Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_9.882.292ON72472435530.0
YIL091C (UTP25)2.292ON72172431370.0
Suva_9.1082.292ON72272431040.0
Skud_9.822.292ON72272530640.0
NDAI0B035302.292ON73972724720.0
NCAS0B062302.292ON72371924260.0
KAFR0J013402.292ON72872824050.0
KNAG0A054002.292ON72171623540.0
SAKL0E07546g2.292ON71873323470.0
TBLA0B059702.292ON71972822970.0
TDEL0G022202.292ON71072822890.0
KLLA0E08229g2.292ON70471422530.0
Kpol_1039.462.292ON70456322480.0
KLTH0G10494g2.292ON74773822360.0
TPHA0D015202.292ON71672522210.0
ZYRO0A02002g2.292ON70972422170.0
Ecym_33312.292ON70871321900.0
CAGL0D04180g2.292ON70057021820.0
Kwal_27.115032.292ON72774321830.0
ADL209C2.292ON70472420880.0
Smik_4.4908.469ON587251810.38
TBLA0C055802.164ON540115790.77
Kpol_1005.115.337ON50695752.2
Skud_4.5058.469ON604249715.7
ZYRO0G16764g5.303ON36469715.9
KLTH0G04004g5.538ON108586717.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_9.88
         (724 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}...  1373   0.0  
YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}  ...  1212   0.0  
Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON...  1200   0.0  
Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}...  1184   0.0  
NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.2...   956   0.0  
NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON} Anc_2...   939   0.0  
KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2....   931   0.0  
KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.2...   911   0.0  
SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} simila...   908   0.0  
TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa] ...   889   0.0  
TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {O...   886   0.0  
KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} simila...   872   0.0  
Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa] ...   870   0.0  
KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {...   865   0.0  
TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.2...   860   0.0  
ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {...   858   0.0  
Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}...   848   0.0  
CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {...   845   0.0  
Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091...   845   0.0  
ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON} S...   808   0.0  
Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON...    36   0.38 
TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 5...    35   0.77 
Kpol_1005.11 s1005 complement(18157..19677) [1521 bp, 506 aa] {O...    33   2.2  
Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON...    32   5.7  
ZYRO0G16764g Chr7 complement(1375587..1376681) [1095 bp, 364 aa]...    32   5.9  
KLTH0G04004g Chr7 complement(316665..319922) [3258 bp, 1085 aa] ...    32   7.7  

>Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}
           YIL091C (REAL)
          Length = 724

 Score = 1373 bits (3553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 676/724 (93%), Positives = 676/724 (93%)

Query: 1   MNGESVREKNDHFRGYRKRGRQELRKIKRSSVRRTKDESVNEVDHVADEIVHSTGEDKIS 60
           MNGESVREKNDHFRGYRKRGRQELRKIKRSSVRRTKDESVNEVDHVADEIVHSTGEDKIS
Sbjct: 1   MNGESVREKNDHFRGYRKRGRQELRKIKRSSVRRTKDESVNEVDHVADEIVHSTGEDKIS 60

Query: 61  DIGSEEDNLXXXXXXXXXXXXYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNENVN 120
           DIGSEEDNL            YDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNENVN
Sbjct: 61  DIGSEEDNLDVEDEEGKKEKVYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNENVN 120

Query: 121 VEYEPVDEQLEIENGLLGXXXXXXXXXXXXXXXXXXXXXXXQDPFESHFNQVSEKYVDDL 180
           VEYEPVDEQLEIENGLLG                       QDPFESHFNQVSEKYVDDL
Sbjct: 121 VEYEPVDEQLEIENGLLGDREDDNDDDSNENEKDDMDSEDEQDPFESHFNQVSEKYVDDL 180

Query: 181 SNAFKSKSIKYKSVKASLGDDESYIYAKPFMVGEEALVESPYRSSSIYSYFLKQRLKVQN 240
           SNAFKSKSIKYKSVKASLGDDESYIYAKPFMVGEEALVESPYRSSSIYSYFLKQRLKVQN
Sbjct: 181 SNAFKSKSIKYKSVKASLGDDESYIYAKPFMVGEEALVESPYRSSSIYSYFLKQRLKVQN 240

