Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_10.166na 1ON39239220920.0
Skud_12.150na 1ON39039216830.0
Smik_12.141na 1ON39239216560.0
YLR082C (SRL2)na 1ON39239216220.0
NCAS0A110303.340ON104469741.4
ZYRO0C10450g2.41ON61371713.1
NDAI0A052703.340ON105844686.7
Kwal_23.45482.41ON71171686.8
KLLA0D13002gna 2ON344139677.8
KLTH0B07744g2.41ON61371678.7
TBLA0A038708.313ON168367679.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_10.166
         (392 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_10.166 Chr10 complement(297390..298568) [1179 bp, 392 aa] {...   810   0.0  
Skud_12.150 Chr12 complement(275805..276977) [1173 bp, 390 aa] {...   652   0.0  
Smik_12.141 Chr12 complement(272182..273360) [1179 bp, 392 aa] {...   642   0.0  
YLR082C Chr12 complement(292394..293572) [1179 bp, 392 aa] {ON} ...   629   0.0  
NCAS0A11030 Chr1 (2195054..2198188) [3135 bp, 1044 aa] {ON} Anc_...    33   1.4  
ZYRO0C10450g Chr3 complement(800873..802714) [1842 bp, 613 aa] {...    32   3.1  
NDAI0A05270 Chr1 complement(1187490..1190666) [3177 bp, 1058 aa]...    31   6.7  
Kwal_23.4548 s23 (764273..766408) [2136 bp, 711 aa] {ON} YNL209W...    31   6.8  
KLLA0D13002g Chr4 (1111951..1112985) [1035 bp, 344 aa] {ON} cons...    30   7.8  
KLTH0B07744g Chr2 complement(628224..630065) [1842 bp, 613 aa] {...    30   8.7  
TBLA0A03870 Chr1 complement(966525..971576) [5052 bp, 1683 aa] {...    30   9.9  

>Suva_10.166 Chr10 complement(297390..298568) [1179 bp, 392 aa] {ON}
           YLR082C (REAL)
          Length = 392

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/392 (100%), Positives = 392/392 (100%)

Query: 1   MSNFKNFTLNSFEDYYGKASEPSRMEEEKLEATNLNVSSLKKVHKGKKNASKYDQKNVFR 60
           MSNFKNFTLNSFEDYYGKASEPSRMEEEKLEATNLNVSSLKKVHKGKKNASKYDQKNVFR
Sbjct: 1   MSNFKNFTLNSFEDYYGKASEPSRMEEEKLEATNLNVSSLKKVHKGKKNASKYDQKNVFR 60

Query: 61  NSMTGVVQAAPLKPIKIIEQNIEFANPKSFDLLQSTHTICFSKKNGTTDTKLNMEAQTSS 120
           NSMTGVVQAAPLKPIKIIEQNIEFANPKSFDLLQSTHTICFSKKNGTTDTKLNMEAQTSS
Sbjct: 61  NSMTGVVQAAPLKPIKIIEQNIEFANPKSFDLLQSTHTICFSKKNGTTDTKLNMEAQTSS 120

Query: 121 DIDNDLLHVGAPTDLGGNSNDEAETRQLRKFRWSNNKDKCLCEKLTVIYWALLLNTTKRA 180
           DIDNDLLHVGAPTDLGGNSNDEAETRQLRKFRWSNNKDKCLCEKLTVIYWALLLNTTKRA
Sbjct: 121 DIDNDLLHVGAPTDLGGNSNDEAETRQLRKFRWSNNKDKCLCEKLTVIYWALLLNTTKRA 180

Query: 181 SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVTWIAQGKELHEKGWIDIAKTGD 240
           SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVTWIAQGKELHEKGWIDIAKTGD
Sbjct: 181 SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVTWIAQGKELHEKGWIDIAKTGD 240

Query: 241 LQEQFNFATIKLYESAEDGRFIASKDKTSREENTVNDGSIQPEEESADTTDETGPVTTGK 300
           LQEQFNFATIKLYESAEDGRFIASKDKTSREENTVNDGSIQPEEESADTTDETGPVTTGK
Sbjct: 241 LQEQFNFATIKLYESAEDGRFIASKDKTSREENTVNDGSIQPEEESADTTDETGPVTTGK 300

