FVGSYTSMGIYKFFDGPYWKAN+I+TPLL+PG IL++IIALNFFLMFVHSSGVIPASTLF
Sbjct: 412 FVGSYTSMGIYKFFDGPYWKANLILTPLLVPGTILIIIIALNFFLMFVHSSGVIPASTLF 471

Query: 493 FMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPATLIAGIF 552
           FMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKT+PATLIAG+F
Sbjct: 472 FMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVF 531

Query: 553 PFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITYHSLCLENWKWQW 612
           PFGSIAVELYFIYTSLWFNKIFYMFG                  +ITYHSLCLENWKWQW
Sbjct: 532 PFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQW 591

Query: 613 RGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFISSMF 672
           RGF VGG GCALYVFIHSILFTKFKLGGFTTIVLY+GYSSVISLLCCLVTGSIGFISSMF
Sbjct: 592 RGFIVGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMF 651

Query: 673 FIRKIYSSIKVD 684
           FIRKIYSSIKVD
Sbjct: 652 FIRKIYSSIKVD 663

>NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {ON}
           Anc_8.254
          Length = 722

 Score = 1034 bits (2674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/680 (72%), Positives = 556/680 (81%), Gaps = 18/680 (2%)

Query: 6   LFLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHF 65
           + L  F +S  RAFYLPGVAPTTY  +DEIPLLVNHLTPSMY+QH++EDG  +  DKE F
Sbjct: 60  VLLFAFCLSLTRAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDGKTMKSDKERF 119

Query: 66  LYSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPG 125
           LYSYDYYYD+FHFC+PEH+EKQPESLGSIIFGDRIYNSPF++NMLQ+K CVSLCKT IPG
Sbjct: 120 LYSYDYYYDRFHFCQPEHIEKQPESLGSIIFGDRIYNSPFQINMLQDKTCVSLCKTTIPG 179

Query: 126 DDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQ 185
            DAKFINKLIKNGFFQNWLIDGLPAAR+V+D RTKT+FYG GF LGFV+V Q        
Sbjct: 180 KDAKFINKLIKNGFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFVDVVQ-------- 231

Query: 186 VQVASGETEQTQAADGKTEPEKGKSSNEGMELDARD-QGKNMVKTREFPYFANHFDIKIE 244
                     T   D      K  ++NEG+ELD RD +   M+K  E PYFANHFDI++E
Sbjct: 232 ---------GTTTGDNANTVAKKPTTNEGLELDTRDAKNVQMLKNFELPYFANHFDIQVE 282

Query: 245 YHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTS 304
           YHDRGE NYRVVGVIVNP+SIKRS+PGTCET+G+PL+L E  DN+VYFTYSVKF  S T 
Sbjct: 283 YHDRGENNYRVVGVIVNPVSIKRSTPGTCETSGAPLMLSEDQDNDVYFTYSVKFIPSETI 342

Query: 305 WATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQ 364
           WATRWDKYLH+YDP+IQW                      +ALKSDFARYNELNLDDDFQ
Sbjct: 343 WATRWDKYLHIYDPAIQWFSLINFSVVVLLLSSVVIHSLLKALKSDFARYNELNLDDDFQ 402

Query: 365 EDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVM 424
           E++GWKL HGDVFR P +SL+LS+LVGSGVQ+FLM+ CSIFFAALGFLSPSSRGSLATVM
Sbjct: 403 EEAGWKLGHGDVFRIPHRSLLLSVLVGSGVQLFLMIICSIFFAALGFLSPSSRGSLATVM 462

Query: 425 FILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSG 484
           FILYALFGFVGSYTSMG+YKFF GPYWK N+++TP+L+PG I   I+ALN FL+FVHSSG
Sbjct: 463 FILYALFGFVGSYTSMGVYKFFGGPYWKVNMLLTPILVPGLIFCGIVALNIFLLFVHSSG 522

Query: 485 VIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLP 544
           VIPA TLFFM+ LWF+FSIPL+ AGSL+A KKC+WDEHPTKTNQIARQIPFQPWYLKT P
Sbjct: 523 VIPAVTLFFMILLWFVFSIPLALAGSLIAHKKCNWDEHPTKTNQIARQIPFQPWYLKTWP 582

Query: 545 ATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITYHSLC 604
           ATLIAGIFPFGSIAVELYFIY+SLWFNKIFYMFG                  +ITYHSLC
Sbjct: 583 ATLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFFLLTLTTSLVTILITYHSLC 642

Query: 605 LENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGS 664
           LENW WQWRGF +GGVGCA+YVFIHSILFTKFKLGGFTTIVLY+GYS++ISLL C+VTG+
Sbjct: 643 LENWMWQWRGFIIGGVGCAIYVFIHSILFTKFKLGGFTTIVLYVGYSTIISLLFCIVTGA 702

Query: 665 IGFISSMFFIRKIYSSIKVD 684
           IGF+SSMFFIRKIYSSIKV+
Sbjct: 703 IGFLSSMFFIRKIYSSIKVE 722

>NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {ON} 
          Length = 666

 Score = 1005 bits (2599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/675 (70%), Positives = 546/675 (80%), Gaps = 21/675 (3%)

Query: 11  FIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYD 70
           F +S  RAFYLPGVAPTTY E DEIPLLVNHLTPS+Y+Q  D +G   S +KEHFLYS+D
Sbjct: 12  FFLSLTRAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK--SKNKEHFLYSFD 69

Query: 71  YYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKF 130
           YY+D+ HFCKPEH+EKQPESLGSIIFGDRIYNSPFEL ML+EK CVSLCK+ IPG DAKF
Sbjct: 70  YYFDRLHFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKF 129

Query: 131 INKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVAS 190
           INKLIKNGFFQNWLIDGLPAA +V+D +TK++FYG GF LGFVE  Q +D +        
Sbjct: 130 INKLIKNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQ-------- 181

Query: 191 GETEQTQAADGKTEPEKGKSSNEGMELDARD-QGKNMVKTREFPYFANHFDIKIEYHDRG 249
                   A   T+P++  ++NEG+EL+ R+ +   MVK  E  YF NH+DI++EYHDRG
Sbjct: 182 --------APATTKPKQ--TTNEGLELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRG 231

Query: 250 EGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSWATRW 309
           EG YRVVGVIVNP+SIKRS+PGTCET G PLVL E  DN+VYFTYSVKF  S T WATRW
Sbjct: 232 EGTYRVVGVIVNPVSIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRW 291

Query: 310 DKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGW 369
           DKYLH YDP+IQW                      +ALKSDFARYNE NL+DDFQED+GW
Sbjct: 292 DKYLHTYDPTIQWFSLVNFSIIVLLLSSVVIHSLMKALKSDFARYNEFNLEDDFQEDAGW 351

Query: 370 KLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFILYA 429
           KL HGDVFR P +S++LS+LVGSGVQ+FLM++CSIFFAALGFLSPSSRGSLATVMFILYA
Sbjct: 352 KLGHGDVFRIPHKSMLLSVLVGSGVQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYA 411

Query: 430 LFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGVIPAS 489
           LFGFVGSYTSM +YKFF GPYWK N+++TP +IPG I L I+ LNFFLMF HSSGV+PA 
Sbjct: 412 LFGFVGSYTSMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAG 471

Query: 490 TLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPATLIA 549
           TLFFM+ LWF+FSIPL+FAGSL+A KKC WDEHPTKTNQIARQIPFQPWYLKT PAT+IA
Sbjct: 472 TLFFMILLWFIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIA 531

Query: 550 GIFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITYHSLCLENWK 609
           GIFPFGSIAVELYFIYTSLWFNKIFYMFG                  +ITYHSLCLENW+
Sbjct: 532 GIFPFGSIAVELYFIYTSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYHSLCLENWQ 591

Query: 610 WQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFIS 669
           WQWRGF VGGVGCA+YVF+HSILFTKFKLGGF TIVLY+GYS++ISLL C+VTG+IGF+S
Sbjct: 592 WQWRGFIVGGVGCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLS 651

Query: 670 SMFFIRKIYSSIKVD 684
           S+ F+RKIYS+IKVD
Sbjct: 652 SLIFVRKIYSAIKVD 666

>YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}
           TMN2Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn3p; member
           of the evolutionarily conserved Transmembrane Nine
           family of proteins with nine membrane-spanning segments
          Length = 672

 Score =  983 bits (2541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/681 (67%), Positives = 539/681 (79%), Gaps = 18/681 (2%)

Query: 7   FLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFL 66
            L+Y   +  + F LPG++PTTY   DEIPLLVN LTPS+Y+QHQDE+GN+VSGDKEHFL
Sbjct: 7   LLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFL 66

Query: 67  YSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGD 126
           YSYDYY  +FHFC+PEHVEKQPESLGS+IFGDRIYNSPF+LNML+EKECV+LCK+ IPG 
Sbjct: 67  YSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGK 126

Query: 127 DAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQV 186
           DAKFIN LIK+GFFQNWL+DGLPAAR+ +D RTKT++YG GF LGF +V Q VD      
Sbjct: 127 DAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDG----- 181

Query: 187 QVASGETEQTQAADGKTEPEKGKSSNEGMELDAR---DQGKNMVKTREFPYFANHFDIKI 243
                     +A     E    ++SNE + LDAR   +   N+VKT E PYF NHFDI++
Sbjct: 182 ----------KAVPSTMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEV 231

Query: 244 EYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPT 303
           E+HDRG  NYRVVGVIVNP+SI+RSSPG C T G PL+LDE  DNEVYFTYSVKF  S T
Sbjct: 232 EFHDRGNDNYRVVGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDT 291

Query: 304 SWATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDF 363
            WATRWDKYLH+YDP IQW                      RALKSD ARYNELNLD++F
Sbjct: 292 VWATRWDKYLHIYDPQIQWFSLINFSVIVILLSSVVMHSLLRALKSDLARYNELNLDNEF 351

Query: 364 QEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATV 423
            EDSGWKL HGDVFR PS+S++LSILVGSG+Q+FLMV CSIFFAA+G +SP SRGSL TV
Sbjct: 352 HEDSGWKLGHGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTV 411

Query: 424 MFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSS 483
           MF+LYALFGFVGSY SMG+YKFF GPYWKAN+I+TP+L+PGAI L+I+ +NFFL+F HSS
Sbjct: 412 MFVLYALFGFVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSS 471

Query: 484 GVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTL 543
           GVIPA +LFF++ LWFL S+PLSFAGS+VA K+C+WDEHPTKTNQIARQIP+QPWYL+T 
Sbjct: 472 GVIPARSLFFIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTA 531

Query: 544 PATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITYHSL 603
            ATLIAGIF FGSIAVELYFIY+SLWFNKIFYMFG                  +ITY+SL
Sbjct: 532 QATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYYSL 591

Query: 604 CLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTG 663
           CLENW WQWR F +GG+GC++Y FIHSILFTKFKLGG  T+VLYLGYS +IS LCC+VTG
Sbjct: 592 CLENWLWQWRSFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTG 651

Query: 664 SIGFISSMFFIRKIYSSIKVD 684
           +IGF SSMFFIRKIYS+IKV+
Sbjct: 652 AIGFFSSMFFIRKIYSAIKVE 672

>KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {ON}
           Anc_8.254 YLR083C
          Length = 664

 Score =  977 bits (2526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/671 (70%), Positives = 548/671 (81%), Gaps = 23/671 (3%)

Query: 16  ARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDK 75
            RAFYLPGVAPTTY E DEIPLLVNHL+PSMY+QH++++G +VS DK  +LYSYDYYYD+
Sbjct: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSDKNKYLYSYDYYYDR 74

Query: 76  FHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLI 135
           FHFC+PE +EKQPESLGSI+FGDRIYNSPF+LNML+EK+C SLCK+ IPG+DAKFINKLI
Sbjct: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134

Query: 136 KNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGETEQ 195
           KNGFFQNWLIDGLPAA E HD RT TDFYG+GF LG V+V Q VD    + +VA+     
Sbjct: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAA----- 189

Query: 196 TQAADGKTEPEKGKSSNEGMELDARDQGKNM--VKTREFPYFANHFDIKIEYHDRGEGNY 253
                          +N+G ELDARD  KN+  +K  E  YF NH+DI+IEYHDRG G+Y
Sbjct: 190 ---------------ANQGAELDARD-AKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDY 233

Query: 254 RVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSWATRWDKYL 313
           RVVGVIVNP+SI+RSSPG+CE+ G PL L E  DN+VYFTYSV F  S TSWATRWDKYL
Sbjct: 234 RVVGVIVNPVSIQRSSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYL 293

Query: 314 HVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLNH 373
           HVYDP+IQW                      +ALK+DFARYNE NLDD+FQED+GWKL H
Sbjct: 294 HVYDPTIQWFSLVNFSLIVLLLSTVVLHSLLKALKNDFARYNEFNLDDEFQEDAGWKLCH 353

Query: 374 GDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGF 433
           GDVFR P +S++LS+LVGSGVQ+F+M++ +IFFAALGFLSPSSRG L TVMF+LYALFGF
Sbjct: 354 GDVFRIPHKSMLLSVLVGSGVQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGF 413

Query: 434 VGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGVIPASTLFF 493
           VGSYTSMG+YKFF GPYWKAN+++TP+L+PG+I + IIA+NFFLM+VHSSGVIPA TLFF
Sbjct: 414 VGSYTSMGVYKFFRGPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFF 473

Query: 494 MVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPATLIAGIFP 553
           MV LWF+FSIP +FAGSLVA KKC+W+EHPTKT QIARQIPFQPWYLKT+PAT IAGIFP
Sbjct: 474 MVLLWFVFSIPSAFAGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFP 533

Query: 554 FGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITYHSLCLENWKWQWR 613
           FGSIAVE+YFIYTSLW+NKIFYMFG                  +ITYHSLCLENW WQWR
Sbjct: 534 FGSIAVEIYFIYTSLWYNKIFYMFGFLFVSLLLLALTTSLVTVLITYHSLCLENWNWQWR 593

Query: 614 GFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFISSMFF 673
            F VGGVGCA+YVFIHSILFTKFKLGGFTT+VLYLGYSS+ISLLCC+VTGSIGF+SSMFF
Sbjct: 594 SFIVGGVGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSSIISLLCCIVTGSIGFLSSMFF 653

Query: 674 IRKIYSSIKVD 684
           +RKI+SSIKVD
Sbjct: 654 VRKIFSSIKVD 664

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/679 (67%), Positives = 536/679 (78%), Gaps = 18/679 (2%)

Query: 9   LYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYS 68
           L+  ++ A+AF LPGV+PTTY+ NDEIPLLVN LTPS+Y+QH+DE+G +VS DKEHFLYS
Sbjct: 9   LFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYS 68

Query: 69  YDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDA 128
           YDYY DKFHFCKPEHVEKQPESLGS+IFGDRIYNSPF+L ML++KECV+LCK+ IPG DA
Sbjct: 69  YDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDA 128

Query: 129 KFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQV 188
           KFIN LIKNGFFQNWL+DGLPAAR V+D RTKT++YG GF LGF +V Q V  +T     
Sbjct: 129 KFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKT----- 183

Query: 189 ASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGK---NMVKTREFPYFANHFDIKIEY 245
                E+  + D KT          G  LDARD      N+V+T E  +F NHF+I++EY
Sbjct: 184 IPSTMEELDSEDSKT----------GATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEY 233

Query: 246 HDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSW 305
           HDRG GNYRVVGV VNPLSI+RSSPG C T G PL L E  DN+VYFTYSVKF  S T W
Sbjct: 234 HDRGNGNYRVVGVTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVW 293

Query: 306 ATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQE 365
           ATRWDKYLHVYDP IQW                      RA++SDFARYNELNLD++F E
Sbjct: 294 ATRWDKYLHVYDPQIQWFSLINFSIIVILLSSVVIHSILRAVRSDFARYNELNLDNEFHE 353

Query: 366 DSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMF 425
           D+GWKL HGDVFR P +S++LS+LVGSG+Q+FLM+ CSIFFAALG +SP+SRGSL TVMF
Sbjct: 354 DAGWKLGHGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMF 413

Query: 426 ILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGV 485
           +LYALFGFVGSYTSMG+YKFF GPYWKAN+I+TP+L+PGAI L+I+A+NFFL+F HSSGV
Sbjct: 414 VLYALFGFVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGV 473

Query: 486 IPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPA 545
           IPA TLFF++FLWF  SIPLSFAGS +A K+C WDEHPTKTNQIARQ P QPWYL+T+ A
Sbjct: 474 IPARTLFFIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQA 533

Query: 546 TLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITYHSLCL 605
           TLIAGIF FGSIAVELYFIY+SLWFNKIFYMFG                   ITYHSLCL
Sbjct: 534 TLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLATSLVTVFITYHSLCL 593

Query: 606 ENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSI 665
           ENW WQWR F +GG+GC++Y+FIH+ILFTKFKLGGF T+VLY+GYS +IS LCC+VTG+I
Sbjct: 594 ENWSWQWRSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAI 653

Query: 666 GFISSMFFIRKIYSSIKVD 684
           GF SSM FIRKIYS IKV+
Sbjct: 654 GFFSSMIFIRKIYSRIKVE 672

>Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON}
           YDR107C (REAL)
          Length = 690

 Score =  957 bits (2474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/681 (65%), Positives = 532/681 (78%), Gaps = 18/681 (2%)

Query: 7   FLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFL 66
            LL+F +   +AF LPG++PTTY +NDEIPLLVN LTPS+Y+QHQDE+G ++S DKEH+L
Sbjct: 25  LLLFFYIGLTKAFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDISSDKEHYL 84

Query: 67  YSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGD 126
           YSYDYY ++FHFC+PEHVE+QPESLGSIIFGDRIYNSPF+L ML+ KECV+LC+  IPG 
Sbjct: 85  YSYDYYNERFHFCRPEHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALCENTIPGK 144

Query: 127 DAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQV 186
           DAKFINKLIK+GFFQNWL+DGLPAAR+V D RTKT++YG GF LG   V   +D      
Sbjct: 145 DAKFINKLIKSGFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELGITAVKNTIDG----- 199

Query: 187 QVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGK---NMVKTREFPYFANHFDIKI 243
                     +      E    ++SN G  LDAR+      N+VKT E PYF NHFDI++
Sbjct: 200 ----------KVIPSTMEELDSETSNTGAALDAREPKNIKPNLVKTVELPYFVNHFDIEV 249

Query: 244 EYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPT 303
           E+HDRG+ NYRVVGV VNP+SI+RSSP +C     PL+LDE  DNE+YFTYSVKF  S T
Sbjct: 250 EFHDRGDDNYRVVGVTVNPMSIERSSPDSCSKATKPLILDEEGDNEIYFTYSVKFVASDT 309

Query: 304 SWATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDF 363
            WATRWDKYLH+YDP IQW                      RAL SD +RYNELNLD++F
Sbjct: 310 VWATRWDKYLHIYDPQIQWFSLINFSVIIVLLSSVVMHSLLRALNSDLSRYNELNLDNEF 369