Query: 241 GLLDKKIDPLTCMQKKLIDPMFQYKDILXXXXXXXXXXXXXRDLYALHVLNHIYKTRDRI 300
           GLLDKKIDPLTCMQKKLIDPMFQYKDIL             RDLYALHVLNHIYKTRDRI
Sbjct: 241 GLLDKKIDPLTCMQKKLIDPMFQYKDILYEYDSYEKDESEYRDLYALHVLNHIYKTRDRI 300

Query: 301 LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQ 360
           LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQ
Sbjct: 301 LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQ 360

Query: 361 FRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQMI 420
           FRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQMI
Sbjct: 361 FRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQMI 420

Query: 421 LENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRM 480
           LENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRM
Sbjct: 421 LENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRM 480

Query: 481 WYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKVR 540
           WYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKVR
Sbjct: 481 WYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKVR 540

Query: 541 QIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYMK 600
           QIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYMK
Sbjct: 541 QIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYMK 600

Query: 601 EKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPP 660
           EKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPP
Sbjct: 601 EKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPP 660

Query: 661 NNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEV 720
           NNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEV
Sbjct: 661 NNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEV 720

Query: 721 YEFK 724
           YEFK
Sbjct: 721 YEFK 724

>YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}
           UTP25Nucleolar protein required for 35S pre-RNA
           processing and 40S ribosomal subunit biogenesis
          Length = 721

 Score = 1212 bits (3137), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/724 (82%), Positives = 636/724 (87%), Gaps = 3/724 (0%)

Query: 1   MNGESVREKNDHFRGYRKRGRQELRKIKRSSVRRTKDESVNEVDHVADEIVHSTGEDKIS 60
           M+  SVREKND+FRGYRKRGRQELRKIKRSS R T+  S   ++ VA++I H + ED++S
Sbjct: 1   MSDSSVREKNDNFRGYRKRGRQELRKIKRSSAR-TEGGSTETLEDVAEDIDHRSDEDEVS 59

Query: 61  DIGSEEDNLXXXXXXXXXXXXYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNENVN 120
           D+ S  D+             YDALLTILKSEHPEPKRR+ +ADE NKA A+   +E+ N
Sbjct: 60  DVDSG-DDFDIEDEEGKKEKVYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHEN 118

Query: 121 VEYEPVDEQLEIENGLLGXXXXXXXXXXXXXXXXXXXXXXXQDPFESHFNQVSEKYVDDL 180
            E+ PVD+QLEIENGLL                        QDPFESHFNQV EK+VD L
Sbjct: 119 TEHGPVDDQLEIENGLL-GNHEDDNDDDSSGDEKDIDSEDEQDPFESHFNQVPEKFVDKL 177

Query: 181 SNAFKSKSIKYKSVKASLGDDESYIYAKPFMVGEEALVESPYRSSSIYSYFLKQRLKVQN 240
           SNAFK+KS+KYKSVK SL D ESYIYAKP ++GEEALVESPYRSSSIYSYFLKQRLKVQN
Sbjct: 178 SNAFKTKSVKYKSVKGSLSDSESYIYAKPVVIGEEALVESPYRSSSIYSYFLKQRLKVQN 237

Query: 241 GLLDKKIDPLTCMQKKLIDPMFQYKDILXXXXXXXXXXXXXRDLYALHVLNHIYKTRDRI 300
           GLLDKK DPLT +QKKL+DPMFQYKDIL             RDLYALHVLNHIYKTRDRI
Sbjct: 238 GLLDKKTDPLTALQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYALHVLNHIYKTRDRI 297

Query: 301 LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQ 360
           LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQ
Sbjct: 298 LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQ 357

Query: 361 FRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQMI 420
           FRDDSLPP+SKPKSFQHIF+GNT+DFFVVGLKFTRKAIKLYSNFYQSDII+CSPLGIQMI
Sbjct: 358 FRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMI 417

Query: 421 LENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRM 480
           LENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDH+NKIPDQQHEADFSRIRM
Sbjct: 418 LENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRM 477

Query: 481 WYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKVR 540
           WYINEQAKLFRQTMVFTKYISPAANSLINGRC NMAGRWKNHKVIGSE+SSIGQ GLK+R
Sbjct: 478 WYINEQAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIR 537

Query: 541 QIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYMK 600
           QIFQRFDIIGNSIIEEPDYRFKFFTSVIIP IVKS GYEDGIL+YIPDYTDFIRIRNYMK
Sbjct: 538 QIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMK 597