Query: 301 STKEDRRELIRNQILALDLNDEDFFQNVMKTLSSIDEPKLRQYVTIISELVNMEIDDGKT 360
           STKEDRRELIRNQILALDLNDEDFFQNVMKTLSSIDEPKLRQYVTIISELVNMEIDDGKT
Sbjct: 301 STKEDRRELIRNQILALDLNDEDFFQNVMKTLSSIDEPKLRQYVTIISELVNMEIDDGKT 360

Query: 361 VREKLRDVEMSINRLQVDIREIKEMLIALANK 392
           VREKLRDVEMSINRLQVDIREIKEMLIALANK
Sbjct: 361 VREKLRDVEMSINRLQVDIREIKEMLIALANK 392

>Skud_12.150 Chr12 complement(275805..276977) [1173 bp, 390 aa] {ON}
           YLR082C (REAL)
          Length = 390

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/392 (80%), Positives = 341/392 (86%), Gaps = 2/392 (0%)

Query: 1   MSNFKNFTLNSFEDYYGKASEPSRMEEEKLEATNLNVSSLKKVHKGKKNASKYDQKNVFR 60
           MSNFKNFTLNSFED+YGKASE  ++EEEKLEA N N SSLKKVHK KK  SKYDQKNVFR
Sbjct: 1   MSNFKNFTLNSFEDFYGKASETPKIEEEKLEAMNTNASSLKKVHKNKKVISKYDQKNVFR 60

Query: 61  NSMTGVVQAAPLKPIKIIEQNIEFANPKSFDLLQSTHTICFSKKNGTTDTKLNMEAQTSS 120
           NSMT + Q  P K +KIIEQNIEF+NPKSFDLLQ+THTICF+KKNGT DTK+NMEAQTSS
Sbjct: 61  NSMTALAQVPPSKSVKIIEQNIEFSNPKSFDLLQATHTICFNKKNGTKDTKINMEAQTSS 120

Query: 121 DIDNDLLHVGAPTDLGGNSNDEAETRQLRKFRWSNNKDKCLCEKLTVIYWALLLNTTKRA 180
           DIDND+L+V AP DLGGNSNDEAETRQLRKFRWSNNK+KCLCEKLTVIYWALLLNTTKRA
Sbjct: 121 DIDNDMLYVEAPADLGGNSNDEAETRQLRKFRWSNNKEKCLCEKLTVIYWALLLNTTKRA 180

Query: 181 SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVTWIAQGKELHEKGWIDIAKTGD 240
           SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLV W+ QGKELHEKGWI   KT D
Sbjct: 181 SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVAWVTQGKELHEKGWIGDTKTSD 240

Query: 241 LQEQFNFATIKLYESAEDGRFIASKDKTSREENTVNDGSIQPEEESADTTDETGPVTTGK 300
           LQEQFN AT+KLYES E+GR I  KDK  REEN  +DG +Q  EESA  TDE G V   K
Sbjct: 241 LQEQFNIATVKLYESTENGRIIMGKDKVFREENAGSDGLVQ--EESASVTDENGQVALEK 298

Query: 301 STKEDRRELIRNQILALDLNDEDFFQNVMKTLSSIDEPKLRQYVTIISELVNMEIDDGKT 360
           + KEDRRE IRNQILALDL DEDFFQN MK LS+IDEP+LRQY  IISELV+MEIDDGKT
Sbjct: 299 NLKEDRRESIRNQILALDLGDEDFFQNTMKNLSAIDEPELRQYGVIISELVSMEIDDGKT 358

Query: 361 VREKLRDVEMSINRLQVDIREIKEMLIALANK 392
           VREKLRDVEMSINRLQ+DI+EIKE+LI L NK
Sbjct: 359 VREKLRDVEMSINRLQLDIKEIKELLITLMNK 390

>Smik_12.141 Chr12 complement(272182..273360) [1179 bp, 392 aa] {ON}
           YLR082C (REAL)
          Length = 392