Query: 364 QEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATV 423
            EDSGWKL HGDVFR P++S++LS+LVGSGVQ+FLM+ CSIF AALG +SP SRGSL TV
Sbjct: 370 HEDSGWKLGHGDVFRTPTKSMLLSVLVGSGVQLFLMIICSIFLAALGLVSPVSRGSLPTV 429

Query: 424 MFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSS 483
           MF+ YALFGFVGSYTSMG+YKFF GPYWKAN+I+TP+L+PG I ++I+A+NFFL+F HSS
Sbjct: 430 MFVFYALFGFVGSYTSMGVYKFFHGPYWKANLILTPILLPGGIFVLIVAMNFFLLFAHSS 489

Query: 484 GVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTL 543
           GVIPASTLFF++FLWF  SIPLSFAGS++A K C+WDEHPTKTNQIARQ+P+QPWYL+T+
Sbjct: 490 GVIPASTLFFIIFLWFAVSIPLSFAGSMIAHKWCNWDEHPTKTNQIARQVPYQPWYLRTI 549

Query: 544 PATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITYHSL 603
            ATLIAGIF FGSIAVELYFIY+SLWFNKIFYMFG                  +ITYHSL
Sbjct: 550 QATLIAGIFCFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTVLITYHSL 609

Query: 604 CLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTG 663
           CLENW+WQWR F +GG+GC++Y+FIHSILFTKFKLGGF TIVLY GYS +IS LCC+VTG
Sbjct: 610 CLENWQWQWRSFIIGGLGCSVYMFIHSILFTKFKLGGFITIVLYFGYSFIISALCCVVTG 669

Query: 664 SIGFISSMFFIRKIYSSIKVD 684
           +IGF S M FIRKIYS++K++
Sbjct: 670 AIGFFSCMLFIRKIYSAVKIE 690

>KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {ON}
           Anc_8.254 YLR083C
          Length = 667

 Score =  944 bits (2439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/677 (68%), Positives = 534/677 (78%), Gaps = 22/677 (3%)

Query: 9   LYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYS 68
           L +      AFYLPGVAPTTYK NDEIPLLVNHL+PSMY+QH+ EDG N+ GDK  +LYS
Sbjct: 12  LLWACGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKSRYLYS 71

Query: 69  YDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDA 128
           YDYYYD+FHFC+PE + K+PESLGSIIFGDRIYNSP+++ ML+EK CV LC T+IPG DA
Sbjct: 72  YDYYYDRFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDA 131

Query: 129 KFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQV 188
           +FINKLIKNGFFQNWLIDGLPAAR VHD  T +DFYG GF LG VEV Q V         
Sbjct: 132 EFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAV--------- 182

Query: 189 ASGETEQTQAADGKTEPEKGKSSNEGMELDARD-QGKNMVKTREFPYFANHFDIKIEYHD 247
                     A  KT P++  S +   +L  RD +   M+K  E PYFANH DI +EYHD
Sbjct: 183 ----------AQAKTHPKEDDSGSA--KLSTRDAKNVQMLKNVELPYFANHHDITVEYHD 230

Query: 248 RGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSWAT 307
           RGEGN RVVGV V+P+SIKRSSPGTC+T+G PL+LDE NDNEVYFTYSV+F  S T WAT
Sbjct: 231 RGEGNLRVVGVTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWAT 290

Query: 308 RWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDS 367
           RWDKYLH YDP+IQW                      +AL+SDFARYNELNLD++FQEDS
Sbjct: 291 RWDKYLHTYDPTIQWFSLVNFSIVVVLLSSVVIHMLLKALRSDFARYNELNLDNEFQEDS 350

Query: 368 GWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFIL 427
           GWKL HGDVFR PS+S++LSILVGSG+Q+FLM++ SIFFAALGFLSPSSRGSL TVMF+L
Sbjct: 351 GWKLTHGDVFRIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFML 410

Query: 428 YALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGVIP 487
           YALFGFVGSYTSMG+YKFF GPYWKAN+I+TPLL+PG +LL I+ LN FL+  HSSG IP
Sbjct: 411 YALFGFVGSYTSMGVYKFFRGPYWKANMILTPLLVPGCLLLSIVGLNMFLLGAHSSGTIP 470

Query: 488 ASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPATL 547
           A TLFF+V LWF+ S+P + AGSL+A KKC WDEHPTKTNQ+ARQ+PFQPWYLKT+ AT 
Sbjct: 471 AKTLFFIVLLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATF 530

Query: 548 IAGIFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITYHSLCLEN 607
           IAGIFPFGSIAVELYFIYTSLW+NKIFYMFG                  +ITYHSL LEN
Sbjct: 531 IAGIFPFGSIAVELYFIYTSLWYNKIFYMFGFLFVSFLLLTLTTVLVTILITYHSLSLEN 590

Query: 608 WKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGF 667
           W+WQWR F VGGVGCA+Y+F+HSILFTK KLGGF TIVLY+GYS+VISLLCCLVTGSIGF
Sbjct: 591 WQWQWRSFIVGGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGF 650

Query: 668 ISSMFFIRKIYSSIKVD 684
           +SSMFF+R+IYSSIKV+
Sbjct: 651 LSSMFFVRRIYSSIKVE 667

>Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  944 bits (2439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/684 (64%), Positives = 529/684 (77%), Gaps = 19/684 (2%)

Query: 4   IQLFLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKE 63
           I L LL +I   A+AF LPG++PTTY  NDEIPLLVN LTPS+Y+QHQDE+GN++S DKE
Sbjct: 5   IWLALLSYI-PVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKE 63

Query: 64  HFLYSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVI 123
           HFLYSYDYY ++FHFC+PEHVEKQPESLGS+IFGDRIYNSPF+L ML+EKECV+LCK  I
Sbjct: 64  HFLYSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTI 123

Query: 124 PGDDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSET 183
           PG DA+FIN+LI +GFFQNWL+DGLPAAR V+D RTKT++YG GF LGF +V Q V  ET
Sbjct: 124 PGRDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDET 183

Query: 184 EQVQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGK---NMVKTREFPYFANHFD 240
                               E     +SN G  L  R       N VKT E PYF NHF+
Sbjct: 184 ---------------VPNTMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFE 228

Query: 241 IKIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEE 300
           I +E+H+RG  +YR+VGV VNP+SI+RSSPG+C     PL L E  DNEVYFTYSVKF  
Sbjct: 229 IVVEFHERGNDSYRIVGVTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVA 288

Query: 301 SPTSWATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLD 360
           S T WATRWDKYLH+YDP IQW                      RALKSD  RYNELNL+
Sbjct: 289 SATVWATRWDKYLHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLN 348

Query: 361 DDFQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSL 420
           ++F ED+GWKL+HGDVFR P +S++LS+LVGSG+Q+FLM+ CSIFFAA G +SP SRGSL
Sbjct: 349 NEFHEDAGWKLSHGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSL 408

Query: 421 ATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFV 480
            TVMF+LYALFGFVGSYTSMG+YKFF GPYWKAN+I+TP+L+PGAILL+I+A+N FL+F 
Sbjct: 409 QTVMFLLYALFGFVGSYTSMGVYKFFHGPYWKANLIITPILLPGAILLLIVAMNIFLLFA 468

Query: 481 HSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYL 540
           HSSGVIPA +LFF++FLWF+ SIPLSF GS++A K+C W+EHPTKTNQIARQIP QPWYL
Sbjct: 469 HSSGVIPAKSLFFIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYL 528

Query: 541 KTLPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITY 600
           +T  AT++AGIF FGSIAVELYFIY+SLWFNKIFYMFG                  +ITY
Sbjct: 529 RTTQATMVAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLITVLITY 588

Query: 601 HSLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCL 660
           HSLCLENW WQWR F +GG+GC++Y+FIHSILFTKFKLGGF T+VLYLGYS ++S+LCC+
Sbjct: 589 HSLCLENWLWQWRSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCV 648

Query: 661 VTGSIGFISSMFFIRKIYSSIKVD 684
           VTG+IGF SSM FIRKIY ++KV+
Sbjct: 649 VTGAIGFFSSMIFIRKIYYAVKVE 672

>ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 647

 Score =  922 bits (2384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/680 (66%), Positives = 518/680 (76%), Gaps = 37/680 (5%)

Query: 5   QLFLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEH 64
            L  +  + S  +AFYLPGVAPTTY  NDEI LLVNHLTPSM +QH+DEDGN V GDKEH
Sbjct: 5   SLLFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEH 64

Query: 65  FLYSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIP 124
           +LYSYDYYY KFHFCKPE+V +QP SLGS+IFGDRI+NSPF+LNML+EKECV LC + IP
Sbjct: 65  YLYSYDYYYSKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIP 124

Query: 125 GDDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETE 184
           G+DAKF+NKLIKNGF QNWLIDGLPA RE+HD RT ++FYG GF LGFV+V         
Sbjct: 125 GEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVT-------- 176

Query: 185 QVQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIE 244
                                       EG   D+ D+ K ++KT E PY ANH+DI IE
Sbjct: 177 ----------------------------EGFS-DSNDEEKKIMKTLEVPYLANHYDINIE 207

Query: 245 YHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTS 304
           YHDRG  NYRVVGV V+P+SIKRSS  +C+ N   L L E  +NEV+FTYSVKF +S T 
Sbjct: 208 YHDRGNDNYRVVGVTVDPVSIKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTV 267

Query: 305 WATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQ 364
           WATRWDKYLHVYDP+IQW                      RALK+D +RYNE NLD++F 
Sbjct: 268 WATRWDKYLHVYDPTIQWFSLINCSVIVVALSSVVLHMLLRALKNDLSRYNEFNLDNEFH 327

Query: 365 EDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVM 424
           EDSGWKL+HGDVFR P +SL+LSILVGSGVQ+FLM+ CSI FAALGFLSPSSRGSL TVM
Sbjct: 328 EDSGWKLSHGDVFRIPPRSLLLSILVGSGVQLFLMIACSIIFAALGFLSPSSRGSLPTVM 387

Query: 425 FILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSG 484
           F+LYALFGFVGSYTSM IYKFF GP WK N+++TP+L+PG I + II LNFFL+FV SSG
Sbjct: 388 FLLYALFGFVGSYTSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSG 447

Query: 485 VIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLP 544
            IPA TLF ++ LWF+FSIPLSFAGSL+A K+C  D HPTKTNQIARQIP QPWYLKT+P
Sbjct: 448 AIPAGTLFTIILLWFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIP 507

Query: 545 ATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITYHSLC 604
            +LIAG+FPF SIAVELYFIYTSLWFNKIFYMFG                  + TYHSLC
Sbjct: 508 VSLIAGVFPFASIAVELYFIYTSLWFNKIFYMFGFLLFSFLLLTFTTALVTILTTYHSLC 567

Query: 605 LENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGS 664
           LENWKWQWR F +GG GCA+YVFIHSILFTKFKLGGFTT+VLYLGYS +IS+LCC+VTGS
Sbjct: 568 LENWKWQWRSFIIGGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGS 627

Query: 665 IGFISSMFFIRKIYSSIKVD 684
           IGFISSMFFIRKIYSS+KVD
Sbjct: 628 IGFISSMFFIRKIYSSVKVD 647

>Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}
           complement(78246..80222) [1977 nt, 659 aa]
          Length = 658

 Score =  897 bits (2318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/679 (64%), Positives = 506/679 (74%), Gaps = 31/679 (4%)

Query: 8   LLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLY 67
           LL   ++   AFYLPGVAPTTY + DEIPLLVNHLTPS+ +QH+D+ GN++ G+KEHFLY
Sbjct: 9   LLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLY 68

Query: 68  SYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDD 127
           S+DYY+ K HFCKPEHVEKQPESLGSI+FGDRIYNSPF + ML+ +EC SLCK  IP DD
Sbjct: 69  SFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADD 128

Query: 128 AKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQ 187
           AKFINKLIKNGFFQNWLIDGLPAAR++HD +TK+DFYG GF LG V V Q V        
Sbjct: 129 AKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLA---- 184

Query: 188 VASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGK--NMVKTREFPYFANHFDIKIEY 245
                                 SS   +E  AR+     NMV   E P+  NH+DI +EY
Sbjct: 185 ----------------------SSKLNLENPAREAKNVNNMVHNVEIPFLFNHYDINVEY 222

Query: 246 HDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSW 305
           HDRGEGNYRVVGV V+P   K S+   C      L+L E  DNEV F+YSV+F  S T W
Sbjct: 223 HDRGEGNYRVVGVTVDP---KSSTGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVW 279

Query: 306 ATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQE 365
           ATRWDKYLHVYDP+IQW                      RALKSDFARY E NLDD FQ+
Sbjct: 280 ATRWDKYLHVYDPTIQWFSLINFSVVVILLSMVVIHSLMRALKSDFARYEEFNLDDTFQQ 339

Query: 366 DSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMF 425
           DSGWKL HGDVFR P +S++LSILVGSG Q+FLMV  SIFFAA+G LSPSSRGSL + MF
Sbjct: 340 DSGWKLGHGDVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMF 399

Query: 426 ILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGV 485
           ILYALFGF GSY SMG+YKFF+GPYWKAN+I+TP+L+PG + + I+ LNFFL+F  SSG 
Sbjct: 400 ILYALFGFCGSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGT 459

Query: 486 IPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPA 545
           IP + L F++ LWF+ SIPLS AGSL+A KKC+W EHPTKTN+IARQIPFQPWYLKT+PA
Sbjct: 460 IPPTALIFVIVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPA 519

Query: 546 TLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITYHSLCL 605
           TLIAG+FPFGSIAVELYFIY+SLWFNKIFYMFG                  +ITY+SL L
Sbjct: 520 TLIAGLFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTTLVTILITYYSLNL 579

Query: 606 ENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSI 665
           ENW+WQWR F VGGVGCA Y+F+HSI+FTKFKLGGFTTIVLY+GYS +IS LC +VTG+I
Sbjct: 580 ENWRWQWRSFIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAI 639

Query: 666 GFISSMFFIRKIYSSIKVD 684
           GFISSM F++KIYSS+KVD
Sbjct: 640 GFISSMLFVKKIYSSVKVD 658

>SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 660

 Score =  892 bits (2304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/670 (64%), Positives = 507/670 (75%), Gaps = 23/670 (3%)

Query: 16  ARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDK 75
           A AFYLPGVAPTTY + DEIPLLVNHLTPS Y+QH D++G+ +SGDKE FLYSYDYYYDK
Sbjct: 13  ASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDK 72

Query: 76  FHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLI 135
           FHFC+PE++ KQPESLGSIIFGDRIYNSPFELNML+ K CV LCK+ IP DDAKFINKLI
Sbjct: 73  FHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLI 132

Query: 136 KNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVV-DSETEQVQVASGETE 194
           +NGFF NWL+DGLPAARE+HDGRT + FYG GF LGFV+V   + D +T++V     E++
Sbjct: 133 RNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVS----ESD 188

Query: 195 QTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGNYR 254
             + AD   E ++  +                 K  E  YF NHFDIKIEYHDRGE NYR
Sbjct: 189 YIEIADADKELKERSA-----------------KLTELSYFINHFDIKIEYHDRGEDNYR 231

Query: 255 VVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSWATRWDKYLH 314
           VVGV V P SIKR S  +C+T G PLVL E  DN V+FTYSV F  S T WATRWDKYLH
Sbjct: 232 VVGVSVIPASIKRDSSDSCDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLH 291

Query: 315 VYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLNHG 374
           VYDP IQW                      RALK+D +RYNELNLDD+FQE++GWKL HG
Sbjct: 292 VYDPQIQWFSLISFSLIVILLSSVMVHSLFRALKNDLSRYNELNLDDEFQEETGWKLVHG 351

Query: 375 DVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFV 434
           DVFR P ++++LS+LVGSG Q+FLM   +I FA LG LSPSSRGSL TVMFILYALFG  
Sbjct: 352 DVFRTPERTMLLSVLVGSGAQLFLMAGFTILFALLGLLSPSSRGSLTTVMFILYALFGSF 411

Query: 435 GSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGVIPASTLFFM 494
           GSYTSM +YKFF+G  WK N+I+TP+LIP  I + ++ LN FL+FVHSSG IP  T+  +
Sbjct: 412 GSYTSMAVYKFFNGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAI 471

Query: 495 VFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPATLIAGIFPF 554
           V LWF+FSIPLS AGS+++RKK  WD  PT TNQIARQIPFQPWYLKT+PA+LIAG FPF
Sbjct: 472 VVLWFVFSIPLSVAGSIISRKKSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPF 530

Query: 555 GSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITYHSLCLENWKWQWRG 614
           GSI VELYFIY+SLWFNKIFYMFG                  ++TY+SLC+ENWKWQWRG
Sbjct: 531 GSIVVELYFIYSSLWFNKIFYMFGFLFFSFLLLTLTTTLVTVLLTYYSLCMENWKWQWRG 590

Query: 615 FTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFISSMFFI 674
           F +GG GCA YVF+H+ILFTKFKLGG TT+VLYLGYS VIS LCCL+TG++GF+SS++F+
Sbjct: 591 FWIGGAGCAFYVFVHAILFTKFKLGGLTTVVLYLGYSVVISGLCCLITGAVGFLSSLWFV 650

Query: 675 RKIYSSIKVD 684
           RKIY SIKVD
Sbjct: 651 RKIYGSIKVD 660

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score =  890 bits (2300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/674 (61%), Positives = 507/674 (75%), Gaps = 14/674 (2%)

Query: 13  VSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYY 72
           +S    FYLPGVAPTTY E D IPLLVNHLTPSM+++H+D DGN +S DKE+FLYSYDYY
Sbjct: 15  LSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYY 74

Query: 73  YDKFHFCKP--EHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKF 130
           Y K HFCKP    ++KQPESLGSI+FGDRIYNSPFEL ML ++ C  LC T IPGDDAKF
Sbjct: 75  YSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKF 134

Query: 131 INKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVAS 190
           IN LIK+GF QNWLIDGLPAAR+++D  TK+ FYG+GF LG VE+ QVVD          
Sbjct: 135 INDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQ 194

Query: 191 GETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGE 250
              E   + +   E    K +N+            +V + E  YFANHFDI IEYHDRG 
Sbjct: 195 PIVEDVLSQELDEEQATEKRANQ-----------MLVSSVERTYFANHFDIHIEYHDRGN 243

Query: 251 GNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSWATRWD 310
             YR+VGV VNP+S+KR S   C+TN   L L E +D +V FTYSV FE+S T WATRWD
Sbjct: 244 NEYRIVGVTVNPISMKRDS-AICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWD 302

Query: 311 KYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWK 370
           KYLH+YDP+IQW                      +ALK+DF RYNE NL+D F EDSGWK
Sbjct: 303 KYLHIYDPTIQWFSLINFTVIVVVLSIIVVHFLTKALKNDFVRYNEFNLNDSFDEDSGWK 362