Query: 601 EKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPP 660
           EKTTILFGDINEYS+QRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPP
Sbjct: 598 EKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPP 657

Query: 661 NNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEV 720
           NNPEFYNE VRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKE+
Sbjct: 658 NNPEFYNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEI 717

Query: 721 YEFK 724
           YEFK
Sbjct: 718 YEFK 721

>Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score = 1200 bits (3104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 586/724 (80%), Positives = 628/724 (86%), Gaps = 2/724 (0%)

Query: 1   MNGESVREKNDHFRGYRKRGRQELRKIKRSSVRRTKDESVNEVDHVADEIVHSTGEDKIS 60
           M+G+S RE ++HFRG+RKRGRQE+RKIKR++ RRT+D   NEVDHVA+E V +  ED IS
Sbjct: 1   MSGKSARENDEHFRGHRKRGRQEMRKIKRTTARRTEDVDTNEVDHVAEESVETKAEDAIS 60

Query: 61  DIGSEEDNLXXXXXXXXXXXXYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNENVN 120
           D GSE D L            YDALLTILKSEHPEPKR+KT+A  +N  A    G  N N
Sbjct: 61  DAGSESD-LDIGDEEEKQEKVYDALLTILKSEHPEPKRKKTKATGENNEAVDQTG-VNEN 118

Query: 121 VEYEPVDEQLEIENGLLGXXXXXXXXXXXXXXXXXXXXXXXQDPFESHFNQVSEKYVDDL 180
            + EPVD+QLEIENGLL                        QDPFESHFNQVSEKYVDD+
Sbjct: 119 TDSEPVDDQLEIENGLLSDQEDDSDDDGDENEQDEVDSEDEQDPFESHFNQVSEKYVDDV 178

Query: 181 SNAFKSKSIKYKSVKASLGDDESYIYAKPFMVGEEALVESPYRSSSIYSYFLKQRLKVQN 240
           SNAFK+ +IKYKSVK+ LGDDES IY+KP + G+E  VE PY+SSSIYSYFLKQRLK+QN
Sbjct: 179 SNAFKANNIKYKSVKSPLGDDESCIYSKPVVNGDETPVERPYKSSSIYSYFLKQRLKIQN 238

Query: 241 GLLDKKIDPLTCMQKKLIDPMFQYKDILXXXXXXXXXXXXXRDLYALHVLNHIYKTRDRI 300
           GLLDKKIDPLT +QKKL+DPMFQYKDIL             RDLY LH LNHIYKTRDRI
Sbjct: 239 GLLDKKIDPLTSLQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHALNHIYKTRDRI 298

Query: 301 LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQ 360
           LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTR+ AY VVDKII KSGIDQVDKKGKFYDQ
Sbjct: 299 LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDAAYHVVDKIIKKSGIDQVDKKGKFYDQ 358

Query: 361 FRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQMI 420
           FRDDSLPP SKPKSFQHIF+GNTSDFFVVGLKFTRKAIKLYSNFYQSDII+CSPLGIQMI
Sbjct: 359 FRDDSLPPSSKPKSFQHIFRGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMI 418

Query: 421 LENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRM 480
           LENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRM
Sbjct: 419 LENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRM 478

Query: 481 WYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKVR 540
           WYINEQAKL RQTMVFTKYISPAANSLINGRC N+AGRWKNHKVI SE+SSIGQLGLK+R
Sbjct: 479 WYINEQAKLLRQTMVFTKYISPAANSLINGRCRNLAGRWKNHKVIESETSSIGQLGLKIR 538

Query: 541 QIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYMK 600
           QIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKS GYEDGIL+YIPDYTDFIRIRNYMK
Sbjct: 539 QIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMK 598

Query: 601 EKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPP 660
           EKTTILFGDINEYS+Q+QLNANRSLFQQGR+KV+LYTERLHHYRRYEIKGVK+V+FYKPP
Sbjct: 599 EKTTILFGDINEYSSQKQLNANRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVIFYKPP 658

Query: 661 NNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEV 720
           NNPEFYNETVR+IGKNAFLGNTDLNISTVRC+YSKLDGLSLERIVGTKRA VLSHAQKEV
Sbjct: 659 NNPEFYNETVRYIGKNAFLGNTDLNISTVRCVYSKLDGLSLERIVGTKRAGVLSHAQKEV 718