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/392 (80%), Positives = 349/392 (89%)

Query: 1   MSNFKNFTLNSFEDYYGKASEPSRMEEEKLEATNLNVSSLKKVHKGKKNASKYDQKNVFR 60
           MSNFKNFTLNSFEDYYGKASE  +ME+EK EATN++ SS KKV+K KKN ++YDQKNVFR
Sbjct: 1   MSNFKNFTLNSFEDYYGKASETPKMEDEKSEATNVSASSSKKVYKSKKNTTRYDQKNVFR 60

Query: 61  NSMTGVVQAAPLKPIKIIEQNIEFANPKSFDLLQSTHTICFSKKNGTTDTKLNMEAQTSS 120
           NS TG+ Q  P KP+KIIEQ+I+FANPKSFDLLQSTHTICF++KNGTTDTKLNMEAQTSS
Sbjct: 61  NSTTGLAQTLPTKPVKIIEQSIDFANPKSFDLLQSTHTICFNRKNGTTDTKLNMEAQTSS 120

Query: 121 DIDNDLLHVGAPTDLGGNSNDEAETRQLRKFRWSNNKDKCLCEKLTVIYWALLLNTTKRA 180
           DIDND+LHVGAP+DLGGNSNDEAETRQLRKFRWSNNK+KC+CEKLTVIYWALLLNTTKRA
Sbjct: 121 DIDNDMLHVGAPSDLGGNSNDEAETRQLRKFRWSNNKEKCICEKLTVIYWALLLNTTKRA 180

Query: 181 SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVTWIAQGKELHEKGWIDIAKTGD 240
           SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVTW+ QGKELHEKGW   +KTGD
Sbjct: 181 SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVTWVTQGKELHEKGWEGDSKTGD 240

Query: 241 LQEQFNFATIKLYESAEDGRFIASKDKTSREENTVNDGSIQPEEESADTTDETGPVTTGK 300
           LQEQFN A IKLY+SAEDGR I +KD+  REEN+ ++ S++ EE+   TTDE   V   +
Sbjct: 241 LQEQFNIAIIKLYDSAEDGRLIMAKDRVFREENSRSNSSVRAEEDFTSTTDENDQVALQR 300

Query: 301 STKEDRRELIRNQILALDLNDEDFFQNVMKTLSSIDEPKLRQYVTIISELVNMEIDDGKT 360
           + KEDRRE IRN ILALDLNDEDF  N+MK LSSIDEP+LRQYV IISELV+MEIDDGKT
Sbjct: 301 NLKEDRRESIRNHILALDLNDEDFLHNIMKILSSIDEPELRQYVVIISELVSMEIDDGKT 360

Query: 361 VREKLRDVEMSINRLQVDIREIKEMLIALANK 392
           VREKLRDVEMSINRLQVDI+EIKEMLI LA K
Sbjct: 361 VREKLRDVEMSINRLQVDIKEIKEMLIMLAKK 392

>YLR082C Chr12 complement(292394..293572) [1179 bp, 392 aa] {ON}
           SRL2Protein of unknown function; overexpression
           suppresses the lethality caused by a rad53 null mutation
          Length = 392

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/392 (79%), Positives = 347/392 (88%)

Query: 1   MSNFKNFTLNSFEDYYGKASEPSRMEEEKLEATNLNVSSLKKVHKGKKNASKYDQKNVFR 60
           MSNFKNFTLNSFEDYYGK SE  +MEEEKLE TN+N SS KKVHK KK+ SKYDQKNVFR
Sbjct: 1   MSNFKNFTLNSFEDYYGKPSETPKMEEEKLEVTNVNASSSKKVHKSKKSTSKYDQKNVFR 60

Query: 61  NSMTGVVQAAPLKPIKIIEQNIEFANPKSFDLLQSTHTICFSKKNGTTDTKLNMEAQTSS 120
           NSMTG+ Q  P KP+KIIEQNI+FANPKSFDLLQSTHTICF+K+  TT+TKLN+E  TSS
Sbjct: 61  NSMTGIAQILPTKPVKIIEQNIDFANPKSFDLLQSTHTICFNKRINTTNTKLNVETHTSS 120