Query: 371 LNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFILYAL 430
           L HGDVFR P++S++LSI VGSG Q+F M++  +  AALGFLSPS+RGSL T+MFILYA+
Sbjct: 363 LAHGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAV 422

Query: 431 FGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGVIPAST 490
           FGFVGSYTSMG+Y+FF+GPYWKAN+I+TPL++PG I + II++N FL+FVHSS V+P  T
Sbjct: 423 FGFVGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGT 482

Query: 491 LFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPATLIAG 550
           L  MV LW + S+PLSFAGSL++ K+C W +HPTKTN++ RQIPFQPWYLKT+PATLI G
Sbjct: 483 LSLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGG 542

Query: 551 IFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITYHSLCLENWKW 610
           IFPFGSIAVELYFIY+SLWFNKIFYMFG                  ++TYHSLCLENW+W
Sbjct: 543 IFPFGSIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRW 602

Query: 611 QWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFISS 670
           QWR F +GG+GC++Y+FIHSILFT+FKLGGF TIVLY+GYS++I++LC +VTG+IGFIS+
Sbjct: 603 QWRSFIIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISN 662

Query: 671 MFFIRKIYSSIKVD 684
           MFF++KIYSSIKV+
Sbjct: 663 MFFVKKIYSSIKVE 676

>CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {ON}
           highly similar to uniprot|Q04562 Saccharomyces
           cerevisiae YDR107c or uniprot|P32802 Saccharomyces
           cerevisiae YLR083c EMP70
          Length = 691

 Score =  887 bits (2292), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/688 (61%), Positives = 511/688 (74%), Gaps = 8/688 (1%)

Query: 5   QLFLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEH 64
           QL +L   V++   FYLPG AP TYK+ D IPLLVNHLTPS+ +QH D+DGN + GDK  
Sbjct: 4   QLLVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKAR 63

Query: 65  FLYSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIP 124
            LY YDYY +K HFC+PE +EKQPESLGS+IFG++IYNSPF + ML++ ECV LC T IP
Sbjct: 64  MLYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIP 123

Query: 125 GDDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVD---- 180
           G DAKFINKLIKNGF QNWLIDGLPAAR++HD RT T+FYG GF LGFVEV Q V     
Sbjct: 124 GKDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIV 183

Query: 181 SETE-QVQVASGETEQT-QAADGKTEPEKGKSSNEGMEL-DARDQGKNMVKTREFPYFAN 237
           SE+E ++Q++  + +      D +    K       +E+ +A++   N+V   E P FAN
Sbjct: 184 SESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFAN 243

Query: 238 HFDIKIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCE-TNGSPLVLDEANDNEVYFTYSV 296
           HFDI++EYHDRG G++RVVGVIVNP+S+      +C   N   L LDE  DNEV FTYSV
Sbjct: 244 HFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSV 303

Query: 297 KFEESPTSWATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNE 356
           KF  S T WATRWDKYLH+YDP IQW                      RALKSD +RYNE
Sbjct: 304 KFTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNE 363

Query: 357 LNLDDDFQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSS 416
            NL D+F+EDSGWKL HGDVFR P  S++LS+LVGSG+Q+FLM+  SI  +ALG LSPSS
Sbjct: 364 FNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALGILSPSS 423

Query: 417 RGSLATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFF 476
           RGSL T MF+ YA+FGFVGSYTSMGIYKFF GPYWKAN+I+TP+L+PG I L +I +N  
Sbjct: 424 RGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVL 483

Query: 477 LMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQ 536
           L FV SS VIP +TL FMVFLW LFSIPL+FAGSL++ KKC+WDEHPTKTN+I RQIPFQ
Sbjct: 484 LYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQ 543

Query: 537 PWYLKTLPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXX 596
           PW+LKT+PATLI G+  FGSIAVELYFIY+SLWFNKIFYMFG                  
Sbjct: 544 PWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINV 603

Query: 597 MITYHSLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISL 656
           +ITY +LC ENW WQWR F +GG+GC++Y+FIHSILFT+FKLGGF TIVLY+GYS +IS 
Sbjct: 604 IITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISF 663

Query: 657 LCCLVTGSIGFISSMFFIRKIYSSIKVD 684
           L C+VTG+IGFI SMFF+R+I++SIKVD
Sbjct: 664 LTCIVTGAIGFICSMFFVRRIFASIKVD 691

>KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]
           {ON} similar to uniprot|P32802 Saccharomyces cerevisiae
           YLR083C EMP70 Protein whose 24kDa cleavage product is
           found in endosome-enriched membrane fractions predicted
           to be a transmembrane protein
          Length = 665

 Score =  881 bits (2276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/673 (62%), Positives = 505/673 (75%), Gaps = 31/673 (4%)

Query: 16  ARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDK 75
             AFYLPGVAPTTY E D++PLLVNHLTPS +Y+H D D ++ +GDKE FLYSYDYYY K
Sbjct: 20  VEAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYKHYDTDQHD-TGDKEGFLYSYDYYYKK 78

Query: 76  FHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLI 135
           FHFC+P  ++KQPESLGSIIFGDRIYNSPF+L +L+  EC SLCK+VIPG DAKFINKLI
Sbjct: 79  FHFCQPAELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCKSVIPGKDAKFINKLI 138

Query: 136 KNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGETEQ 195
            NGFFQNW+IDGLPAAR++ D +T   FYG GF LG V+V    + +T  +     E E 
Sbjct: 139 LNGFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVDVLSDYEPDTRSLH---DELE- 194

Query: 196 TQAADGKTEPEKGKSSNEGMELDARDQGKNMV----KTREFPYFANHFDIKIEYHDRGEG 251
                              ++L+A+   KN++    K  E PYF NH+DI+IEYHDRGE 
Sbjct: 195 -------------------LQLNAK---KNVLSPGDKVTEIPYFVNHYDIQIEYHDRGEN 232

Query: 252 NYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSWATRWDK 311
           NYR+VGV VNP SIKR SP +CE+ G  LVL E  DNEVYFTYSVKF +S T WATRWDK
Sbjct: 233 NYRIVGVTVNPASIKRDSPDSCESTGKSLVLSETEDNEVYFTYSVKFIKSDTVWATRWDK 292

Query: 312 YLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKL 371
           YLHVYDP IQW                       ALK+D ARYNELNLD DF+E++GWKL
Sbjct: 293 YLHVYDPKIQWFSLINFSTIVVLLSSVMLHSLYSALKNDLARYNELNLDTDFEEETGWKL 352

Query: 372 NHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALF 431
            HGDVFR P+++L+LS+LVGSG Q+ LM+T +I FA LGFLSPSSRGSL+TVMF+LYA+F
Sbjct: 353 IHGDVFRSPNKALLLSVLVGSGGQLALMLTTTILFACLGFLSPSSRGSLSTVMFLLYAIF 412

Query: 432 GFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGVIPASTL 491
           G  GS+TSM  YKFF+G  W+ N+++TPLL+PG+IL V++ LNFFL+FVHSSG IP  T+
Sbjct: 413 GSFGSFTSMATYKFFNGKAWRLNLVLTPLLVPGSILTVVLGLNFFLIFVHSSGAIPFQTM 472

Query: 492 FFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPATLIAGI 551
             +V LWF+ SIPLS  GS++A KKC+W+EHPTKTNQIARQIPFQPWYLKT+P  L+AGI
Sbjct: 473 LVLVLLWFVISIPLSAIGSVIAWKKCNWNEHPTKTNQIARQIPFQPWYLKTIPVALLAGI 532

Query: 552 FPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITYHSLCLENWKWQ 611
           FPFGSIAVELYFIY+SLWFNKI+YMFG                  ++TYHSLC+ENWKWQ
Sbjct: 533 FPFGSIAVELYFIYSSLWFNKIYYMFGFLFFSFILLALTTSLITVLLTYHSLCMENWKWQ 592

Query: 612 WRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFISSM 671
           WR F +GG GCA YVF HSILFTKF+LGG TTIVLYLGYS +IS LCCLVTG+IGF+SS+
Sbjct: 593 WRSFVIGGCGCAFYVFCHSILFTKFRLGGLTTIVLYLGYSILISGLCCLVTGAIGFLSSL 652

Query: 672 FFIRKIYSSIKVD 684
             +RKIYS +KVD
Sbjct: 653 ILVRKIYSCVKVD 665

>Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {ON}
           YLR083C (EMP70) - endosomal membrane protein [contig
           176] FULL
          Length = 683

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/675 (63%), Positives = 506/675 (74%), Gaps = 8/675 (1%)

Query: 13  VSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYY 72
            S    FYLPGVAPTTY E D IPLLVNHLTPSMY++H D+DG + +GD+E FLYSYDYY
Sbjct: 14  ASRVEGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKD-TGDRESFLYSYDYY 72

Query: 73  YDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFIN 132
           YDKFHFCKPE +EKQ ESLGSIIFGDRIYNSPF+L ML++KEC +LC + IP +DAKFIN
Sbjct: 73  YDKFHFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFIN 132

Query: 133 KLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQV---VDSETEQVQVA 189
           KLI NGFFQNWL+DGLPAAR+  D RTK++FY  GF LGF++V      +D + E+    
Sbjct: 133 KLIANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHP 192

Query: 190 SGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRG 249
            G T+     D    P K K+      +D     K +VK  E  YFANHF+I+++YHDRG
Sbjct: 193 KGATKPVAQDDYLDRPSKSKNEKRKKIVDP----KELVKQLETAYFANHFNIEVQYHDRG 248

Query: 250 EGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSWATRW 309
            G+YRVVGVIVNP SIKR S  +C   G  L L E  +  V+F+YSVKF  S T WATRW
Sbjct: 249 NGDYRVVGVIVNPQSIKRDSSNSCAATGELLKLSEEEETTVHFSYSVKFTPSDTVWATRW 308

Query: 310 DKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGW 369
           DKYLHVYDP IQW                      R L+ D +RYN+LNLDDDFQE++GW
Sbjct: 309 DKYLHVYDPKIQWYSLINFSIVVIVLSSVVIHSLYRTLRDDLSRYNQLNLDDDFQEETGW 368

Query: 370 KLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFILYA 429
           KL HGDVFR P++SL+LS+LVGSG Q+F+M  C+I FA LG LSPSSRGSL TVMFILYA
Sbjct: 369 KLVHGDVFRTPTKSLLLSVLVGSGTQLFVMAACTIAFALLGLLSPSSRGSLTTVMFILYA 428

Query: 430 LFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGVIPAS 489
           LFG +GSYTSM  YKFF G YWK N+I+TP+L+PG +  V++ LNFFL+ V S+G IP  
Sbjct: 429 LFGSLGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFG 488

Query: 490 TLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPATLIA 549
           T+  +V LWF+FSIPLS AGSL+A+KKC W+EHPTKT QI RQIPFQPWYLKT PA LIA
Sbjct: 489 TMCAIVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIA 548

Query: 550 GIFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITYHSLCLENWK 609
           GIFPFGSIAVELYF+Y+SLWFNKIFYMFG                  ++TY+SLCLENWK
Sbjct: 549 GIFPFGSIAVELYFVYSSLWFNKIFYMFGFLFVSFLLLTLTTALVTVLLTYYSLCLENWK 608

Query: 610 WQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFIS 669
           WQWRGF +GG GCALYVF+H+ILFTKFKLGGF TIVLY+GYS VISLL CL+TG++GF+S
Sbjct: 609 WQWRGFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMS 668

Query: 670 SMFFIRKIYSSIKVD 684
           S++F+R+IYSSIKVD
Sbjct: 669 SLWFVRRIYSSIKVD 683

>KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 687

 Score =  872 bits (2252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/686 (63%), Positives = 508/686 (74%), Gaps = 11/686 (1%)

Query: 6   LFLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHF 65
           L L     S    FYLPGVAPTTY E D IPLLVNHLTP+MYYQH DEDGN++ GDKE  
Sbjct: 6   LLLSILWASQVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-GDKESL 64

Query: 66  LYSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPG 125
           LYSYDYYY KFHFC+PE +EKQ ESLGSIIFGDRIYNSPF++ ML+ KEC SLC   IP 
Sbjct: 65  LYSYDYYYPKFHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPA 124

Query: 126 DDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVV------ 179
           DDAKFINKLI NGFFQNWL+DGLPAAR+  D RTK++FY  GF LG+V +          
Sbjct: 125 DDAKFINKLITNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNGQ 184

Query: 180 -DSETEQVQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANH 238
             S+      + G T++   +D    P   +S  +  ++      K +VK  E PYFANH
Sbjct: 185 GGSQDGDDSGSHGSTKEVSESDYLDAPPAKRSLAKRKQVS---NTKELVKQLETPYFANH 241

Query: 239 FDIKIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKF 298
           F+I+++YHDRG GNYRVVGVIVNP SIKR SP TC+  G  L L E    EV+F+YSVKF
Sbjct: 242 FEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKF 301

Query: 299 EESPTSWATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELN 358
             S T WATRWDKYLHVYDP IQW                        L  D +RYN++N
Sbjct: 302 TPSETVWATRWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQIN 361

Query: 359 LDDDFQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRG 418
           LDDDFQE++GWKL HGDVFR P +SL+LS+LVGSG Q+FLM  C+I FA LG LSPSSRG
Sbjct: 362 LDDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFALLGLLSPSSRG 421

Query: 419 SLATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLM 478
           SL TVMFILYALFG  GSYTSM  YKFF GPYWK N+++TP+L+PG +  V++ALNFFL+
Sbjct: 422 SLTTVMFILYALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLV 481

Query: 479 FVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPW 538
            V S+G IP  T+  +V LWFLFSIPLS AGSL+ARKKC WDEHPTKT QI RQIPFQPW
Sbjct: 482 VVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPW 541

Query: 539 YLKTLPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMI 598
           YLKT+PA+LIAGIFPFGSIAVELYFIY+SLWFNKIFYMFG                  ++
Sbjct: 542 YLKTVPASLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTSLITVLL 601

Query: 599 TYHSLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLC 658
           TY+SLCLENWKWQWRGF +GG GCALY+FIH+ILFTKF+LGGFTTIVLY+GYS V+SLL 
Sbjct: 602 TYYSLCLENWKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLS 661

Query: 659 CLVTGSIGFISSMFFIRKIYSSIKVD 684
           CL+TG++GF+SS++F+R+IYSS+KVD
Sbjct: 662 CLITGTVGFLSSLWFVRRIYSSVKVD 687

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score =  847 bits (2187), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/685 (60%), Positives = 505/685 (73%), Gaps = 12/685 (1%)

Query: 7   FLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFL 66
            L+  +VS   AFYLPGVAP+TY E DE+PLLVNHLTPS+ YQ +D+ G  V   +E  L
Sbjct: 6   LLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVE-SREKML 64

Query: 67  YSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGD 126
           YS+DYY+ K HFCKPE + KQP+SLGSI+FGDRIYNSPF + ML+ +  V LC   IPG 
Sbjct: 65  YSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGS 124

Query: 127 DAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVV------- 179
           DAKFINKLIKNGFFQNWLIDGLPAAR+++D  T T+FY  GF LGFVE+ + V       
Sbjct: 125 DAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPM 184

Query: 180 DSETEQVQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHF 239
           D++T+     +  +++ + +  K + +K + SN+  + + +   K +V   EFPY ANH+
Sbjct: 185 DAKTKDSGKKNSNSDKKKDSKKKDDSQKKEDSNKKEKREPKRISK-LVHNVEFPYLANHY 243

Query: 240 DIKIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFE 299
            I +E HDRGEGNYRVVGV V+P S   S+       G+ L LDE  DNEV F+YSV F 
Sbjct: 244 VINVEVHDRGEGNYRVVGVTVDPYSTTDSA---NPEKGNKLFLDEKKDNEVTFSYSVNFI 300

Query: 300 ESPTSWATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNL 359
           ES T WATRWDKYLH Y+P+IQW                      +ALKSDFARY E NL
Sbjct: 301 ESETVWATRWDKYLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSDFARYEEFNL 360

Query: 360 DDDFQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGS 419
           D+ F EDSGWKL HGDVFR PSQS++LSILVGSG Q+FLM+  SIF AA+G +SPSSRGS
Sbjct: 361 DNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGS 420

Query: 420 LATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMF 479
           L + MF  YALFGF GSY SM +YKFF GPYWKAN+I+TPLL+PG IL+ I+ LNFFL+F
Sbjct: 421 LPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLF 480

Query: 480 VHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWY 539
           VHSSG IP + L  +V +WF+ S+PLSF GSL+A K+ +W EHPTKTNQIARQIPFQ WY
Sbjct: 481 VHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWY 540

Query: 540 LKTLPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMIT 599
           LKT+PA LIAGIFPFG+IAVELYFIYTSLWFNKIFYMFG                  +IT
Sbjct: 541 LKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLTTSLVTVLIT 600

Query: 600 YHSLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCC 659
           Y SLC+ENW WQWR FT+GGVGC+LY+FIHSILFTKFKLGGFTT++LY+GY+ ++S+L C
Sbjct: 601 YQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSC 660

Query: 660 LVTGSIGFISSMFFIRKIYSSIKVD 684
           +VTG++GFISSM F+RKIYS+++VD
Sbjct: 661 IVTGAVGFISSMIFVRKIYSNVRVD 685

>NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254
          Length = 663

 Score =  842 bits (2176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/684 (57%), Positives = 496/684 (72%), Gaps = 21/684 (3%)

Query: 1   MAYIQLFLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSG 60
           M Y+ L LL F +S   AF LPG+ P TY++ D+IPLLVNHLTPSM++ H++E+G ++S 
Sbjct: 1   MNYVILSLL-FCLSVVEAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKDIST 59

Query: 61  DKEHFLYSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCK 120
            K++ ++SYDYYY+KFHFC+P H+EK   S+GSI+FGDRIYNSPF+LNML+ K CV LC+
Sbjct: 60  AKKYVVHSYDYYYEKFHFCQPVHIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVPLCE 119

Query: 121 TVIPGDDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVD 180
           ++IPG DA+FINKLIKNG++QNW IDGLPAAREV+D RTK+ FYG GF LG VE+ Q   
Sbjct: 120 SIIPGKDAEFINKLIKNGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLVEIRQ--- 176

Query: 181 SETEQVQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFD 240
                    +G+         K  P+     ++  + DA++  +N++K  E PYF NHFD
Sbjct: 177 --------TTGD---------KLLPDSVHDISDLAKRDAKNLVQNLIKEVEVPYFVNHFD 219

Query: 241 IKIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEE 300
           I IEYH+RG GNYRVVG  VNP+SI R S G C   G  L L+E  DN V+ TYSV F  
Sbjct: 220 IVIEYHERGNGNYRVVGATVNPVSIARKSAGDCTPTGKSLTLNEEEDNNVHSTYSVTFVP 279

Query: 301 SPTSWATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLD 360
           S TSW TRWDKYLHVYDP IQW                      +ALKSDFARYN +NLD
Sbjct: 280 SKTSWVTRWDKYLHVYDPKIQWFSLINFSLIVILLSVILINSLLKALKSDFARYNNINLD 339