Query: 721 YEFK 724
           YEFK
Sbjct: 719 YEFK 722

>Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score = 1184 bits (3064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/725 (80%), Positives = 626/725 (86%), Gaps = 4/725 (0%)

Query: 1   MNGESVREKNDHFRGYRKRGRQELRKIKRSSVRRTKDESVNEVDHVADEIVHSTGEDKIS 60
           M+  SVRE  DH RG+RKRGRQELRKIKRSS RRT+D   +++D+VA+E V     D +S
Sbjct: 1   MSSNSVRENEDHHRGHRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAVS 60

Query: 61  DIGSEEDNLXXXXXXXXXXXXYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNENVN 120
           D+GSE+D L            YDALLTILKSEHPEPKR KT+A+E +    +  GNEN  
Sbjct: 61  DVGSEDD-LDVGDEDEKKKKVYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNENA- 118

Query: 121 VEYEPVDEQLEIENGLLGXXXXXXXXX-XXXXXXXXXXXXXXQDPFESHFNQVSEKYVDD 179
            E EPVD+QLEIENGLLG                        QDPFESHFNQV EK VDD
Sbjct: 119 -ESEPVDDQLEIENGLLGDREDESEDDGSEDEKHDDVDSEDEQDPFESHFNQVPEKDVDD 177

Query: 180 LSNAFKSKSIKYKSVKASLGDDESYIYAKPFMVGEEALVESPYRSSSIYSYFLKQRLKVQ 239
           LSNAFKSK+I+YKSVKA L  DESYIYA+P +VGEE+ VESPY+SSSIYSYFLKQRLK+Q
Sbjct: 178 LSNAFKSKNIRYKSVKAPLNGDESYIYAQPVVVGEESSVESPYKSSSIYSYFLKQRLKIQ 237

Query: 240 NGLLDKKIDPLTCMQKKLIDPMFQYKDILXXXXXXXXXXXXXRDLYALHVLNHIYKTRDR 299
           NGL DKKIDPL  +Q+KL+DPMFQYKDIL             RDLY LHVLNHIYKTRDR
Sbjct: 238 NGLQDKKIDPLNALQRKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHVLNHIYKTRDR 297

Query: 300 ILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYD 359
           ILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTR+VAYRVVDKIISKSGIDQVDKKGKFYD
Sbjct: 298 ILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYD 357

Query: 360 QFRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQM 419
           QFRDDSLPP+SKP+SFQHIFKGNT+DFFVVGLKFTRKAIKLYSNFYQSDII+CSPLGIQM
Sbjct: 358 QFRDDSLPPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQM 417

Query: 420 ILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIR 479
           ILENTDKKKRQDDFLSSIE+MVIDQLHSIEYQNISHI TIFDH+NKIPDQQHEADFSRIR
Sbjct: 418 ILENTDKKKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIR 477

Query: 480 MWYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKV 539
           MWYINEQAK FRQTMVFTKYISP  NSLINGRC NMAGRWKNH+ IG E+SSIGQLGLK+
Sbjct: 478 MWYINEQAKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKI 537

Query: 540 RQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYM 599
           RQIFQRFD IGNSI+EEPDYRFKFFTSV+IPSIVKS GYEDGIL+YIPDYTDFIRIRNYM
Sbjct: 538 RQIFQRFDTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYM 597

Query: 600 KEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKP 659
           KEKTTILFGDINEYS+QRQLNANRSLFQQGRLKVMLYTERLHHYRRY+IKGVKSV+FYKP
Sbjct: 598 KEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKP 657

Query: 660 PNNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKE 719
           PNNPEFY+ETVRFIGKNAF GNTDLNISTVRCIYSKLDG+SLERIVGTKRAAVLSHAQKE
Sbjct: 658 PNNPEFYSETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKE 717

Query: 720 VYEFK 724
           VYEFK
Sbjct: 718 VYEFK 722

>NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.292
           YIL091C
          Length = 739

 Score =  956 bits (2472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/727 (65%), Positives = 561/727 (77%), Gaps = 20/727 (2%)