Query: 121 DIDNDLLHVGAPTDLGGNSNDEAETRQLRKFRWSNNKDKCLCEKLTVIYWALLLNTTKRA 180
           DIDND+LHVGAPTDLGGNSNDEAETRQLRKFRWSNNK+K LCEKLTVIYWALLL+TTKRA
Sbjct: 121 DIDNDILHVGAPTDLGGNSNDEAETRQLRKFRWSNNKEKSLCEKLTVIYWALLLHTTKRA 180

Query: 181 SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVTWIAQGKELHEKGWIDIAKTGD 240
           SKRRPILCHQ+IAEFFNRVYKEKSRVPITSRYIRDNLV W+ QGKELHEKGW+  AKTGD
Sbjct: 181 SKRRPILCHQMIAEFFNRVYKEKSRVPITSRYIRDNLVAWVTQGKELHEKGWVGDAKTGD 240

Query: 241 LQEQFNFATIKLYESAEDGRFIASKDKTSREENTVNDGSIQPEEESADTTDETGPVTTGK 300
           LQEQFN AT+KLYESAEDGR    KDK  REENT +D  ++ EE+S   T+E G +++ K
Sbjct: 241 LQEQFNIATVKLYESAEDGRLSIGKDKPFREENTGSDSLVRAEEDSTAVTNENGHISSEK 300

Query: 301 STKEDRRELIRNQILALDLNDEDFFQNVMKTLSSIDEPKLRQYVTIISELVNMEIDDGKT 360
           + K+DRRE IRNQIL LDLNDEDFFQNVMK LS+IDEP+LRQYV +ISELV+ME+DDGKT
Sbjct: 301 NLKKDRRESIRNQILTLDLNDEDFFQNVMKVLSAIDEPELRQYVIVISELVSMEMDDGKT 360

Query: 361 VREKLRDVEMSINRLQVDIREIKEMLIALANK 392
           VREKLRDVE++INRLQVDI+EIKEML+ L NK
Sbjct: 361 VREKLRDVELNINRLQVDIKEIKEMLVTLINK 392

>NCAS0A11030 Chr1 (2195054..2198188) [3135 bp, 1044 aa] {ON}
           Anc_3.340 YPR055W
          Length = 1044

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 33/69 (47%), Gaps = 14/69 (20%)

Query: 72  LKPIKIIEQNIEFANPKSFD-LLQSTHTICFSKKNGTTDTKLNMEAQTSSDIDNDLLHVG 130
           LKP+K I Q +E      F+ L++  H I +SKKN             + D+DNDLL   
Sbjct: 208 LKPLKPIRQQLELQEHVLFNNLIEELHNIIYSKKN-------------TPDMDNDLLKTI 254

Query: 131 APTDLGGNS 139
           + T  G  S
Sbjct: 255 SITQNGFTS 263

>ZYRO0C10450g Chr3 complement(800873..802714) [1842 bp, 613 aa] {ON}
           uniprot|Q707X3 Zygosaccharomyces rouxii SSB Heat shock
           protein SSB
          Length = 613

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 3/71 (4%)

Query: 279 SIQPEEESADTTDETGPVTTGKSTKEDRRELIRNQILALDLN---DEDFFQNVMKTLSSI 335
           SI P+E  A      G + TG+ST ED ++L+   +  L L      D F  V+   +++
Sbjct: 365 SINPDEAVAYGAAVQGAILTGQSTSEDTKDLLLLDVAPLSLGVGMQGDIFGIVVPRNTTV 424

Query: 336 DEPKLRQYVTI 346
              K R + T+
Sbjct: 425 PTIKRRTFTTV 435

>NDAI0A05270 Chr1 complement(1187490..1190666) [3177 bp, 1058 aa]
           {ON} Anc_3.340 YPR055W
          Length = 1058

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 72  LKPIKIIEQNIEFANPKSFD-LLQSTHTICFSKKNGTTDTKLNM 114
           LKP+K I Q +E      F+ L+   H I +SKKN  TD  +++
Sbjct: 202 LKPLKPITQQLEMQEHVFFNNLIDEIHDIVYSKKNNHTDLDIDI 245