Query: 361 DDFQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSL 420
           DD +E+SGWKL HG VFR P   ++LSILVGSG Q+FL++ C++F AA+  LSP  RG+L
Sbjct: 340 DDVKEESGWKLVHGYVFRIPKNPMILSILVGSGFQLFLVIVCTVFLAAIDILSPIYRGAL 399

Query: 421 ATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFV 480
            T M ILY LFGF+ SY SMG+YKFF GPYWK N+++TP+L+PG I++  +ALN FLMF 
Sbjct: 400 PTAMIILYILFGFISSYVSMGVYKFFKGPYWKVNMLLTPILVPGLIIITFLALNLFLMFS 459

Query: 481 HSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYL 540
            SS V+PA T+  ++ LWF  SIPLS AGSL+A+KKCHWDEHPT TNQIA+ IP Q WYL
Sbjct: 460 ESSSVVPAKTIMTLILLWFAVSIPLSVAGSLMAQKKCHWDEHPTVTNQIAKVIPPQKWYL 519

Query: 541 KTLPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITY 600
           KT+PA+LI G+F FGSI+V+LYFIYTSLWFN IFYM+G                  + TY
Sbjct: 520 KTIPASLIGGLFSFGSISVQLYFIYTSLWFNNIFYMYGFLLFSICLFTMTITLVTILFTY 579

Query: 601 HSLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCL 660
           HSLC ENWKWQWRGF +GG+GC++YV +HS+ F + KLGGFT I+LY+GYSSV++ L  L
Sbjct: 580 HSLCQENWKWQWRGFFIGGLGCSIYVLLHSLFFIELKLGGFTNILLYMGYSSVVTALIFL 639

Query: 661 VTGSIGFISSMFFIRKIYSSIKVD 684
           VTGS+GF+SSMFFI++I+SS+KVD
Sbjct: 640 VTGSVGFLSSMFFIKRIFSSVKVD 663

>TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {ON}
           Anc_8.254 YLR083C
          Length = 673

 Score =  837 bits (2161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/682 (57%), Positives = 495/682 (72%), Gaps = 22/682 (3%)

Query: 6   LFLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHF 65
           L L+ F +  + AFY+PG++  TY   D I L VN LTPSMY++H DE+G +V+ DKEHF
Sbjct: 9   LCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHF 68

Query: 66  LYSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPG 125
           LYSYDYYYDKFHFC+PE VE++ ESLGS++FGDRIYNSPFEL ML+ KECV LCKT IP 
Sbjct: 69  LYSYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPA 128

Query: 126 DDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQ 185
           DDAKFINKLIKNGFF NWLIDGLP+AR+++D +T++ FY +GF LG V V          
Sbjct: 129 DDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSV---------- 178

Query: 186 VQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKN----MVKTREFPYFANHFDI 241
                   E        T P   K  NE ++   + + KN    ++   E  YFANHF+I
Sbjct: 179 --------EHMSGGSKVTIPGVSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNI 230

Query: 242 KIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEES 301
            IEYHDRG  NYRVVGV V+P+SIKR    +C   G+ L L+E  +N+V FTYSV F +S
Sbjct: 231 HIEYHDRGNNNYRVVGVTVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKS 290

Query: 302 PTSWATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDD 361
            T+WATRWDKYLH YDPSIQW                      RALK D +RY +LNLD+
Sbjct: 291 ETAWATRWDKYLHTYDPSIQWFSLINFTIVVVLLSTIVIHALLRALKKDISRYTDLNLDN 350

Query: 362 DFQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLA 421
            F EDSGWKL HGDVFR P ++++LSI VGSGVQ+FLM+ C +  AALGF+SPS RG+L 
Sbjct: 351 SFTEDSGWKLTHGDVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALP 410

Query: 422 TVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVH 481
           T MF+LYA+FGFVGSYTSMG+YKFF GPYWKAN+I+TPLL+PG++LL+II LNFFL+ VH
Sbjct: 411 TCMFVLYAIFGFVGSYTSMGVYKFFHGPYWKANMILTPLLVPGSMLLLIIFLNFFLLGVH 470

Query: 482 SSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLK 541
           SSG IPAST+  M+ LW L S+PLSF GS VA KKC+W+++PT  N+I R+IP QPWY++
Sbjct: 471 SSGTIPASTIILMICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMR 530

Query: 542 TLPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITYH 601
           ++P  L++GI PFG+IAVELYFIY+SLW+NKIFYMFG                  ++ YH
Sbjct: 531 SIPVVLLSGIVPFGAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYH 590

Query: 602 SLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLV 661
           SLCLENW+WQWR F  GG+GCA Y+F++SI FT+FK  GF +I+LY+GYSS+I ++ CL+
Sbjct: 591 SLCLENWRWQWRSFVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLI 650

Query: 662 TGSIGFISSMFFIRKIYSSIKV 683
           TG++ F+ +MFF+++I++SIKV
Sbjct: 651 TGAVSFMCNMFFVKRIFTSIKV 672

>TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {ON}
           Anc_8.254 YLR083C
          Length = 656

 Score =  804 bits (2076), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/671 (57%), Positives = 470/671 (70%), Gaps = 27/671 (4%)

Query: 14  SAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYY 73
           + +RA +LPG++PT Y    EI L VNHLTPS ++QH+D+DGNN+  DKEH+LYSYDYY 
Sbjct: 13  AVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYN 72

Query: 74  DKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINK 133
            K HFCKPE+V +Q ESLGS++FGDR+YNSPF+LNML++K CVSLCK+VIPG+DA FINK
Sbjct: 73  SKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINK 132

Query: 134 LIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGET 193
           LIKNGF  NWL+DGLPA   +++ R  +     GF LG VE+ Q V +            
Sbjct: 133 LIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHN------------ 180

Query: 194 EQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGNY 253
                A      E G S+           G N+V   E P+  NH+DI I+YH+   G Y
Sbjct: 181 ----GAMATPREETGISA----------HGSNVVVNLELPHLNNHYDITIQYHEPEAGKY 226

Query: 254 RVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSWATRWDKYL 313
           R+VGV V P SIK++S  +CE  G  + L E  DNEV +TYSV++     +WATRWD Y 
Sbjct: 227 RIVGVEVEPKSIKQTS-NSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYR 285

Query: 314 HVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLNH 373
             YD ++QW                      RALKSDFARYNELNLDD+F E+SGWKL+H
Sbjct: 286 FSYDTTVQWFSLISCVIVVIGLSSVVLHMLLRALKSDFARYNELNLDDEFHEESGWKLSH 345

Query: 374 GDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGF 433
           GDVFR P++SL+LS+LVGSGVQ+ L+    I  AA+ F +  SR  L T+ F+LYALFGF
Sbjct: 346 GDVFRMPNKSLLLSVLVGSGVQLLLLAVGGIVIAAIAFNNAGSREVLPTIFFVLYALFGF 405

Query: 434 VGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGVIPASTLFF 493
           VGSY SMG+Y+FF GPY K N+I+TP LIPG ILL II+LNFFL+  HSS  IP S LF 
Sbjct: 406 VGSYASMGVYRFFKGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFA 465

Query: 494 MVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPATLIAGIFP 553
           +V LW + S+PLS AGSL A K C WD+HPTKTNQIARQIPFQPWYLKTLPA L+AGIFP
Sbjct: 466 VVLLWLIISVPLSLAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFP 525

Query: 554 FGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITYHSLCLENWKWQWR 613
           F SIAVELYFIY SLWF++ FYMFG                  MITYHSLCLENW+WQWR
Sbjct: 526 FASIAVELYFIYNSLWFHQFFYMFGFSMVSLFLLVLTTALVTVMITYHSLCLENWQWQWR 585

Query: 614 GFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFISSMFF 673
            F VGG+G A+Y+FIHSI FT+FKL GFTTIVLY+GYS +IS+LCCL TG++GF SSMF 
Sbjct: 586 SFIVGGLGSAVYIFIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFL 645

Query: 674 IRKIYSSIKVD 684
           +RKI+SS+KVD
Sbjct: 646 VRKIFSSVKVD 656

>NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8.254
          Length = 619

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/639 (55%), Positives = 455/639 (71%), Gaps = 20/639 (3%)

Query: 46  MYYQHQDEDGNNVSGDKEHFLYSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPF 105
           M+Y H++++G ++S D +  +YSYDYYY+K HFCKPEHVEK   S+GS++FGDR+YNSPF
Sbjct: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60

Query: 106 ELNMLQEKECVSLCKTVIPGDDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYG 165
           +LNML+ K C  LC + I G DAKFINKLIKNG++QNWLIDGLPAAREV+D RTK++FYG
Sbjct: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120

Query: 166 AGFGLGFVEVAQVVDSETEQVQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKN 225
            GF LG VE+ Q            +GE         K  P    +  +  + DA++  +N
Sbjct: 121 NGFELGLVEIRQ-----------TTGE---------KLLPNSADTFRDLHKRDAKNIVQN 160

Query: 226 MVKTREFPYFANHFDIKIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEA 285
           +++  E PYF NHFDI+IEYHDRG  NYRVVGV VNP+SI RS  G C+  G  L L E+
Sbjct: 161 LMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSES 220

Query: 286 NDNEVYFTYSVKFEESPTSWATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXR 345
             N ++FTYSV+F  S T+W TRWDKYLHVYDP+IQW                      +
Sbjct: 221 EVNYIHFTYSVEFIPSETAWVTRWDKYLHVYDPTIQWVSIVNFSIVVIILSCAVARSLLQ 280

Query: 346 ALKSDFARYNELNLDDDFQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIF 405
           ALKSDF+RY ELNLD+  +ED+ WKL HGDVFR P   ++LSILVGSGVQ+FLM+ C+IF
Sbjct: 281 ALKSDFSRYGELNLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIF 340

Query: 406 FAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGA 465
             A+G ++P SRG+L TVMF+LY  F F+ S+ SMG+YKFF+G  W  N I+TP L+PG 
Sbjct: 341 LPAVGLITPGSRGTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCILTPFLVPGL 400

Query: 466 ILLVIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTK 525
           +LLVII LN FL+FVHSSGVIP +T   ++ LWF   +PLS  GSL+ARK CHWD HPTK
Sbjct: 401 LLLVIIGLNIFLIFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTK 460

Query: 526 TNQIARQIPFQPWYLKTLPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXX 585
           TN +++ IP Q WYL+T+PA+LI G+F FGS++VELYF+YTSLWFNKIFYM+G       
Sbjct: 461 TNTVSKVIPPQKWYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAI 520

Query: 586 XXXXXXXXXXXMITYHSLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIV 645
                      + TY+SL  ENW+WQWR F + G+GC+ YVF+HS+LFT+ KLGGFT  +
Sbjct: 521 LFTLTVSLVTVLFTYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNAL 580

Query: 646 LYLGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 684
           LY+GYS VI+ L  +VTG++GF+SSM F+R IYS++KVD
Sbjct: 581 LYMGYSFVITSLAFVVTGALGFLSSMLFVRTIYSAVKVD 619

>AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR083C (EMP70) and
           YDR107C
          Length = 653

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/669 (55%), Positives = 463/669 (69%), Gaps = 29/669 (4%)

Query: 16  ARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDK 75
           A+ FYLPG APTTY+  D IPLLVNH+TP+++    D  G +   DKE +LY+YDYYY +
Sbjct: 14  AQGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERYLYAYDYYYPR 71

Query: 76  FHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLI 135
            H C+P+ +EK  ESLGSIIFGDR++NSPFEL ML+EK CV+LC+  +P +DAKFIN+LI
Sbjct: 72  LHMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLI 131

Query: 136 KNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGETEQ 195
           ++GFF NWL+DGLPA RE+HD RT T FYG GF LG               +V  G  ++
Sbjct: 132 RSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG---------------RVIRGTEDR 176

Query: 196 TQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGNYRV 255
            Q   G+ E +  +    G  + A             PYF NHF+I ++YH R E   RV
Sbjct: 177 NQEEPGEIELQTRRVLQPGESVVA------------VPYFINHFEITVDYHKRAEDELRV 224

Query: 256 VGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSWATRWDKYLHV 315
           VGV V P S++      C  +G+ LVL E  D +V FTYSV+F ES  SWATRW KYLHV
Sbjct: 225 VGVSVLPRSLQNPVGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHV 284

Query: 316 YDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLNHGD 375
           YDP +QW                      RALK+D  RYN+ NLD++FQED GWKL H D
Sbjct: 285 YDPKVQWYSLINFSLVVLLLSSIMVHSLFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSD 344

Query: 376 VFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVG 435
           VFR PS++L+LS+ VGSG Q+FLM  C++F A LGFLSPSSRGSL T+MF+LYA+FG  G
Sbjct: 345 VFRSPSKTLLLSVFVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFG 404

Query: 436 SYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGVIPASTLFFMV 495
           SY SM  YK F G  WK N+++TPLL+PG I   ++ +NFFL+ V SSG +P  T+  +V
Sbjct: 405 SYLSMSTYKMFGGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIV 464

Query: 496 FLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPATLIAGIFPFG 555
            LWF+ SIP+S  GSL ARKK  WD+HPTKT+QIA+QIP QPWYL+T PA  IAG+FPFG
Sbjct: 465 VLWFVLSIPISIMGSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFG 524

Query: 556 SIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITYHSLCLENWKWQWRGF 615
           +IAVELYFIYTS+WFN +FYMFG                  ++TY+SLC+ENW WQWR F
Sbjct: 525 AIAVELYFIYTSIWFNTMFYMFGFLFFTFLLLTLTTALVTILLTYYSLCMENWSWQWRSF 584

Query: 616 TVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFISSMFFIR 675
            +GG+GC+ YVFI+SILFTKF+LGGF TIVLY+GYS +IS L CLVTG+IGF+SS++F+R
Sbjct: 585 IIGGIGCSTYVFINSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVR 644

Query: 676 KIYSSIKVD 684
           KIYSSIKVD
Sbjct: 645 KIYSSIKVD 653

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/684 (45%), Positives = 410/684 (59%), Gaps = 79/684 (11%)

Query: 1   MAYIQLFLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSG 60
           M  I+ FLL      +  FY PGV+P TY   DEIPLLVN+L+                 
Sbjct: 1   MRLIRSFLL--CAGVSYGFYFPGVSPVTYHIGDEIPLLVNYLS----------------- 41

Query: 61  DKEHFLYSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCK 120
               FL++ DYY D    CKP  +++Q ESLGS+IFGDR+YNSPF+++ML+  ECV LC 
Sbjct: 42  --SDFLWNIDYYSDSIGLCKPNTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCD 99

Query: 121 TVIPGDDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVD 180
           T I   D    N      +  NWL+DGLP                               
Sbjct: 100 TTI---DTALWNTFFGYRYSYNWLVDGLPVL----------------------------- 127

Query: 181 SETEQVQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFD 240
                              DG ++     +++E       D+ K         Y  NHFD
Sbjct: 128 -----------------GIDGTSDANGYHNNSELFMGYQADEQK---------YIYNHFD 161

Query: 241 IKIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEE 300
           I I Y+DRG+G YRVV     P+S+ R+    C  +  P+ +   N   + FTYSV F++
Sbjct: 162 IYIHYNDRGKGEYRVVFAEAKPISLPRTGSELCSKDAKPVPIGSGNHENITFTYSVIFKK 221

Query: 301 SPTSWATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLD 360
           S  SW+TRWD+YLHVYD  IQ                       R LK D A Y+E NLD
Sbjct: 222 SDISWSTRWDQYLHVYDFDIQLAELISFSLVVLLLSSVLVHSLFRVLKRDIAAYSEFNLD 281

Query: 361 DDFQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSL 420
           D+FQ+D  WK+ HG+VFR PS++L+LS+ VGSG Q+F M  C++   + GFLSPS+RGSL
Sbjct: 282 DEFQQDYCWKIIHGEVFRSPSKALLLSVFVGSGSQLFFMALCTVLLGSCGFLSPSARGSL 341

Query: 421 ATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFV 480
            TVMF+LYALFG VGSYTSM IYKFF G  WK N+I+TPLLIP  + +  + LNFFL++ 
Sbjct: 342 GTVMFVLYALFGGVGSYTSMSIYKFFGGQNWKLNLILTPLLIPVFLFVTTVLLNFFLIYA 401

Query: 481 HSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYL 540
            SSG +P  T+  ++ LWF+ S+P+S  GSL++ K   WDEHP KTNQIARQ+P QPWY+
Sbjct: 402 KSSGAMPFGTMVTIIILWFILSVPVSIIGSLLSWKLNRWDEHPAKTNQIARQVPSQPWYI 461

Query: 541 KTLPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITY 600
           KT  AT +AG+FPFG++AVELY+IY S+W   IF+M+G                  ++TY
Sbjct: 462 KTWVATFLAGMFPFGAMAVELYYIYASIWGEIIFFMYGFLFVAFILLTLTTSLVTILLTY 521

Query: 601 HSLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCL 660
           +SLC+ENWKWQWR F +GGVGC++YVF+HS+ F KFK  GF ++VLYLGYS+++S++CCL
Sbjct: 522 YSLCMENWKWQWRSFIIGGVGCSVYVFLHSLFFIKFKFPGFVSMVLYLGYSAMVSIVCCL 581

Query: 661 VTGSIGFISSMFFIRKIYSSIKVD 684
           VTGSIGF+++++F+RKIYS+IKVD
Sbjct: 582 VTGSIGFLANLWFVRKIYSNIKVD 605

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa]
           {ON} Anc_7.411 YER113C
          Length = 670

 Score =  155 bits (392), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 170/704 (24%), Positives = 278/704 (39%), Gaps = 130/704 (18%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDKFHFCKPEH 83
           + P  Y + D + L+VN                 V  D     Y+Y   YD   F  P  
Sbjct: 42  LRPNYYSKGDPVELIVN----------------KVESDLTQLPYAY---YD-LPFTCPPT 81

Query: 84  VEKQPE--SLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLIKNGFFQ 141
           + K+P   SL  II GDR + S + LN  ++ +C  LC      +  K   +L+KNG+  
Sbjct: 82  MHKKPLHLSLNEIIRGDRKWQSDYILNFGEDDQCHILCTRKTTKEGMKEAQELVKNGYVV 141

Query: 142 NWLIDG-LPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGETEQTQAAD 200
            WLID  LPA            +Y +GF LGFV+                          
Sbjct: 142 QWLIDDELPAVTTFISTTDHKKYYASGFPLGFVD-------------------------- 175

Query: 201 GKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGNYRVVGVIV 260
               PE GK+                       Y   H  I I Y+      + + G  +
Sbjct: 176 ----PETGKT-----------------------YLNTHVMIVIRYNTVDTNKHTIFGFEL 208

Query: 261 NPLS-IKRSSPGTCET-NGSPLVLDEANDNEVY--FTYSVKF-EESPTSWATRWDKYLHV 315
            P S +    PG  +      LV+ E +D+  +  FTYSV + EE    W  RWD YL+ 
Sbjct: 209 YPKSTVDFHCPGASKDYEQYELVVPENDDDLTFIPFTYSVYWREEYLVDWEHRWDLYLNA 268