Query: 10  NDHFRGYRKRGRQELRKIKRSSVRRTK-DESVNEVDHVADEIVHSTGEDKISDIGSEEDN 68
           NDH   +RKRGRQELR I+RS+ ++++ D +V E +   + +   + E +  +   +   
Sbjct: 21  NDH---HRKRGRQELRTIRRSAAKKSRYDSNVTEHNDTEELLQEESEEGEEDEEDDQS-E 76

Query: 69  LXXXXXXXXXXXXYDALLTILKSEHPEPKRR--------KTQADEDNKAAAKPAGNENVN 120
                        Y ALLTIL++EHPEPK +        K Q  + N         E+  
Sbjct: 77  QEEVDEDERKGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVSDSNLNNTGDRETEDSI 136

Query: 121 VEYEPVDEQLEIENGLLGXXXXXXXXXXXXXXXXXXXXXXXQDPFESHFNQVSEKYVDDL 180
           +E    DE  +IENGLL                        QDPFESHFN+ +E++VD L
Sbjct: 137 IE---EDETEQIENGLL-DRDDEQSDDDQLNDSNDVESDDEQDPFESHFNKPTEQFVDKL 192

Query: 181 SNAFKSKSIKYKSVKASLGDDESYIYAKPFMVGEEA---LVESPYRSSSIYSYFLKQRLK 237
             AF+S+ IKYK+ K  + D  S I +KP + GEE     + S     SI+SYF+KQRLK
Sbjct: 193 HAAFESREIKYKATKIVIDDSHSVISSKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLK 252

Query: 238 VQNGLLDKKIDPLTCMQKKLIDPMFQYKDILXXXXXXXXXXXXXRDLYALHVLNHIYKTR 297
           +QN LL+ K+DPLT +QK+L+DPMFQYKDIL             RDLYALH LNH+YKTR
Sbjct: 253 IQNNLLNPKVDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTR 312

Query: 298 DRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKF 357
           DRILKNNQRLQDN DTE+LDQGFTRPKVLIVVPTR+ AY V DKII KSG+DQVDKKGKF
Sbjct: 313 DRILKNNQRLQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKF 372

Query: 358 YDQFRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGI 417
           YDQF+DDSLPP SKPKSFQ IFKGNT+DFFV+GLKFTRKAIKLYSNFYQSDII+CSPLG+
Sbjct: 373 YDQFKDDSLPPSSKPKSFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGM 432

Query: 418 QMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSR 477
           QMI+ENTDKKKRQDDFLSSIEL+++DQLHS+EYQN++HIFTIFDH+NKIP +QH+ADFSR
Sbjct: 433 QMIVENTDKKKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSR 492

Query: 478 IRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGL 537
           IRMWYIN+QAKLFRQTMVFTKY+SPAAN++IN RC N  GRWKNHK++  E SSIG+LGL
Sbjct: 493 IRMWYINDQAKLFRQTMVFTKYVSPAANAIINNRCRNWEGRWKNHKIVAPEVSSIGKLGL 552

Query: 538 KVRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRN 597
           K++QIFQRFDI+G SI++EPDYRFK FTSVIIPSIVKS  Y+DGIL+YIPDYTD++RIRN
Sbjct: 553 KIKQIFQRFDIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRN 612

Query: 598 YMKEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFY 657
           Y+KEKT ILFGDINEYS QR+LN+NRSL QQGR+KV+LYTERLHHYRRYEIKGVKSVVFY
Sbjct: 613 YLKEKTRILFGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFY 672

Query: 658 KPPNNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQ 717
           KPP NPEFYNE VRFIGKNAFLGNTDLNISTVR +Y KLDGLSLERIVGTKRA +L HAQ
Sbjct: 673 KPPTNPEFYNEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQ 732

Query: 718 KEVYEFK 724
            EVYEFK
Sbjct: 733 NEVYEFK 739

>NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON}
           Anc_2.292 YIL091C
          Length = 723

 Score =  939 bits (2426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/719 (64%), Positives = 564/719 (78%), Gaps = 17/719 (2%)

Query: 15  GYRKRGRQELRKIKRSSVRRTKDESVNEVDHVADEIVHSTGEDKISDIGSEEDNLXXXXX 74
           G +KRGRQELR I+RS+  +   + V     V DE      E ++++    E        
Sbjct: 13  GSKKRGRQELRTIRRSAGAKVSSQEVFNSSIVDDE------EQELNESNESE-QEEDIDE 65