>Kwal_23.4548 s23 (764273..766408) [2136 bp, 711 aa] {ON} YNL209W
           (SSB2) - Heat shock protein of HSP70 family, homolog of
           SSB1 [contig 4] FULL
          Length = 711

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 3/71 (4%)

Query: 279 SIQPEEESADTTDETGPVTTGKSTKEDRRELIRNQILALDLN---DEDFFQNVMKTLSSI 335
           SI P+E  A      G + TG+ST ED ++L+   +  L L      + F  V+   +++
Sbjct: 463 SINPDEAVAYGAAVQGAILTGQSTSEDTKDLLLLDVAPLSLGVAMQGNVFAPVVPRNTTV 522

Query: 336 DEPKLRQYVTI 346
              K R + T+
Sbjct: 523 PTIKRRTFTTV 533

>KLLA0D13002g Chr4 (1111951..1112985) [1035 bp, 344 aa] {ON}
           conserved hypothetical protein
          Length = 344

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 53/139 (38%), Gaps = 21/139 (15%)

Query: 233 IDIAKTGDLQEQFNFATIKL----YESAEDGRFIASKDKTSREENTVNDGSIQPEEESAD 288
           +D  K  D +E +NF         Y  +ED  F    DK    EN V          S  
Sbjct: 82  LDPRKARDFKEGYNFGYANFKTGEYNLSED-YFYKRSDKNDPSENPV---------PSLF 131

Query: 289 TTDETGPVTTGKSTKEDRRELIRNQILALDLNDEDFFQNVMKTLSSIDEPKLRQYVTIIS 348
             +E   V T +   +   E++R   +AL + DEDFF        S DEP    +  +  
Sbjct: 132 KQNEALTVPTMQKLHKTATEILRLIAIALGIEDEDFF----TARHSPDEPSGSVFRMLRY 187

Query: 349 ELVNMEIDDGKTVREKLRD 367
            L+    DDG T  E   D
Sbjct: 188 PLIR---DDGLTDEETKYD 203

>KLTH0B07744g Chr2 complement(628224..630065) [1842 bp, 613 aa] {ON}
           highly similar to uniprot|P40150 Saccharomyces
           cerevisiae YNL209W SSB2 Ribosome-associated molecular
           chaperone heat shock protein of HSP70 family proposed to
           be involved in the folding of newly synthesized
           polypeptide chains homolog of SSB1
          Length = 613

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 3/71 (4%)

Query: 279 SIQPEEESADTTDETGPVTTGKSTKEDRRELIRNQILALDLN---DEDFFQNVMKTLSSI 335
           SI P+E  A      G + TG+ST ED ++L+   +  L L      + F  V+   +++
Sbjct: 365 SINPDEAVAYGAAVQGAILTGQSTSEDTKDLLLLDVAPLSLGVAMQGNVFAPVVPRNTTV 424

Query: 336 DEPKLRQYVTI 346
              K R + T+
Sbjct: 425 PTIKRRTFTTV 435

>TBLA0A03870 Chr1 complement(966525..971576) [5052 bp, 1683 aa] {ON}
           Anc_8.313 YDR141C
          Length = 1683

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 13/67 (19%)

Query: 6   NFTLNSFEDYYGKASEPSRMEE-EKL-------EATNLNVSSLKKVH----KGKKNASK- 52
           N TL    DYY   S+PS+++E EKL          NL+  ++K +H    +  KN+S+ 
Sbjct: 550 NNTLEKIMDYYISVSDPSKIQESEKLIELSLPFSTENLSFLTVKAIHTIVLENLKNSSRV 609

Query: 53  YDQKNVF 59
           Y+  N+F
Sbjct: 610 YESCNIF 616

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,771,352
Number of extensions: 2057543
Number of successful extensions: 8043
Number of sequences better than 10.0: 131
Number of HSP's gapped: 8450
Number of HSP's successfully gapped: 131
Length of query: 392
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 280
Effective length of database: 40,638,807
Effective search space: 11378865960
Effective search space used: 11378865960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)