Query: 316 YDPS------IQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDD-----FQ 364
            + S        W                      R  K     +++++ ++D     + 
Sbjct: 269 GELSNDKSKQFHWISLANSFGIVFLISSITAVILYRTFKISRRSFSDISKEEDDKGSIYV 328

Query: 365 EDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVM 424
               W LN     + P  ++++ I V  GVQ    V  S+  +       + R S+ T+ 
Sbjct: 329 VARKWLLNE----QTPLANVLI-IFVSMGVQFLFTVLGSLIISCSLKKLHNVRDSVLTMG 383

Query: 425 FILYALFGFVGSYTSMGIYKFFD----------GPYWKANVIMTPLLIPGAILLVIIALN 474
            + +    F+ S+T   + K  +            Y+    ++   L+P  ++LV + LN
Sbjct: 384 LLCFVTGAFMASFTGAHLLKSREEMCSESQMKPTRYYPVFALLCGSLLPSFVMLVALLLN 443

Query: 475 FFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIA---- 530
             +    S+  +P  T+ F++ ++F+  IPLS  G  +A K    +  P+ +  I     
Sbjct: 444 SIVWAHDSTHALPFGTVLFLISVYFVVCIPLSLLGGYIAVKST--NSKPSFSFSIGNYSD 501

Query: 531 -----RQIPFQPWYLKTLP----ATLIAGIFPFGSIAVELYFIYTSLWFNKI--FYMFGX 579
                + I   P  L   P    A L  G+FPF  I VEL ++Y SLW  K   +Y +G 
Sbjct: 502 RIFVYKTITMSPSVLINRPLSSLAILAGGLFPFIIIYVELQYVYKSLWLEKTTFYYFYGF 561

Query: 580 XXXXXXXXXXXXXXXXXMITY---HSLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKF 636
                            + T+   +S    +  W+W  F +G   CA Y+ ++S+ +  F
Sbjct: 562 LLANILLLCIVICEISIIGTFILLNSADKNSNNWRWTSFQIGA-SCAFYMEVYSLYYVFF 620

Query: 637 KLG--GFTTIVLYLGYSSVISLLCCLVTGSIGFISSMFFIRKIY 678
            L   GF++I + + Y ++ +++C   TGSI  ++S +F++KIY
Sbjct: 621 ILNIRGFSSIFISVCYGTLFNIMCGCATGSIACLTSHWFVQKIY 664

>SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 707

 Score =  149 bits (375), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 171/749 (22%), Positives = 282/749 (37%), Gaps = 189/749 (25%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDKFHFCKPEH 83
           + P  Y+END + ++VN                 +  D   F Y+Y   Y+    C P +
Sbjct: 56  IRPNVYEENDPVEIIVN----------------KIESDLTQFPYAY---YELPFTCPPTN 96

Query: 84  VEKQPE-SLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLIKNGFFQN 142
           V+K    SL  II GDR + S + L+  +++ C+ LC      D  +  ++LIK G+   
Sbjct: 97  VKKPLHLSLNEIIRGDRKWQSDYLLHFKKDEHCLRLCDRKTSPDALRKAHELIKQGYVVQ 156

Query: 143 WLIDG-LPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGETEQTQAADG 201
           WLID  LPAA      +    +Y +GF LGF++                           
Sbjct: 157 WLIDDELPAATTFISTKDHKKYYASGFPLGFMD--------------------------- 189

Query: 202 KTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGNYRVVGVIVN 261
                             +D GK         Y  NH  + I YH      + +VG+ V 
Sbjct: 190 ------------------KDTGKT--------YLNNHVMLVIRYHTVDINKFTIVGLEVY 223

Query: 262 PLSIKRSSPGTCETNGSPLVLDEANDNEVY--FTYSVKF-EESPTSWATRWDKYLHVYDP 318
           P S+          N     ++       Y  FTYS+ + EE    W  RW+ +++  + 
Sbjct: 224 PKSVSDYHCPGASKNFDHYEVNTEETETTYIPFTYSIYWREEFNVDWTNRWNFFINSGEI 283

Query: 319 S------IQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLN 372
           S        W                      +++ +D     E       Q  S W + 
Sbjct: 284 SQEKSSQFHWISLANSVVIVTLMTLVVALILAKSVSTD-----ETVSTSTSQVASQWVVQ 338

Query: 373 HGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFG 432
           H  +         L++    GVQ    +  S+  +       + R S+ T+     AL  
Sbjct: 339 HSYLLN------HLNVFTAMGVQFLFTILGSLIISCSMNKLHNIRNSVLTM-----ALMC 387

Query: 433 FV-GSYTSMGIYKFFDGPYWKAN-------VIMTPLLIPGAILLVIIALNFFLMFVHSSG 484
           F+ G+YTS      F G    AN        I     +PG  L V++ LN  +    S+ 
Sbjct: 388 FISGAYTSS-----FVGALLSANHNTTIKISIACGSALPGFTLCVVLILNCIIWAKDSTH 442

Query: 485 VIPASTLFFMVFLWFLFSIPLSFAGSLVA---RKKC-----------------HWDEHPT 524
            +P  T+  ++ ++F+  IPLS  G + A   R+KC                 H+D+ P 
Sbjct: 443 ALPFGTIVLLITVYFIVCIPLSILGGVSATYTRRKCLSLDPRSIINRFFLLNIHYDDQPV 502

Query: 525 KTNQI-------ARQIPF---QPWYLKTLPATLIAGIFPFGSIAVELYFIYTSLWFNKI- 573
             N++         ++P    QP  L     T+I+GI PF  I VEL F+Y SLW  K  
Sbjct: 503 VENKVHLPRISGNSKLPLMLRQPVLL-----TVISGIVPFIVIYVELLFVYKSLWLEKTT 557

Query: 574 -FYMFGXXXXXXXXXXXXXXXXXXMITYHSLC---------------------------- 604
            +Y++G                  +  Y +L                             
Sbjct: 558 FYYLYGFLLANIVLLCVVVCEISIIGCYLTLIHVSPDEFIPIATPEQAMHSPMLKQVRVQ 617

Query: 605 ---------LENWKWQWRGFTVGGVGCALYVFIHSILF--TKFKLGGFTTIVLYLGYSSV 653
                    L   +W+W+ F +GG   A Y+  +S+ +  T  K+  F++I+L+  YS++
Sbjct: 618 AMNFVCAIGLAMTQWRWKSFQIGG-SVAWYLEAYSLYYFLTVLKIRDFSSILLFFCYSAL 676

Query: 654 ISLLCCLVTGSIGFISSMFFIRKIYSSIK 682
            + LC    G++G++S  +F+ +I+++ K
Sbjct: 677 FNFLCWCSFGALGYLSCCWFVNRIHTNSK 705

>KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.411
           YER113C
          Length = 680

 Score =  144 bits (364), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 168/708 (23%), Positives = 282/708 (39%), Gaps = 133/708 (18%)

Query: 42  LTPSMYYQHQDEDG---NNVSGDKEHFLYSYDYYYDKFHFCKPEHVEKQPE--SLGSIIF 96
           LTP++Y +H D      N +  D     Y Y   YD   F  P  V+K+P   SL  +I 
Sbjct: 33  LTPTIY-RHGDPVEIIVNKIESDATQLPYGY---YD-LPFTCPPTVDKKPLHLSLNEVIR 87

Query: 97  GDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLIKNGFFQNWLIDG-LPAAREVH 155
           GDR + S +EL   ++ EC  LC      D  + ++K IK  +   W ID  LPAA    
Sbjct: 88  GDRKWQSNYELEFGKDTECTVLCARKTNPDGMRSLDKFIKQEYVVQWFIDKELPAATTFI 147

Query: 156 DGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGETEQTQAADGKTEPEKGKSSNEGM 215
               +  +YG+GF LGFV      D ET +V                             
Sbjct: 148 STVDQKKYYGSGFPLGFV------DEETGKV----------------------------- 172

Query: 216 ELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGNYRVVGVIVNPLSIKR-SSPGTCE 274
                             Y  NH  + I YH   + N+ +VG  + P S+     PG  +
Sbjct: 173 ------------------YVNNHVMMVIRYHAIDDYNFTIVGFEIYPKSVSDYHCPGASK 214

Query: 275 T-NGSPLVLDEANDNEVY--FTYSVKF-EESPTSWATRWDKYLHVYDPS------IQWXX 324
             +   +V+ E  + + +  FTYSV + EE    W  R++ +    + S        W  
Sbjct: 215 DYDQYEVVVPEIANEDTFIPFTYSVYWREEFDVEWKDRYNLFFDSGELSGSVSRKFHWIS 274

Query: 325 XXXXXXXXXXXXXXXXXXXXR--ALKSDFARYNELNLDDDFQEDSGWKLNHGDVFRPPSQ 382
                               +   + +      E      F     W  +     RP   
Sbjct: 275 LANSASIAFLMTFIVSLIFIKITGIPNRLETKKESPKASIFVIARNWFYDD----RPVMP 330

Query: 383 SLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGI 442
            L + I V  GV     V  S+  +       + R S+ T+  + + L  F+ S+    +
Sbjct: 331 HLFICI-VSMGVHFLFTVIGSLTISCSLNSLHTIRNSVLTMALLFFVLGAFMASFVGGTL 389

Query: 443 YKFFDGPYWK--------ANVIMTPL----LIPGAILLVIIALNFFLMFVHSSGVIPAST 490
               +    +        +N+++  +    L+PG ++L  I LN  +    S+ V+P +T
Sbjct: 390 LIENNKLIMRRGSLKNVFSNILLFSVVCGSLLPGMVILTAIILNCIIWLHTSTNVLPFAT 449

Query: 491 LFFMVFLWFLFSIPLS-FAGSLVARKKCH---------------------WDEHPTKTNQ 528
           +  ++F++F+  IPLS   GS+ A K                         DE      +
Sbjct: 450 IMKLLFIYFIVCIPLSVLGGSIAANKDSEEYSRLRSDSIKRISRTRANKIMDEDQGTDVR 509

Query: 529 IARQIPFQ-PWYLK-------TLPATLIAGIFPFGSIAVELYFIYTSLWFNKI--FYMFG 578
             R++ ++  W LK       T+ + L +GIFPF  I VEL F+Y S+W+ K   +Y +G
Sbjct: 510 TTRKLKYKVRWQLKKMMLDTVTVVSLLASGIFPFIMIYVELQFVYKSVWYEKTTFYYYYG 569

Query: 579 XXXXXXXXXXXXXXXXXXMITYHSLCLENW----KWQWRGFTVGGVGCALYVFIHSI--L 632
                             + +Y  + + +      W+W+ F +    CA Y+  +SI  +
Sbjct: 570 FLLANIILLCLVICDIAIICSYLMMTVSSKDNSDSWKWKTFQLSS-SCAWYMEAYSIYYV 628

Query: 633 FTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFISSMFFIRKIYSS 680
           F    +  F++I++ + YS + + LC L  GSIG+++S++F++++Y S
Sbjct: 629 FKVLNMRDFSSILISVCYSLLFNALCGLAMGSIGYLASLWFVKRVYRS 676

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score =  143 bits (361), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 172/726 (23%), Positives = 284/726 (39%), Gaps = 119/726 (16%)

Query: 9   LYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDED--GNNVSGDKEHFL 66
           L F +++   FY+     +  + N+ I      L P+ Y+Q  + +   N V  D     
Sbjct: 8   LVFAITSFILFYIFYGNVSNKRGNNTILEKAGWLQPNFYFQGDEVELIVNKVESDLTQLP 67

Query: 67  YSYDYYYDKFHFCKPEHVEKQPE--SLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIP 124
           Y+Y   YD   F  P  + K+P   SL  II GDR + S + L   Q+  C  LC     
Sbjct: 68  YAY---YD-LPFTCPPTMHKKPLHLSLNEIIRGDRKWQSDYILKFGQDDTCHILCTRKTT 123

Query: 125 GDDAKFINKLIKNGFFQNWLIDG-LPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSET 183
            +  K   KL+++G+   WLID  LPAA        +  +Y +GF LGFV+         
Sbjct: 124 KEGLKNAKKLVEDGYVVQWLIDEELPAATTFISTIDQKKYYASGFPLGFVD--------- 174

Query: 184 EQVQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKI 243
                                P+ GK                        Y   H  + I
Sbjct: 175 ---------------------PDTGKV-----------------------YLNTHVMLVI 190

Query: 244 EYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSP--LVLDEANDNEVY--FTYSVKF- 298
            Y+      + +VG  V P S+          N  P  +V+ E +D+  +  FTYSV + 
Sbjct: 191 RYNTVDVNKHTIVGFEVYPKSVSDFHCPGASKNYEPYEIVIPENDDDLTFIPFTYSVYWR 250

Query: 299 EESPTSWATRWDKYLHVYDPS------IQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFA 352
           EE    W  RWD YL+  + S        W                      R+ KS   
Sbjct: 251 EEYLVDWDHRWDLYLNSGELSENKTTQFHWISLANSAGIVFLMSFVVSVILLRSFKSSRD 310

Query: 353 RYNELNLDDD------FQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFF 406
              ++N  ++      ++    W +N     R P  +L++ + V  GVQ    V  S+  
Sbjct: 311 ISTDINKSEEHRNGLVYEVARNWIINE----RTPLANLLI-LFVSMGVQFLFTVLGSLTI 365

Query: 407 AALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFDGPYWKAN----------VI 456
           +           S+ T+  + + L  F+ SY    + +  +    K             I
Sbjct: 366 SCSLNKLHDIGDSVLTMAVLCFVLGAFMSSYIGSVLLRLKNKATMKKQPIKKGFHLFFAI 425

Query: 457 MTPLLIPGAILLVIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVA--- 513
           +    +PG +++V + LN  +    S+  +P  T+   + ++F+  IPLS  G  +A   
Sbjct: 426 LCGSFLPGIVMIVTLLLNSIVWAHDSTHALPFKTVVMFITVYFIVCIPLSILGGYMANSS 485

Query: 514 RKKCHWDEHPTKTNQIARQI------PFQPWYL--------KTLPATLIAGIFPFGSIAV 559
           + K    +    T++   ++      P +  +L        K     L++GIFPF  I V
Sbjct: 486 KTKGSLTDPKFHTSRPELELFANKLKPKKHIFLFGARLKSIKIALPILLSGIFPFVIIYV 545

Query: 560 ELYFIYTSLWFNK--IFYMFGXXXXXXXXXXXXXXXXXXMITYHSLCL---ENWKWQWRG 614
           EL ++Y S+W  K   +Y +G                  + TY  L +    N  W+W  
Sbjct: 546 ELQYVYKSVWLEKTAFYYFYGFLFANILLLCIVVGEIAIIGTYTMLHMADRNNTDWRWIS 605

Query: 615 FTVGGVGCALYVFIHSILFTKFKLG--GFTTIVLYLGYSSVISLLCCLVTGSIGFISSMF 672
           F +G   CA Y+ ++S+ +  F L   GF++I + + Y ++ + LC    GSI  ++S F
Sbjct: 606 FFMGS-SCAWYMELYSLYYVFFILNIRGFSSIFISVCYGALFNTLCGCAMGSIASLTSHF 664

Query: 673 FIRKIY 678
           F+ K+Y
Sbjct: 665 FVEKLY 670

>Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  140 bits (353), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 175/743 (23%), Positives = 291/743 (39%), Gaps = 147/743 (19%)

Query: 12  IVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDY 71
           I S+    Y   + P  YK  D + L+VN                 V  D     Y+Y  
Sbjct: 40  IYSSQSNLYDGWITPNFYKNGDPLELIVN----------------KVESDLTQLPYAY-- 81

Query: 72  YYDKFHFCKPEHVEKQPE--SLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAK 129
            YD   F  P  + K P   SL  II GDR + S ++L   ++  C  LC      +  +
Sbjct: 82  -YD-LPFTCPPTMHKTPLHLSLNEIIRGDRKWESDYKLTFGEDNPCEVLCARKTTKEGMQ 139

Query: 130 FINKLIKNGFFQNWLIDG-LPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQV 188
            ++KLI+ G+   WLID  LPAA           +Y +GF LGF++              
Sbjct: 140 TLDKLIREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFMD-------------- 185

Query: 189 ASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDR 248
                           P+ GK+                       Y  NH  + I +H  
Sbjct: 186 ----------------PDTGKT-----------------------YLHNHVMLVIRFHSG 206

Query: 249 GEGNYRVVGVIVNPLSIKR-SSPGTCETNGSPLVLDEANDNEVY---FTYSVKF-EESPT 303
             G   +VG  V P S+     PG  +T     +    ++NE+    FTYSV + EE   
Sbjct: 207 DNGKNTIVGFEVYPRSVSDYHCPGASKTYEQYEITIPEDENELTYLPFTYSVYWREEFEV 266

Query: 304 SWATRWDKYLHVYDPS------IQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNE- 356
            W  RWD +L+  + S        W                        + +D    +  
Sbjct: 267 DWNHRWDYFLNSGELSDEQSSQFHWMSFANSVIIVLSISLITLIIYIGVMHTDKNNPHSN 326

Query: 357 ---LNLDDDFQED--SGWKLNHGDVF----------RPPSQSLM-LSILVGSGVQIFLMV 400
              +N++    ED  +  K +   V+          +P   SL  L +LV  GVQ    V
Sbjct: 327 KFMINIEGIGAEDVLNNDKYSKNSVYMVAKDWIQNGKPDLFSLKGLIVLVSFGVQFLFTV 386

Query: 401 TCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSY--TSMGIYK---------FFDGP 449
             S+  +       + R S+ T+  + + +  F+ S+  T + I           F D  
Sbjct: 387 IGSLTISCSMNKLHNVRNSVLTMAILCFVIGAFMASFVGTRLSIVSKTRRFNANYFGDNK 446

Query: 450 YWKANVIMTPLL-------IPGAILLVIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFS 502
            +K     +P+        +PG I++    LN  +    S+  +P  T+ F + ++F+  
Sbjct: 447 NFKCREKFSPIFAIICGSSLPGMIMISTFLLNSIVWAHDSTNALPFKTIVFFISVYFIVC 506

Query: 503 IPLSFAGSLVARK---KCHW------DEHPTKTNQIARQIPFQPWYLKTL--PATLIAGI 551
           IPLS  G +VA       +W      DE  +K N++   +P  P     L      + G+
Sbjct: 507 IPLSLFGGIVANNIPLPQYWLSGITIDESDSKNNKLF--LPKSPNKFNPLVNCGIYLCGV 564

Query: 552 FPFGSIAVELYFIYTSLWFNKI--FYMFGXXXXXXXXXXXXXXXXXXMITY--HSLCLEN 607
           FP   I VE+ ++Y SLW  K   +Y +G                  + +Y     C E+
Sbjct: 565 FPLLVIYVEMQYVYKSLWLEKTTFYYFYGFLFLSIILLCVLTMEISVIGSYLLMRFCFED 624