Query: 75  XXXXXXXYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNE--NVNVEYEPVDEQLEI 132
                  Y ALLTILKSEHPE K++K +  +D+K+  +  G+E  + + + + +DE  +I
Sbjct: 66  EEKKNKVYGALLTILKSEHPELKKKKKKRVDDSKSG-EDKGSELASDDGKDDEIDEAQQI 124

Query: 133 ENGLL----GXXXXXXXXXXXXXXXXXXXXXXXQDPFESHFNQVSEKYVDDLSNAFKSKS 188
           E+GL     G                       QDPFESHFNQVSEK  DDL+ AF + S
Sbjct: 125 EDGLARGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAFNTGS 184

Query: 189 IKYKSVKASLGDDESYIYAKPFMVGEEALVE---SPYRSSSIYSYFLKQRLKVQNGLLDK 245
           +KYKS K+ +GD+++ I + P ++G+E   E   S  +SSSI+SYFLKQRL+V N +LD 
Sbjct: 185 VKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVANDMLDS 244

Query: 246 KIDPLTCMQKKLIDPMFQYKDILXXXXXXXXXXXXXRDLYALHVLNHIYKTRDRILKNNQ 305
           K DPL  +QK+L+DPMFQY+DIL             RDLYALH LNH+YKTRDRILK+N 
Sbjct: 245 KKDPLGPLQKELVDPMFQYRDILCEYSSYEKDEDEYRDLYALHALNHVYKTRDRILKDNG 304

Query: 306 RLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDS 365
           RLQDN DTE+ DQGFTRPKVLIVVPTR+ AY V+ KIISKSG+DQVDKKGKF DQF D++
Sbjct: 305 RLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQFHDET 364

Query: 366 LPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTD 425
           LPP SKPKSFQHIFKGNT+DFFV+G+KFTRKAIKLYSNFYQSDII+CSPLG+QMI+ENTD
Sbjct: 365 LPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTD 424

Query: 426 KKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRMWYINE 485
           KK RQDDFLSSIE+++IDQLHSIEYQN++H+FTIFDH+NKIP+QQHEADFSRIRMWYIN+
Sbjct: 425 KKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMWYIND 484

Query: 486 QAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKVRQIFQR 545
           QA+LFRQTM+FTKY++PAAN+LIN RC N AGRWKNH++I  E+S+I QLGLKV+Q FQR
Sbjct: 485 QARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQTFQR 544

Query: 546 FDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYMKEKTTI 605
           FD++G S+I+EPDYRFK F+SVIIPSIVKS  Y DGIL+YIPDYTD++RIRNY+KEKTT+
Sbjct: 545 FDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKTTL 604

Query: 606 LFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEF 665
           LFGDINEYS QR+LN+NRSLFQQGR+KV+LYTERLHHYRRYE+KGVKSVVFYKPP NPEF
Sbjct: 605 LFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPTNPEF 664

Query: 666 YNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEVYEFK 724
           YNE VR+IGK+AFLGN DLNISTVR +Y KLDGLSLERIVG+KRA +L HAQ EVYEF+
Sbjct: 665 YNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVYEFQ 723

>KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2.292
           YIL091C
          Length = 728

 Score =  931 bits (2405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/728 (64%), Positives = 560/728 (76%), Gaps = 22/728 (3%)

Query: 11  DHFRGYRKRGRQELRKIKRSSVRRTKDESVNEVDHVADEIVHSTGEDKIS-----DIGSE 65
           D + G RKRGR+ELR I+R+  R+ +D   N       E      E+  S     D+G E
Sbjct: 9   DGYDGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAANGDDVGDE 68

Query: 66  EDNLXXXXXXXXXXXXYDALLTILKSEHPEPKRRKTQADE----DNKAAAKPAGNENVNV 121
             +             Y ALLTILKSEHPEPK++K +       DN+   +   +E    
Sbjct: 69  VGDEASDDEEEMKKQVYGALLTILKSEHPEPKKQKKEKVNKVLLDNEQQDESDASEEEED 128

Query: 122 EYEPVDEQLEIENGLLGXXXXXXXXXXXXXX-XXXXXXXXXQDPFESHFNQVSEKYVDDL 180
           E +      +IEN L+G                        QDPFE+HFN V EK+ D L
Sbjct: 129 ETQ------QIENALMGSHADDASEDDDKEHGDDNEESDEEQDPFETHFNSVDEKFTDKL 182