Query: 608 W----KWQWRGFTVGGVGCALYVFIHSI--LFTKFKLGGFTTIVLYLGYSSVISLLCCLV 661
                 W+W+ F +G  G  +Y+ ++S+  +F    + GF++I++ + YS + +++C L 
Sbjct: 625 KVVRNNWRWKCFEMGFSG-GVYMELYSLYYIFAVLNIHGFSSILISICYSLLFNIMCGLG 683

Query: 662 TGSIGFISSMFFIRKIYSSIKVD 684
            G++ ++++ +FI KIY  +KV+
Sbjct: 684 LGALSYLTASWFINKIY-HVKVN 705

>YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}
           TMN3Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn2p; member
           of Transmembrane Nine family with 9 transmembrane
           segments; localizes to Golgi; induced by
           8-methoxypsoralen plus UVA irradiation
          Length = 706

 Score =  140 bits (352), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 165/738 (22%), Positives = 285/738 (38%), Gaps = 148/738 (20%)

Query: 12  IVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDY 71
           I S+ +  Y   + P  Y++ D + L+VN                 V  D     Y+Y  
Sbjct: 40  ISSSQKNLYDGWITPNFYRKGDPLELIVN----------------KVESDLTQLPYAY-- 81

Query: 72  YYDKFHFCKPEHVEKQPE--SLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAK 129
            YD   F  P  + K+P   SL  II GDR + S ++L   ++  C +LC      +  +
Sbjct: 82  -YD-LPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYKLKFGEDNPCETLCARKTTKEGMQ 139

Query: 130 FINKLIKNGFFQNWLIDG-LPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQV 188
            ++KL++ G+   WLID  LPAA           +Y +GF LGF++              
Sbjct: 140 TLDKLVREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFID-------------- 185

Query: 189 ASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDR 248
                           P+  K+                       Y  NH  + I +H  
Sbjct: 186 ----------------PDTDKT-----------------------YLHNHVMLVIRFHAS 206

Query: 249 GEGNYRVVGVIVNPLSIKR-SSPGTCETNGSPLVLDEANDNEVY---FTYSVKF-EESPT 303
                 +VG  V P S+     PG  +      ++   ++NE+    FTYSV + EE   
Sbjct: 207 DNDKNTIVGFEVYPRSVSDYHCPGASKNYEQYEIVIPEDENELTYLPFTYSVYWREEFEV 266

Query: 304 SWATRWDKYLHV----YDPSIQ--WXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNE- 356
            W  RWD +L+      + SIQ  W                      R + +D +     
Sbjct: 267 DWNHRWDYFLNAGELSDEQSIQFHWMSLANSVGIVLSISFITLIIYVRVMYTDKSNSKSP 326

Query: 357 --------LNLDDDFQEDSGWKLNHGDVFRPPSQS--------LMLSILVGSGVQIFLMV 400
                   +  +DD  +D   K +   V +   Q+         +L +LV  GVQ    +
Sbjct: 327 KYMINIEGIETEDDLDDDKYGKYSVYTVAKDWIQNGRPNLFGLKVLILLVSFGVQFLFTI 386

Query: 401 TCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVI---- 456
             S+  +       + R S+ T+  + + L  F+ S+    +         KAN +    
Sbjct: 387 IGSLTISCSMNKLHNVRNSVLTMAILFFVLGAFMASFVGTRLSMVTKTKRTKANYLDDNR 446

Query: 457 -------MTPLL-------IPGAILLVIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFS 502
                   +P+        +PG +++    LN  +    S+  +P  T+ F + ++F+  
Sbjct: 447 YLKDYKKFSPIFTILCGSSLPGIVMVSTFLLNSIVWAHDSTSALPFKTIVFFMSIYFIVC 506

Query: 503 IPLSFAGSLVARK---KCHW------DEHPTKTNQI---ARQIPFQPWYLKTLPATLIAG 550
           IPLS  G +VA       +W      DE  +  N +     +  F P          + G
Sbjct: 507 IPLSLFGGIVANNIPLPQYWLSGITKDESNSDGNGLFVPKSRAKFNPL---VYCGIYLCG 563

Query: 551 IFPFGSIAVELYFIYTSLWFNKI--FYMFGXXXXXXXXXXXXXXXXXXMITY--HSLCLE 606
           IFP   I VE+ ++Y SLW  K   +Y +G                  + +Y     C E
Sbjct: 564 IFPLLVIYVEMQYVYKSLWLEKTTFYYFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFE 623

Query: 607 NW----KWQWRGFTVGGVGCALYVFIHSI--LFTKFKLGGFTTIVLYLGYSSVISLLCCL 660
           +      W+W+ F +G  G  +Y+ ++S+  +F    + GF++I++ + YS + +++C L
Sbjct: 624 DKVVRNNWRWKCFEMGFSG-GVYMELYSLYYIFAVLNIHGFSSILISICYSLIFNVMCSL 682

Query: 661 VTGSIGFISSMFFIRKIY 678
             G++ ++++ +FI KIY
Sbjct: 683 GLGALSYLTASWFINKIY 700

>TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {ON}
           Anc_7.411 YER113C
          Length = 678

 Score =  135 bits (341), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 167/713 (23%), Positives = 272/713 (38%), Gaps = 136/713 (19%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDKFHFCKPEH 83
           + P  Y+  D + LLVN                 V  D   F Y Y   YD    C P  
Sbjct: 41  LQPNVYRWGDHVELLVN----------------KVESDLTQFPYGY---YDLPFTCPPTE 81

Query: 84  VEKQPE--SLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLIKNGFFQ 141
            +K+P   SL  II GDR + S ++L   Q+  C +LC         +   +L++ G+  
Sbjct: 82  -DKKPLHLSLNEIIRGDRKWESDYKLKFGQDASCEALCARKTKPAGMRRAQELVRQGYVV 140

Query: 142 NWLIDG-LPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGETEQTQAAD 200
            WLID  LPAA           +Y +GF LGFV      D +TE+               
Sbjct: 141 QWLIDQELPAATTFISTIDHKKYYVSGFPLGFV------DPDTEKT-------------- 180

Query: 201 GKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGNYRVVGVIV 260
                                            Y   H  + I Y+      + +VG  V
Sbjct: 181 ---------------------------------YLNTHVMMVIRYNAIDPETFTIVGFEV 207

Query: 261 NPLSIKR-SSPGTCET-NGSPLVLDEANDNEVY--FTYSVKF-EESPTSWATRWDKYLHV 315
            P S+     PG  +      L++ E  D   Y  FTYSV + EE    W+ RW+ +L+ 
Sbjct: 208 YPKSVSDYHCPGASKGYEQYELIVPENEDELTYIPFTYSVYWREEFKVDWSHRWNFFLNS 267

Query: 316 YDPS------IQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNE---LNLDDDFQED 366
            + S        W                      R ++      +E      D++ + D
Sbjct: 268 GEMSEASSRRFHWMTLGNSVGISFLLMLIVIANLYRIVRVGHEAGSEEFQFTFDENEEAD 327

Query: 367 SGWKLNHGDVFRPPSQSL---MLSILVGSGVQIFLMVTCSIFFA-ALGFLSPSSRGSLAT 422
           S + +    + +  S S+   +L+I V  GVQ    +  S+ F+ +L  L       L+ 
Sbjct: 328 SIYGVAKTWLAQTDSSSISFKILTIFVSIGVQFLFTIIGSLAFSCSLNKLHNIRNSVLSV 387

Query: 423 VMFIL----YALFGFVGSYTSMGIYKFFDGPYWKANV--IMTPLLIPGAILLVIIALNFF 476
             F L    Y    FVG++  +      DG   +     I+    +PG +++    LN+ 
Sbjct: 388 ASFFLCHWSYLWHLFVGTWLHIDHRTTNDGSAGRCRTFSILCGSALPGLVMISTQMLNWI 447

Query: 477 LMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARK--KCHWDEHPTKTNQIARQI- 533
           +    SS  +P  T+   V ++F+  IPLS  G  V+ +  +      P  ++  AR I 
Sbjct: 448 VWANESSHALPFRTIVLFVSIYFVICIPLSLLGEEVSHRVHRKQAQNFPILSSLGARSIK 507

Query: 534 PFQPWYLKTLPATL-----------------IAGIFPFGSIAVELYFIYTSLWFNKI--F 574
           P +       P TL                 I G  PF  I VEL +IY S+W  K   +
Sbjct: 508 PCRA------PTTLAPRKISERLTFDFATFAICGFLPFAVIYVELQYIYKSVWLEKTDFY 561

Query: 575 YMFGXXXXXXXXXXXXXXXXX-----XMITYHSLCLENWKWQWRGFTVGGVGCALYVFIH 629
           Y++G                       M+  H        W+W+ F +G   CA Y+ ++
Sbjct: 562 YLYGFLLANIILLCIVVCEVSFLGCYVMMRKHKRVATFDSWRWKCFMMG-TSCAWYMELY 620

Query: 630 SI--LFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFISSMFFIRKIYSS 680
           S+  +F   K+ GF +I + + YS + +++C    GS+G+++S + + +++ +
Sbjct: 621 SLYYIFHTLKMTGFPSIFISVSYSLIFNIMCGCGMGSLGYLTSCWLVNRVFCT 673

>KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 676

 Score =  133 bits (335), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 157/691 (22%), Positives = 266/691 (38%), Gaps = 133/691 (19%)

Query: 42  LTPSMYYQHQDE---DGNNVSGDKEHFLYSYDYYYDKFHFCKP-EHVEKQPESLGSIIFG 97
           L+P+ +Y++ D+     N V  D  HF Y Y   YD    C P + ++  P +   I++G
Sbjct: 57  LSPN-FYEYGDKVDITVNKVESDLTHFSYGY---YDLHFTCPPSQDMKPLPLTFSDILYG 112

Query: 98  DRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLIKNGFFQNWLIDG-LPAAREVHD 156
           ++ + S ++L   ++++CV LC     G+  K   +LIK  +   WL D  LP A    +
Sbjct: 113 NKKWQSDYQLTFGKDEDCVRLCDRKTNGEGKKQAYELIKQNYVVQWLADDDLPGATTYLN 172

Query: 157 GRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGETEQTQAADGKTEPEKGKSSNEGME 216
            + K  +Y +GF LG        D ET++                               
Sbjct: 173 TKDKKKYYSSGFPLG------QYDPETDEA------------------------------ 196

Query: 217 LDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETN 276
                            Y  NH  I I YH   +G   +VG  V P S+          +
Sbjct: 197 -----------------YINNHVMIVIRYHTIDQGKNTIVGFEVYPKSVSDHHCPGASKD 239

Query: 277 GSPLVLDEANDNE--VYFTYSVKFEES-PTSWATRWDKYLH------VYDPSIQWXXXXX 327
            +P  +D  N++   + FTY+V + E     W  RW+ +++             W     
Sbjct: 240 YTPYKIDPTNEDIEFISFTYAVYWREDFKVDWKNRWNFFINGGELKESTSNQFHWITFAN 299

Query: 328 XXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLNHGDVFRPPSQSLMLS 387
                            R          E +     Q  + W      +F        L+
Sbjct: 300 GIIVTSCLLLIVIAILKR---------QETDGSITTQLAAEWSKARVPLF------FQLN 344

Query: 388 ILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFV-GSYTSMGIYKFF 446
           +LV  G+  FL  T      +         GS      +  A+F F+ GS+TS  I    
Sbjct: 345 LLVSMGIH-FLFTTLGTLIISCSLNHTHRIGS----SVLTCAVFLFISGSFTSSFIGALL 399

Query: 447 DGPYWK---ANVIMTPLLIPGAILLVIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSI 503
           +G   +    N I+    +PG  L++++ LN+ L   +++  +P  T+  +   +F+  +
Sbjct: 400 EGQMSQHKLVNSIIFGSTLPGITLVIVLLLNYILKANNAANTLPHGTVALLFGAYFIVCV 459

Query: 504 PLSFAGSLVARKKCHWDEHPTKTNQIA----RQIPFQPWYLKT-----------LPATLI 548
           P+S  G   A +    +   T  N  A     +   +P Y+++           +  TL 
Sbjct: 460 PISIIGGKCADRFLKVNSTNTLLNSFALAEVNKHDTRPLYVESKNSIPFVLKNPIAITLT 519

Query: 549 AGIFPFGSIAVELYFIYTSLWFNK--IFYMFGXXXXXXXXXXXXXXXXXXMITYHSLCLE 606
            G+ PF  I VEL F Y SLW  K  ++Y++G                  +  Y  L   
Sbjct: 520 FGLIPFALIYVELLFAYKSLWLQKTTLYYLYGFLLSNIVIVCICICLLSIIGCYIHLNYG 579

Query: 607 N------W------------KWQWRGFTVGGVGCALYVFIHSILFTKF--KLGGFTTIVL 646
           N      W             W+W+ F +GG   A Y+  +SIL+  F  +   F +  L
Sbjct: 580 NDSLNFKWDNVIGRVLEACHSWRWKAFHMGG-AVAWYMEAYSILYLIFVARYRDFISSFL 638

Query: 647 YLGYSSVISLLCCLVTGSIGFISSMFFIRKI 677
           ++ YS++ ++LC    GS+ ++SS++FI K+
Sbjct: 639 FVCYSTLFNILCWTAFGSLSYLSSLWFIGKL 669

>Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  132 bits (332), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 172/738 (23%), Positives = 276/738 (37%), Gaps = 156/738 (21%)

Query: 18  AFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDKFH 77
            +Y   + P  YK+ D + L+VN                 V  D     Y+Y   YD   
Sbjct: 46  TYYDGWITPNFYKKGDPLELIVN----------------KVESDLTQLPYAY---YD-LP 85

Query: 78  FCKPEHVEKQPE--SLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLI 135
           F  P  + K+P   SL  II GDR + S + L   ++  C +LC      +  + ++KL+
Sbjct: 86  FTCPPTMHKKPLHLSLNEIIRGDRKWESDYILAFGEDNACQTLCARKTTKEGMQSLDKLV 145

Query: 136 KNGFFQNWLIDG-LPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGETE 194
           + G+   WLID  LPAA           +Y +GF LGFV+                    
Sbjct: 146 REGYVVQWLIDDKLPAATTFISTTDHKKYYASGFPLGFVD-------------------- 185

Query: 195 QTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGNYR 254
                     P+ GK+                       Y  NH  + I +H        
Sbjct: 186 ----------PDTGKT-----------------------YLHNHVMLVIRFHSGDNDQNT 212

Query: 255 VVGVIVNPLSIKR-SSPGTCETNGSPLVLDEANDNEVY---FTYSVKF-EESPTSWATRW 309
           +VG  V P S+     PG  +      ++   ++NE+    FTYSV + EE    W  RW
Sbjct: 213 IVGFEVYPRSVSDYHCPGASKNYEQYEIVVPEDENELTYLPFTYSVYWREEFEVDWNHRW 272

Query: 310 DKYLHVYDPS------IQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYN-------- 355
           D +L+  + S        W                      + +  D    +        
Sbjct: 273 DYFLNSGELSNEKSAQFHWMSFANSMGIVLSISFITAVIYIQVMHRDKKNTDSTKYLINI 332

Query: 356 -----ELNLDDD-------FQEDSGWKLNHGDVFRPPSQSL-MLSILVGSGVQIFLMVTC 402
                E NLDDD       +     W  N     RP    L +L +LV  GVQ    V  
Sbjct: 333 EGAEVEDNLDDDKYGKNSVYMVTKDWIQNG----RPNMFGLKVLIVLVSFGVQFLFTVIG 388

Query: 403 SIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYT-----------SMGIYKFFDGPYW 451
           S+  +       + R S+ T+  + + L  F+ S+            S+ I    D   +
Sbjct: 389 SLTISCSMNKLHNVRNSVITMAILCFVLGAFMASFVGTRLSIVTKRRSIEINYLDDSKNF 448

Query: 452 KANVIMTPLL-------IPGAILLVIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIP 504
                 +P+        +PG +++    LN  +    S+  +P  T+ F + ++F+  IP
Sbjct: 449 NNCNKFSPVFAIICGSSLPGLVMVSTFLLNSIVWAHDSTNALPFRTIVFFISVYFIVCIP 508

Query: 505 LSFAGSLVARK---KCHWDEHPTKTNQIAR---------QIPFQPWYLKTLPATLIAGIF 552
           LS  G  VA       HW    TK               +  F P          + G+F
Sbjct: 509 LSLFGGTVANNIPLPRHWLSGITKDETCGNSSRLFVPRSRTKFNPL---VYCGIYLCGLF 565

Query: 553 PFGSIAVELYFIYTSLWFNKI-FYMFGXXXXXXXXXXXXXXXXXXMITYHSL---CLENW 608
           PF  I VEL ++Y S+W  K  FY F                   +I  +SL   C E+ 
Sbjct: 566 PFLVIYVELQYVYKSVWLEKTTFYYFYGFLLLNIILLCVLTMEISIIGSYSLMRFCFEDK 625

Query: 609 ----KWQWRGFTVGGVGCALYVFIHSI--LFTKFKLGGFTTIVLYLGYSSVISLLCCLVT 662
                W+W+ F +G  G  +Y+ ++S+  +F    + GF++ ++ + YS + +++C L  
Sbjct: 626 DVRNNWRWKCFEMGFSG-GVYMELYSLYYIFAVLNIHGFSSTLISICYSLLFNIMCGLGL 684

Query: 663 GSIGFISSMFFIRKIYSS 680
           G + ++++ +FI KIY S
Sbjct: 685 GGLSYLTASWFINKIYHS 702

>Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C
           (REAL)
          Length = 707

 Score =  130 bits (327), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 170/739 (23%), Positives = 282/739 (38%), Gaps = 148/739 (20%)

Query: 11  FIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYD 70
           F  S    +Y   + P  YK+ND + L+VN                 V  D     Y+Y 
Sbjct: 40  FSSSQNNLYYDGWITPNFYKKNDFLELIVN----------------KVESDLTQLPYAY- 82

Query: 71  YYYDKFHFCKPEHVEKQPE--SLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDA 128
             YD   F  P  + K+P   SL  II GDR + S ++L   ++  C +LC         
Sbjct: 83  --YD-LPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYKLRFGEDNACETLCARKTDKKGM 139

Query: 129 KFINKLIKNGFFQNWLIDG-LPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQ 187
           + ++KL++ G+   WLID  LPAA           +Y +GF LGFV+             
Sbjct: 140 QTLDKLVREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFVD------------- 186

Query: 188 VASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHD 247
                            P+  K+                       Y  NH  + I +H 
Sbjct: 187 -----------------PDTDKT-----------------------YLHNHVILVIRFHG 206

Query: 248 RGEGNYRVVGVIVNPLSIKR-SSPGTCET-NGSPLVLDEANDNEVY--FTYSVKF-EESP 302
            G+    VVG  V P S+     PG  +      +V+ E   +  Y  FTYSV + EE  
Sbjct: 207 GGDDKNTVVGFEVYPKSVSDYHCPGASKNYEQYEIVVPEDEHDLTYLPFTYSVYWREEFE 266