Query: 181 SNAFKSKSIKYKSVKASLGDDESYIYAKPFMVGEEALVESPYR----SSSIYSYFLKQRL 236
             +FK+  IKYKS K  + +DE  I++KP +  +E  +ESP       SSI+SYFLKQRL
Sbjct: 183 DVSFKNNDIKYKSTKLPISEDEYAIFSKPVIKSDE--IESPVELSVNKSSIHSYFLKQRL 240

Query: 237 KVQNGLLDKKIDPLTCMQKKLIDPMFQYKDILXXXXXXXXXXXXXRDLYALHVLNHIYKT 296
           K+QN L+D K+DPLT +QK+L+DPMFQYKDIL             RDLY+LHVLNH+YKT
Sbjct: 241 KMQNNLMDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKT 300

Query: 297 RDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGK 356
           RD+ILKNNQRLQDN DTE LDQGFTRPKVLIVVPTR+ AY+V++KII+KSGIDQVDKKGK
Sbjct: 301 RDKILKNNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGK 360

Query: 357 FYDQFRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLG 416
           F DQF +DSLPP SKPKSFQ IFKGNT+DFFV+G+KFTRKAIKLYSNFYQSDIIICSPLG
Sbjct: 361 FKDQFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLG 420

Query: 417 IQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFS 476
           IQMILENTDKKKRQDDFLSSIELM+IDQLHSIEYQNISH+FTI +HINKIP +QH+ADFS
Sbjct: 421 IQMILENTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFS 480

Query: 477 RIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLG 536
           R+RMWYIN+QAKLFRQTM+FTKYISP ANSL+NG+C N +GRWKNHKVI + SSSI ++G
Sbjct: 481 RVRMWYINDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVG 540

Query: 537 LKVRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIR 596
           +K+RQIFQRF+ +  S+++EPDYRFKFFTSV +P+IVK+ GYEDG L+YIP+YTD+IR+R
Sbjct: 541 IKIRQIFQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVR 600

Query: 597 NYMKEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVF 656
           NY+K+KTTILFGDINEYS+Q+QLN+NRSLFQQGR+KV+LYTERLHHYRRYEIKGVK+VVF
Sbjct: 601 NYLKDKTTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVF 660

Query: 657 YKPPNNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHA 716
           Y+PP NPEFY E VR+IGKNAFLGNTDLNISTVRC+YSKLD LSLE IVG+KRA VL HA
Sbjct: 661 YQPPKNPEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHA 720

Query: 717 QKEVYEFK 724
           Q EVYEFK
Sbjct: 721 QNEVYEFK 728

>KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.292
           YIL091C
          Length = 721

 Score =  911 bits (2354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/716 (62%), Positives = 545/716 (76%), Gaps = 10/716 (1%)

Query: 18  KRGRQELRKIKRSSVRRTKDESVNEVDHVADEIVHSTGEDKISDIGSEEDNLXXXXXXXX 77
           KRGR+ELR +KR++ R   D+   E   V D+ V    +       +E+ +         
Sbjct: 7   KRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVSDSAEDGDGSDSDAEAR 66

Query: 78  XXXXYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNENVNVEYEPVDEQLEIENGLL 137
               Y ALLTILKSEHPE K+RKT+   D     K   +++ + E E  +E+ +I+N +L
Sbjct: 67  KGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHEELEEENEEEQIDNAIL 126

Query: 138 GXXXXXXXXXXXXXXXXXXXXXXXQDPFESHFNQVSEKYVDDLSNAFKSKSIKYKSVKAS 197
                                   QDPFESHFNQ  E  ++ L  AFKSK ++Y+SVK  
Sbjct: 127 DNRTQSDSEDEQDVAAEEFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQLQYRSVKLQ 186

Query: 198 LGD-----DESYIYAKPFMVG----EEALVESPYRSSSIYSYFLKQRLKVQNGLLDKKID 248
                   DE  IY++P + G     + L+ES  + S I SYFLK+RLK+QN LL+ K D
Sbjct: 187 PAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCS-IGSYFLKKRLKIQNDLLENKPD 245