Query: 303 TSWATRWDKYLHVYDPS------IQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYN- 355
             W  RW+ +L+  + S        W                      R +++D    + 
Sbjct: 267 VDWNHRWNYFLNAGELSDEQSAQFHWMSLANSLGIVLSISFITFVIYIRVMRTDKKNTDS 326

Query: 356 ------------ELNLDDDFQEDSGWKLNHGDVFRPPSQSL----MLSILVGSGVQIFLM 399
                       E +LDDD    +   +   D  +     L    +L +LV  GVQ    
Sbjct: 327 HKYLINTEGIEAEDSLDDDKYGKNSVYMVTKDWIQNGKPDLFGLKVLIVLVSFGVQFLFT 386

Query: 400 VTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSY--TSMGIY--------KFFD-G 448
           +  S+  +       + R S+ T+  + + L  F+ S+  T +GI          + D  
Sbjct: 387 IIGSLTISCSMNKLHNVRNSVLTMAILCFVLGAFMASFVGTRLGIVTKRRNINVNYLDHN 446

Query: 449 PYWKANVIMTPLL-------IPGAILLVIIALNFFLMFVHSSGVIPASTLFFMVFLWFLF 501
             +K     +P+        +PG +++    LN  +    S+  +P  T+ F + ++F+ 
Sbjct: 447 KSFKNCREFSPIFAVICGSSLPGMVMIGTFLLNSVVGAHDSTNALPFRTIVFFISIYFVV 506

Query: 502 SIPLSFAGSLVARK------------KCHWDEHPTKTNQIARQIPFQPWYLKTLPATLIA 549
            IPLS  G +VA              K   D + +K  +   +  F P          + 
Sbjct: 507 CIPLSLFGGIVANNIPLPKYWLSGITKDETDGNGSKLFKPKSRTRFNPL---VHCGVYLC 563

Query: 550 GIFPFGSIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXMITYHSL----CL 605
           GIFP   I VE+ ++Y SLW  K  + F                    I    L    C 
Sbjct: 564 GIFPLLVIYVEMQYVYKSLWLEKTTFYFFYGFLFLSIILLCVLTMEISIIGSYLLMRFCF 623

Query: 606 ENWK----WQWRGFTVGGVGCALYVFIHSI--LFTKFKLGGFTTIVLYLGYSSVISLLCC 659
           ++ +    W+WR F +G  G  +Y+ ++S+  +F    + GF++I++ + YS + ++LC 
Sbjct: 624 DDKEVRNNWRWRCFEMGFSG-GVYMELYSLYYIFVVLNIHGFSSILISICYSLLFNILCG 682

Query: 660 LVTGSIGFISSMFFIRKIY 678
           L  G++  +++ +FI +IY
Sbjct: 683 LGLGALSCLTASWFINRIY 701

>ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 658

 Score =  122 bits (306), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 152/649 (23%), Positives = 258/649 (39%), Gaps = 105/649 (16%)

Query: 72  YYDKFHFCKPEHVEKQPE--SLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAK 129
           YYD    C P   EK+P   SL  II GDR + S ++L + Q+  C  LC      +  +
Sbjct: 70  YYDLPFTCPPTP-EKKPLHLSLNEIIKGDRKWESDYKLVVGQDNPCEILCARKTTREGLQ 128

Query: 130 FINKLIKNGFFQNWLIDG-LPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQV 188
               LIK+G+   W+ID  LPAA           +Y  GF LG       VD  + +V  
Sbjct: 129 TAKDLIKSGYMVQWMIDDDLPAATTYISTTDNLKYYAPGFPLG------SVDPRSSRV-- 180

Query: 189 ASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDR 248
                                                        +F NH  + I Y+  
Sbjct: 181 ---------------------------------------------FFNNHVMLVIRYNLV 195

Query: 249 GEGNYRVVGVIVNPLSIKR-SSPGTCETNGSPLVLDEANDNEVYF--TYSVKF-EESPTS 304
                 +VG    P S+     PG  +      + D   +  VY   TYSV + E++   
Sbjct: 196 DSDKVTIVGFEAYPKSVSDYHCPGASKDFKPFEITDPPLEEIVYIPVTYSVYWREDAEID 255

Query: 305 WATRWDKYLH---VYDPS---IQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELN 358
           W+ RW  Y++   + D S     W                        L   F   NE  
Sbjct: 256 WSDRWSLYINRAQLADSSSSTFHWMALANSVGIVLFVTFIVIVN----LIMIFRNPNE-Q 310

Query: 359 LDDDFQEDSGWKLNHGDVFRPPSQSLMLS---ILVGSGVQIFLMV----TCSIFFAALGF 411
           L+    EDS    N  + +    Q   L+   + V  G+Q+  M+      S+    L  
Sbjct: 311 LESKENEDSSDIFNVANNWLRARQGFQLNRLIVCVSMGIQVMFMILGPLAISLSLTRLHN 370

Query: 412 LSPSSRGSLATVMFILYALFG-FVGSYTSM----GIYKFFDGPYWKANVIMTPLLIPGAI 466
           +  +S  ++A + F+  A    FVG++  M      Y F++  +     ++    +PG+I
Sbjct: 371 IK-NSVLTIAALCFVAGAFMASFVGTWLKMDQNISAYTFYNPVF----AVLCGSALPGSI 425

Query: 467 LLVIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVA---RKKCHWDEHP 523
           +++ ++LN  +    S+  +P  T+   V  +F+  I +S  G  VA    +    D  P
Sbjct: 426 MVLTLSLNCIIWIWDSTKALPFGTMVVFVSWYFVVCIVVSLLGGAVAAQMHRSVRHDAPP 485

Query: 524 TKT---NQIARQIPFQPWYLKTLPATLIAGIFPFGSIAVELYFIYTSLWFNK--IFYMF- 577
             T    ++ R+       L    A LI+G  PF  I VEL ++Y S+W  K  ++Y++ 
Sbjct: 486 ATTASDRKVLRRSRAISGKLVVFLAGLISGFLPFVIIYVELEYLYKSVWLEKTTLYYLYS 545

Query: 578 ----GXXXXXXXXXXXXXXXXXXMITYHSLCLENWKWQWRGFTVGGVGCALYVFIHSILF 633
                                  ++  +   + +  W+WR F +   GC+ Y+ I+S+ +
Sbjct: 546 FLFANVLLLCIVVCEISLLGCLVLMKLNHKFINDQNWRWRCFVIS-TGCSWYMEIYSLYY 604

Query: 634 TKF--KLGGFTTIVLYLGYSSVISLLCCLVTGSIGFISSMFFIRKIYSS 680
             F   + G + + + + YS + ++LC L TGS+G+++S +F++KI+ +
Sbjct: 605 IFFIIHMTGDSAVFISVCYSFIFNVLCGLATGSLGYLTSSWFVKKIHRT 653

>CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113c
          Length = 704

 Score =  117 bits (292), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 171/732 (23%), Positives = 277/732 (37%), Gaps = 152/732 (20%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDKFHFCKPEH 83
           V P  YK  D + L+VN                 V  D     Y+Y   YD    C P  
Sbjct: 51  VNPNLYKIGDHVELIVN----------------KVESDLTQLPYAY---YDLPFICPPTK 91

Query: 84  VEKQPE--SLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLIKNGFFQ 141
            EK+P   SL  I  GDR + S ++L+   +  C  LC      +      +L++ G+  
Sbjct: 92  -EKKPLHLSLDEIFRGDRKWQSDYKLSFGIDSPCEILCARKTKKEGMIKAKELVQQGYVT 150

Query: 142 NWLID-GLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGETEQTQAAD 200
            WLID  LPAA           +Y AGF +G+V      D  T                 
Sbjct: 151 QWLIDESLPAATTFISSTNHNKYYAAGFPVGYV------DDRT----------------- 187

Query: 201 GKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGNYRVVGVIV 260
           GKT                              +  NH  + I YH   E  + +VG  V
Sbjct: 188 GKT------------------------------FLNNHVMLVIRYHPVSEEEFTIVGFEV 217

Query: 261 NPLSIKR-SSPGTCETNGSPLVLDEANDNEVYF---TYSVKF-EESPTSWATRWDKYLHV 315
            P S+     PG  + +    ++    D+E+ F   TYSV + EE    W  RW+ +L+ 
Sbjct: 218 YPKSVSDYHCPGANKNHDKYEIIVPEKDDELTFIPFTYSVYWREEFEVDWNHRWNYFLNN 277

Query: 316 YDPS------IQWXXXXXXXXXXXXXXXXXXXXXXRAL-KSDFARYN---ELNLDDDFQE 365
            + S        W                      +   K +    N     NL  D ++
Sbjct: 278 GELSNSKANQFHWMSFLNSVGIASMTTTIVSIILLKIFSKKERESRNINTSTNLGQDNED 337

Query: 366 DSGWKLNHGDVFRPPSQSLM---------LSILVGSGVQIFLMVTCSIFFAALGFLSPSS 416
           D+  K++ G VF      +          L  L   G+Q    +  S+  +       + 
Sbjct: 338 DNDDKIS-GSVFVNAKTWITVGKIPYWKALICLTSMGIQFSFTILGSLIISCSLSKLHNI 396

Query: 417 RGSLATVMFILY----ALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLL---------IP 463
           R ++ T+  I +    A+ G++GS   +  Y+   G Y +  V  T +          +P
Sbjct: 397 RFTVLTMSLICFICGAAISGYIGSRLYIE-YQILKG-YLRNEVNRTKVYKFSVVCGSSLP 454

Query: 464 GAILLVIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHP 523
           G ++++  +LN  ++   S+  +P  T  F+V ++F+  IPLS  G ++A   C  D + 
Sbjct: 455 GLLMVISFSLNCIILAHDSTNALPFKTEVFLVSIYFVTCIPLSLLGGVLAL-NCKVDSYN 513

Query: 524 T-------KTNQIARQIP---------FQPWYLK------TLPATLIAGIFPFGSIAVEL 561
           T       + N I+R+           +Q           T    L  G F F  I VEL
Sbjct: 514 TLKRITSLRRNTISRKSRSDFTKKVSLYQRLVFDIKHDSFTTFGALAGGFFSFIIIWVEL 573

Query: 562 YFIYTSLWFNKI--FYMFGXXXXXXXXXXXXXXXXXXMITYHSLCLENWK-----WQWRG 614
            ++Y S+W  K   +Y +G                  +  Y  L  +N +     W W+ 
Sbjct: 574 QYVYKSVWLEKTSFYYYYGFLLANILILSIVTIEIAIIGCYVMLKAKNDRYLRHTWGWKS 633

Query: 615 FTVGGVGCALYVFIHSILFTKFKLG--GFTTIVLYLGYSSVISLLCCLVTGSIGFISSMF 672
           F +G   CA Y+ ++S+ +  F L   GF++I + + YS + + +C    GS+ +++S  
Sbjct: 634 FLMGS-SCAWYMELYSLYYIFFVLNMQGFSSIFISVCYSLLFNGMCGWALGSLSYLTSYM 692

Query: 673 FIRKIYSSIKVD 684
            + +IY   KVD
Sbjct: 693 LVTQIY---KVD 701

>Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar to
           Ashbya gossypii AGL295C
          Length = 676

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 164/736 (22%), Positives = 258/736 (35%), Gaps = 189/736 (25%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDKFHFCKPEH 83
           V P  Y++ +E+ +L+N                 V G      Y Y   YD    C P  
Sbjct: 40  VRPRIYQDGEEVEMLLNQ----------------VVGKPGELSYGY---YDLQFTCTPTK 80

Query: 84  VEKQPE-SLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLIKNGFFQN 142
             +    SL  +  GDR + S ++L   +E +C +LC            + LI+  +   
Sbjct: 81  SRRMVHHSLYEVFSGDRKWQSDYKLYFNRENKCSTLCFRKTQPSGLIEADSLIRQNYTVQ 140

Query: 143 WLIDG-LPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGETEQTQAADG 201
            LID  +PA++     R    +Y  GF LGF      VD ET                  
Sbjct: 141 LLIDEIMPASKTYVSMRDNKRYYVPGFPLGF------VDPET------------------ 176

Query: 202 KTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGNYRVVGVIVN 261
                                        +  Y  NHF + I Y+      Y +VG  V 
Sbjct: 177 -----------------------------DVTYLHNHFMLVIRYNAVDINKYTIVGFEVY 207

Query: 262 PLSIKRS-SPGTCETNGSPLVLDEANDNEVYF---TYSVKF-EESPTSWATRWDKYLHVY 316
           P S+     PG+ +   +  V    ++ +V F   TYSV + EE    W  RW+ YL   
Sbjct: 208 PKSVSDDHCPGSSKDYENYAV--NPSEKDVVFIPITYSVYWREEFMVDWENRWNFYLSAG 265

Query: 317 DPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLNHGDV 376
           D  +                        R +K     +  L L       S   L  G +
Sbjct: 266 DLDVN------------------KSLCFRGIKVTMV-FIILTLMSLAIIVSRLGLGTGSM 306

Query: 377 F----------RPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATV--- 423
           F          R     L L+  V  G+Q+       IF A    L   S G L  +   
Sbjct: 307 FITAVASEWVRRGAPCLLFLNTFVSMGIQV-------IFAAPATLLLICSMGKLHNISNF 359

Query: 424 MFILYALFGFVGSYTSM--GIY---KFFDGPYWKANVIMTPLL----IPGAILLVIIALN 474
           +  + AL    G + S   GI       D    KA +    +L    +P   + V++  N
Sbjct: 360 LVCIAALCYMTGIFMSAFGGILLSGNLLDN---KAQIRKYSVLYGSALPALTVAVLVLAN 416

Query: 475 FFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEH------------ 522
                +     +P   +  ++ L+F+ S+PLS  G   A  K   D+H            
Sbjct: 417 SIAWIIERGKEMPFRDITLLLALYFMVSLPLSLLGGTSASYKLK-DQHFQLYSLSTKYTG 475

Query: 523 ----PTK-------------TNQIA-RQIPFQPWYLKTLPATLIAGIFPFGSIAVELYFI 564
               P+K             T   A  QIP   W  K    T I GI PF +I +++ FI
Sbjct: 476 TPVSPSKPTFWFNFEYDTRGTPACAHEQIPM--WLSKPFLITSIIGIIPFLAIYLQMEFI 533

Query: 565 YTSLWFN--KIFYMFGXXXXXXXXXXXXXXXXXXMITYHSL--------CLENW------ 608
           +  LW +   +F ++                   +I Y  +        C ++       
Sbjct: 534 WKPLWTHSKSLFQIYVSLIIGMILQSILVMEICILIMYVHMHHGDDSECCFDDTCVTGRI 593

Query: 609 -----KWQWRGFTVGGVGCALYVFIHSILFTKF--KLGGFTTIVLYLGYSSVISLLCCLV 661
                 W+W+ F +GG   A Y   +S+ +  F  +L  F +I+LYL Y +++++     
Sbjct: 594 SNAVSSWRWKAFYMGGAA-AWYWEAYSLYYMIFILRLRNFGSILLYLSYGTLLNVFYFYS 652

Query: 662 TGSIGFISSMFFIRKI 677
            GSIG+++  +F+ K+
Sbjct: 653 FGSIGYLACCWFLNKL 668

>KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} similar
           to uniprot|P40071 Saccharomyces cerevisiae YER113C
           Hypothetical ORF
          Length = 694

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 106/294 (36%), Gaps = 77/294 (26%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDKFHFCKPEH 83
           + P  YK  D++ L VN +        + E  N   G           YYD    C P  
Sbjct: 44  IKPNVYKRGDKVDLTVNKV--------ESEITNLPYG-----------YYDLRFVCPPSE 84

Query: 84  VEKQPE-SLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLIKNGFFQN 142
            +K    SL  +I GDR + S + L     ++C  LC      D  +  ++LI+  +  +
Sbjct: 85  TKKPLHLSLDEVIRGDRKWESDYNLEFGVGQDCERLCDRKTMPDGLRQADRLIRENYMVH 144

Query: 143 WLIDG-LPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGETEQTQAADG 201
           WLIDG LPAA      R+   FY AGF LG       VD ET++  +             
Sbjct: 145 WLIDGDLPAATTFASTRSGKKFYTAGFPLG------RVDHETDKTHL------------- 185

Query: 202 KTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGNYRVVGVIVN 261
                                              NH  + I Y       Y +VG  V 
Sbjct: 186 ----------------------------------HNHLMLVIRYQAFDFNRYAIVGFEVY 211

Query: 262 PLSIKRSSPGTCETNGSPLVLDEANDNEVY--FTYSVKF-EESPTSWATRWDKY 312
           P S+          +  P V++       Y  FTYSV + EES   W+ RW+ +
Sbjct: 212 PRSVSDYQCPGASKSFEPYVINTEETEVTYIPFTYSVYWREESNIDWSHRWNLF 265

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 76/333 (22%), Positives = 132/333 (39%), Gaps = 91/333 (27%)

Query: 419 SLATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANV---IMTPLLIPGAILLVIIALNF 475
           S A + F+L       G+YTS  +      P  K N+   ++    +P   L+V+   N 
Sbjct: 366 STAAICFVL-------GAYTSSLVGSLL-APGPKMNLGTSVLCGCTLPALALVVVAVFNS 417

Query: 476 FLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTK-TNQIARQIP 534
            +    SS  +P  TL  ++  +F+  +PLSF G   ARK       P    N    ++P
Sbjct: 418 VVWIKDSSAALPFGTLLALLTSYFVICLPLSFLGGFSARKL---RSAPANGLNYEQSKVP 474

Query: 535 FQPWYL----------------KTLPA--------TLIAGIFPFGSIAVELYFIYTSLWF 570
           F   +L                K +PA        T++ G  PF     EL F+Y SLW 
Sbjct: 475 FS--FLLSIEYHEYNLLPAGQEKEIPAILSNPFLLTIVTGFPPFVVTCTELLFVYRSLWL 532

Query: 571 NK--IFYMFGXXXXXXXXXXXXXXXXXXMITY-----------------------HSLC- 604
            K  ++ ++G                  ++ Y                        S+C 
Sbjct: 533 QKTNLYSLYGFLLVNFIFLCITVCEVSLVVCYVLMIYTQPGSTDRQASNEGPDIRWSICR 592

Query: 605 --------LEN--------WK-----WQWRGFTVGGVGCALYVFIHSILFTKF--KLGGF 641
                   L+N        WK     W+W+ F + G   A Y  ++S+ +  F   L  F
Sbjct: 593 SPMTIVKSLKNYMASTARRWKASFSSWRWKAF-MAGASVAWYFELYSLYYLIFVLHLRDF 651

Query: 642 TTIVLYLGYSSVISLLCCLVTGSIGFISSMFFI 674
           ++I+L++ Y+S+ +L+C    G++G+++ ++F+
Sbjct: 652 SSILLFVCYTSLFNLMCWCAFGALGYLTCLWFL 684

>KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {ON}
           Anc_7.411 YER113C
          Length = 664

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 111/240 (46%), Gaps = 26/240 (10%)

Query: 461 LIPGAILLVIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCH-- 518
           L+P  I+++ I LN  +    SS  +P  T+ F++ ++F+  IPLS  G   A   C   
Sbjct: 421 LLPAVIMIITIFLNNIVWAHGSSRALPLKTILFLISIYFIVCIPLSLLGGSYASDICQKR 480

Query: 519 ---------WDEHPTKTNQIARQIP--FQPWYLKTLPATLIAGIFPFGSIAVELYFIYTS 567
                      +     + +AR I   F   +   L +  I G+FPF  I VEL  +Y  
Sbjct: 481 TLRAFSSPAQQKLAVTNSNLARTIKSIFDDPFSGLLAS--IGGLFPFFIIYVELQHVYKF 538

Query: 568 LWFNKI------FYMFGXXXXXXXXXXXXXXXXXXMITYHSL-CLENWKWQWRGFTVGGV 620
           +W  K       +++F                   ++ + S   LEN  W+WR F +   
Sbjct: 539 VWLEKASFYYLRWFLFANIIILCIVVVEIAIISAYIMMHSSRSSLEN-SWRWRSFQISS- 596

Query: 621 GCALYVFIHSI--LFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFISSMFFIRKIY 678
            CA Y+ ++S+  +F      GF++I+L +  S++ + LC    GSIG++++ +F+ ++Y
Sbjct: 597 SCAWYMELYSLYYIFYVLNTTGFSSILLSVCSSALFNGLCGCALGSIGYLATCWFVGRVY 656

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 77/313 (24%), Positives = 118/313 (37%), Gaps = 74/313 (23%)

Query: 7   FLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDED--GNNVSGDKEH 64
           F+++F++    +  + G  P   + +       N LTP++Y +  D +   N +  D   
Sbjct: 8   FIIFFLLIVTISTIIYGHIPIIQRHD------ANRLTPNIYRKGDDVELIVNKIESDLTK 61

Query: 65  FLYSYDYYYDKFHFCKPEHVEKQP--ESLGSIIFGDRIYNSPFELNMLQEKECVSLC-KT 121
             Y Y   YD    C P + +++P   SL  I+ GDR + S + L   ++ +C  LC + 
Sbjct: 62  LPYGY---YDLPFICPPTN-QRKPLHMSLTEILRGDRKWQSDYSLTFGKDNDCAVLCARK 117

Query: 122 VIPGDDAKFINKLIKNGFFQNWLIDG-LPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVD 180
             P    K IN L+K  +   W ID  LPA+           +Y  GF LGFV+     D
Sbjct: 118 TTPEGIQKAIN-LVKKDYIVQWSIDNDLPASTTFISTSENRKYYIPGFSLGFVD----PD 172

Query: 181 SETEQVQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFD 240
           +ET                                                  Y  NH  
Sbjct: 173 TET-------------------------------------------------AYLNNHVM 183

Query: 241 IKIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVY---FTYSVK 297
           + I YH   + ++ +VG+ V P S+          N     L   +D EV    FTYSV 
Sbjct: 184 LVIRYHAIDDEHFTIVGLEVYPKSVSDYHCPGASRNYEQFELVANDDEEVTYIPFTYSVY 243

Query: 298 F-EESPTSWATRW 309
           + EE    W  R+
Sbjct: 244 WREEFDVEWKDRY 256

>Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113C -
           Hypothetical ORF [contig 33] FULL
          Length = 690

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 110/297 (37%), Gaps = 79/297 (26%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDKFHFCKPEH 83
           + P  YK+ D++ +++N                 V  +   F Y Y   YD    C P  
Sbjct: 40  IKPNVYKKGDKVDVIIN----------------KVVSETARFPYGY---YDLQFVCPPSD 80

Query: 84  VEKQPE--SLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLIKNGFFQ 141
            +K+P   SL  II GDR + S + L   +  +C+ LC      +  K  + LI+ G+  
Sbjct: 81  -KKKPLHLSLNEIIRGDRKWESDYNLAFGERHDCLRLCDRKTKPEGLKQADALIRQGYVA 139

Query: 142 NWLI-DGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGETEQTQAAD 200
           +WLI D LPAA      ++   FY AGF LG V+                       A  
Sbjct: 140 HWLIDDDLPAATTFAKTKSGKKFYTAGFPLGEVD-----------------------AVT 176

Query: 201 GKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGNYRVVGVIV 260
           GKT                                 NH  + + Y       + ++G  V
Sbjct: 177 GKTR------------------------------LYNHLMLVVRYQTVDVNKHTIIGFEV 206

Query: 261 NPLSIKRSSPGTCETNGSPLVLDEANDNEVY--FTYSVKF-EESPTSWATRWDKYLH 314
            P S+  +       +  P  ++       Y  FTYS+ + EES   W+ RW+ ++H
Sbjct: 207 YPKSVSDAHCPGANKDYQPYEINTEESEITYIPFTYSIYWREESNIDWSHRWNFFIH 263

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 65/143 (45%), Gaps = 30/143 (20%)

Query: 462 IPGAILLVIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDE 521
           +PG +L  ++ LN  +    SS  IP  T+   V  +F+ S PLS  G   ARK  +   
Sbjct: 400 LPGLVLFTVLVLNGIVWLKDSSSAIPFGTVVVFVAGYFMISFPLSLLGGFSARKMKN-AA 458

Query: 522 HPTKTNQIARQIPFQPWYLKTL-------PA-----------------TLIAGIFPFGSI 557
                N I++  PF   +L TL       PA                 T++AGI PF  I
Sbjct: 459 KLAPANAISKS-PFS--FLLTLSYDTRSWPATALGKPFPIALSNPILLTILAGIAPFVVI 515

Query: 558 AVELYFIYTSLWFN--KIFYMFG 578
            VEL+++Y S+W      +Y++G
Sbjct: 516 CVELFYVYKSMWLQTTNFYYLYG 538

 Score = 38.5 bits (88), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 42/74 (56%), Gaps = 1/74 (1%)

Query: 610 WQWRGFTVGG-VGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFI 668
           W+W+ F  GG V   L ++    L     L   ++I+L++ Y+++ + +C    G++G++
Sbjct: 615 WRWKSFVAGGSVAWYLELYSLYYLIFVLHLRDLSSILLFVCYTALFNFMCWCAFGALGYL 674

Query: 669 SSMFFIRKIYSSIK 682
           S ++F+  I SS K
Sbjct: 675 SCLWFLSHISSSSK 688

>TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7.411
           YER113C
          Length = 733

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 109/298 (36%), Gaps = 72/298 (24%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDKFHFCKPEH 83
           V P TY   D + ++VN +      Q +D  G++  G       SY Y+ D  + C P +
Sbjct: 46  VHPNTYTFGDPVEVIVNKMV-----QEKDMLGDSNEG------VSYKYH-DLPYICPPTN 93

Query: 84  VEKQ-PESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLIKNGFFQN 142
            +K    SL  +  GD    S + L    + +C +LC         +   ++I   +  N
Sbjct: 94  TKKSIHNSLKELFNGDYNEQSDYILKFGVDNDCQALCLRKTYNAGIRKAKEMIDEDYIVN 153

Query: 143 WLIDG-LPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGETEQTQAADG 201
           W ID  LPAA       T+   Y  GF LG+                             
Sbjct: 154 WFIDDYLPAATTYISSVTRKKKYFEGFSLGW----------------------------- 184

Query: 202 KTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGNYRVVGVIVN 261
             +PE G                         Y  NH  + I Y+   +  + +VG  V 
Sbjct: 185 -KDPETGSY-----------------------YINNHVMLVIRYNAVDDNKFNIVGFEVY 220

Query: 262 PLSI-KRSSPGTCETNGSPLVLDEANDNE---VYFTYSVKF-EESPTSWATRWDKYLH 314
           P SI     PG    +G   + D  N++E   + F+YSV + EE    W TRW  ++ 
Sbjct: 221 PKSIPDLQCPGARRGHGHYELKDLENNDEFSLIPFSYSVYWREEFEYDWRTRWSLFVR 278

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 75/143 (52%), Gaps = 5/143 (3%)

Query: 382 QSLMLSILVGSGVQ-IFLMVTCSIFFAALGFL-SPSSRGSLATVMFILYALF--GFVGSY 437
           ++++L+ILV  G Q +F+ +   +  ++L  L + S+   L  + +I  +L    FVG++
Sbjct: 355 KNILLNILVSMGCQALFIFMPVIVIQSSLWSLHNISNYVMLQIICWISASLLVGSFVGTW 414

Query: 438 TSMGIYKFFDGPYWKANV-IMTPLLIPGAILLVIIALNFFLMFVHSSGVIPASTLFFMVF 496
             M +++    P +   + I+   ++PG  L  +   N    F+  +   P   L +++F
Sbjct: 415 LRMYMFQKKMTPNYDPKMSIVCGSILPGLTLAGVTVFNTVTWFLEGNSSYPFRKLSWLIF 474

Query: 497 LWFLFSIPLSFAGSLVARKKCHW 519
           ++F+FSIP+S  G  +A K  H+
Sbjct: 475 VYFIFSIPMSLIGGSLAVKIQHY 497

>AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER113C
          Length = 657

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/290 (23%), Positives = 102/290 (35%), Gaps = 77/290 (26%)

Query: 26  PTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDKFHFCKPEHVE 85
           P+ Y   + + LLV+                N+  D+E     + YY   F    P    
Sbjct: 39  PSAYTRGERVQLLVD----------------NIWTDRE----VWGYYETLFTCPPPAEAR 78

Query: 86  KQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLIKNGFFQNWLI 145
               SLG +   +  + S + L++  E +C  LC   +  D  + + ++I++G    W +
Sbjct: 79  AIYGSLGQVFRREMPWESNYVLHVRAETQCQPLCMRELRPDSHRRLIQMIRDGAQVRWTL 138

Query: 146 DGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGETEQTQAADGKTEP 205
           DGLPAA    D R  +  Y AGF LG       VD+ET  V+                  
Sbjct: 139 DGLPAATTYPD-RQSSYRYEAGFKLG------EVDAETGHVR------------------ 173

Query: 206 EKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGNYRVVGVIVNPLSI 265
                                          NH  + + Y    +G Y +VG    P S+
Sbjct: 174 -----------------------------LHNHVMLVVRYRILDDGRYVIVGFEAYPRSV 204

Query: 266 --KRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFE-ESPTSWATRWDKY 312
             +  + G  E     L  D      V FTY+V +  +S   W  RW  Y
Sbjct: 205 AGEGCTGGQTEYEHFWLNPDAQAMIMVPFTYAVYWRYQSAVKWNERWRLY 254

>Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON}
           (64237..66282) [2046 nt, 682 aa]
          Length = 681

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 123/590 (20%), Positives = 207/590 (35%), Gaps = 121/590 (20%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDKFHFCKPEH 83
           + P  YK  D + LLVN    ++            + D + ++Y     +D    C P  
Sbjct: 47  LQPNVYKVGDNVDLLVNKAISTL------------NADLKPYIY-----HDLPFVCPPTS 89

Query: 84  VEKQPE-SLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLIKNGFFQN 142
           V K       S+  GD +  S ++L    + EC  LC      +       +IK  +   
Sbjct: 90  VRKPVHLEFDSLFRGDTLSESDYKLKFGDDYECEILCARKTNKNGVSKAIDMIKQDYQIL 149

Query: 143 WLIDG-LPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGETEQTQAADG 201
           W ID  LP +       T+   Y  GF L                              G
Sbjct: 150 WSIDDELPISMPYISTITQRKKYIPGFPL------------------------------G 179

Query: 202 KTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGNYRVVGVIVN 261
           + + +K K                        Y  NH  + I Y+   +  + +VG  V 
Sbjct: 180 RFDKDKNKV-----------------------YLYNHSMLVIRYNAIDDDKFTIVGFEVY 216

Query: 262 PLSIKR-SSPGTCET-NGSPLVLDEANDNEVY--FTYSVKF-EESPTSWATRW---DKYL 313
             S+     PG  +      LV+ E +D+  +  FTYSV + EE    W +RW   D  +
Sbjct: 217 LRSVSDYHCPGASKNYEEYELVIPENDDDLTFIPFTYSVYWREEFDIDWTSRWNLFDNDI 276

Query: 314 HVYDPSI----------QWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDF 363
              DP +          Q                          K+ F    +L      
Sbjct: 277 EEEDPKLINKSMLSNIMQPTRTGLFLLPLIIFSIIIVKVVENGEKNKFTTEAQL------ 330

Query: 364 QEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQ-IFLMVTCSIFFAALGFLSPSSRGSLAT 422
                W  ++    +    + +L++++  GVQ IF ++   I   ++  L   S   L  
Sbjct: 331 -ASKCWIESNNINLKSSFSASILTLVISMGVQSIFSLIGIIILKLSIYKLHDISNIVLLN 389

Query: 423 VMF-----ILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFL 477
           +       IL +   F+G++  M I       Y     I+   L+P  +++ +  ++  +
Sbjct: 390 IFIWFIEGILAS--SFLGTWLRMNILNKKSINYNPKFSILCGSLLPFLLMIFVYPIHSIV 447

Query: 478 MFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARK-KCHWDEH------PTKTNQIA 530
             + SS   P  TL  M+  +++  +P S  G  +A+K + H+ E         + N   
Sbjct: 448 WLIESSSRYPFKTLTMMISFFYIICVPFSIIGGGLAKKYRKHYKEMFGNITLDNENNDND 507

Query: 531 RQIPFQPWY---------LKTLPATLIAGIFPFGSIAVELYFIYTSLWFN 571
            +  F+  +         L TL  +LI  I PF  I  ELY+I+T+ W N
Sbjct: 508 EKKRFKAQHRPSSINKNKLGTLVYSLITAIVPFFIIKSELYWIFTNKWLN 557

>TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411
           YER113C
          Length = 713

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 106/526 (20%), Positives = 172/526 (32%), Gaps = 109/526 (20%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDKFHFCKPEH 83
           + P  YK  D++ +  N   P         D   VS            YYD    C P  
Sbjct: 60  IKPNLYKVGDKVQITTNKALP---------DDPAVSQPALC-------YYDLPFVCPPSD 103

Query: 84  VEKQP--ESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLIKNGFFQ 141
             K+P   SL  +  GD +  S + L   +++ C  LC         +    LIKN +  
Sbjct: 104 T-KRPIHNSLTELFNGDYLSESDYILEFAKDEPCHILCSRKTSKKGMQRAYDLIKNDYIV 162

Query: 142 NWLIDG-LPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGETEQTQAAD 200
            W +D  LP        +     Y  GF LG+       D++T Q               
Sbjct: 163 QWYVDNDLPVGTTYISNKVNKKQYLPGFSLGYF------DNQTGQA-------------- 202

Query: 201 GKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGNYRVVGVIV 260
                                            Y   H    + YH      + +VG+ V
Sbjct: 203 ---------------------------------YLNTHLMFVVRYHAVTSDTFTIVGLEV 229

Query: 261 NPLSIKRSSPGTCETNGSPLVLD--EANDNEVY--FTYSVKF-EESPTSWATRWDKY--- 312
            P SI   +      +  PL +   E ND+  Y  F+YSV + EE    W  RWD +   
Sbjct: 230 YPRSIVDYNCPGASKDFIPLEVKVPENNDDPTYLPFSYSVYWREEFDLPWNQRWDLFKTA 289

Query: 313 ---LHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGW 369
              L   D S  W                        L     R   L        +  W
Sbjct: 290 DELLREKDLSFHWYSLINSNSITVGVITFL------CLVISMNRMRIL-------YNKSW 336

Query: 370 KLNHGDVF-----RPPSQSLMLSILVGSGVQIFLMVTCSIFFA-ALGFLSPSSRGSLATV 423
           K     +      R P+   + +I + SG+Q F ++  S+     +          +  +
Sbjct: 337 KKRQLSITTTTTTRYPN---IFTICITSGIQFFFLLISSVLITFQISKFHQIKDTIIVAL 393

Query: 424 MFILYALFG--FVGSYTSMG-IYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFV 480
            FI + +    F+G+      I   F   Y+  N I+    +P  ILL +  +N  +   
Sbjct: 394 FFIAFGIIVSVFIGTLIQRTFILTNFPDKYYLTNPILFGSTLPAFILLSMFIINSIIYLS 453

Query: 481 HSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKT 526
             +   P     +    +F+ SIPLS    +++ +   + ++P+++
Sbjct: 454 EKNHAFPFKLSMYFFTSYFILSIPLSIISGVLSTRFISFPKYPSRS 499

>KLTH0D07414g Chr4 (645479..647713) [2235 bp, 744 aa] {ON} similar
           to uniprot|P33413 Saccharomyces cerevisiae YHL016C DUR3
           Plasma membrane urea transporter expression is highly
           sensitive to nitrogen catabolite repression and induced
           by allophanate the last intermediate of the allantoin
           degradative pathway
          Length = 744

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 6/46 (13%)

Query: 185 QVQVASGETEQTQAADGKTEPE------KGKSSNEGMELDARDQGK 224
           QV   + ETE+ +AA+G+TE E      +G +S+ G  ++A D+ K
Sbjct: 545 QVITRADETEEIEAAEGQTEGENGQVSVRGDTSDSGNSIEANDREK 590

>Skud_13.466 Chr13 (828310..828331,828415..828809) [417 bp, 138 aa]
           {ON} YMR292W (REAL)
          Length = 138

 Score = 31.6 bits (70), Expect = 3.3,   Method: Composition-based stats.
 Identities = 26/87 (29%), Positives = 42/87 (48%), Gaps = 8/87 (9%)

Query: 419 SLATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLM 478
           +L  ++F++  +F  +GS  +   Y FF  P    N     LL     LL+++   FF  
Sbjct: 35  ALGNILFLI-GVFLIIGSQKT---YVFFTRP----NKRRGSLLFVVGSLLILLKWTFFGF 86

Query: 479 FVHSSGVIPASTLFFMVFLWFLFSIPL 505
            + S G+I     FF V + FL S+P+
Sbjct: 87  IIESLGIIGLFGDFFGVIVQFLRSMPI 113

>SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 751

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 11/42 (26%), Positives = 25/42 (59%)

Query: 347 LKSDFARYNELNLDDDFQEDSGWKLNHGDVFRPPSQSLMLSI 388
           +K+++ ++  +  D +FQ  +GWKL++ D    P+++    I
Sbjct: 43  IKTEYRQFRNMTYDSNFQNITGWKLSYQDALDDPNRNATYPI 84

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.141    0.442 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,972,727
Number of extensions: 3263010
Number of successful extensions: 10905
Number of sequences better than 10.0: 68
Number of HSP's gapped: 11011
Number of HSP's successfully gapped: 108
Length of query: 684
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 568
Effective length of database: 40,180,143
Effective search space: 22822321224
Effective search space used: 22822321224
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 69 (31.2 bits)