Query: 249 PLTCMQKKLIDPMFQYKDILXXXXXXXXXXXXXRDLYALHVLNHIYKTRDRILKNNQRLQ 308
            L  +QK+L+DPMFQYKDIL             R LYALH LNH+YKTRDRILKNNQRLQ
Sbjct: 246 NLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILKNNQRLQ 305

Query: 309 DNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPP 368
           +N DTE LDQGFTRPKVLI+ PTR+ AY +V  II+KSGIDQVDK+GKF DQF +DSLPP
Sbjct: 306 ENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFYEDSLPP 365

Query: 369 ESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKK 428
            SKPKSFQ IFKGNT+DFFV+G+KFTRKAIKLYSNFYQSDII+CSPLG+QMI+ENTDKKK
Sbjct: 366 SSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKK 425

Query: 429 RQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRMWYINEQAK 488
           RQDDFLSSIE+ +IDQLHSIEYQNISH++TIF+H+N IPD+QH+ADFSRIRMWYIN+QA+
Sbjct: 426 RQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWYINDQAR 485

Query: 489 LFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKVRQIFQRFDI 548
            FRQTMVFTKYISP ANS+ING+C N +GRWKNH+++ +E+S IG+L L+VRQIFQRF++
Sbjct: 486 FFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIFQRFEV 545

Query: 549 IGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYMKEKTTILFG 608
            G SI++EPDYRFKFFTSVIIP I+KS GYEDGIL+YIP+YTD++R+RNY+KEKT ILFG
Sbjct: 546 TGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKTRILFG 605

Query: 609 DINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNE 668
           DINEYS+Q+QL ANRSLFQQGRLKV+LYTERLHHYRRYEIKGVKSV+FYKPP++PEFY E
Sbjct: 606 DINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPEFYTE 665

Query: 669 TVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEVYEFK 724
            VR IG+NAFLGNTDLNISTVRCIYSKLD L+LE +VGT+RA VL H Q E+YEFK
Sbjct: 666 VVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYEFK 721

>SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 718

 Score =  908 bits (2347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/733 (62%), Positives = 549/733 (74%), Gaps = 24/733 (3%)

Query: 1   MNGESVREKNDHFRG----YRKRGRQELRKIKRSSVRR---TKDESVNEVDHVADEIVHS 53
           MN  S R   D   G     +K GR+ELR I R++ R    +KD+  NE D        S
Sbjct: 1   MNNVSKRSNRDESHGGYKKAKKTGRKELRTITRANARHANESKDDFENEPDM-------S 53

Query: 54  TGEDKISDIGSEEDNLXXXXXXXXXXXXYDALLTILKSEHPEPKRRKTQADEDNKAAAKP 113
           + E++++D     D              Y+ALLT+L+SEHP  K +K +     +   + 
Sbjct: 54  SEEEELADNKPRSDEEEEEDIETKKQKVYNALLTLLESEHPHKKSKKNR-----EGGKEK 108

Query: 114 AGNENVNVE-YEPVDEQLEIENGLLGXXXXXXXXXXXXXXXXXXXXXXXQDPFESHFNQV 172
            GN    VE Y   DE+  IEN L+                         D FE HFN V
Sbjct: 109 QGNLQEGVETYSDEDEEEAIENALV--ETNDDEDDVGSDINGDEDDEDKADSFELHFNNV 166

Query: 173 SEKYVDDLSNAFKSKSIKYKSVKASLGDDESYIYAKPFMVGEE-ALVESPYRSSSIYSYF 231
           SE     L++AF+ K I+YKSVK  + +DE +IY++P + GE+ + V +P    S++SYF
Sbjct: 167 SELQATKLASAFRDKKIRYKSVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSCKKSLHSYF 226

Query: 232 LKQRLKVQNGLLDKKIDPLTCMQKKLIDPMFQYKDILXXXXXXXXXXXXXRDLYALHVLN 291
           +KQ+LK+QN LLD K + L  +QK L+DPMFQY+D+L             RDLYALHVLN
Sbjct: 227 IKQKLKIQNNLLDDKKEALAPLQKNLVDPMFQYQDLLYEYRSYEQEEEY-RDLYALHVLN 285

Query: 292 HIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQV 351
           H+YKTRDRIL+N+Q+LQDN D E LDQGFTRPKVLIVVPTR+VAY++V KII KSG+DQV
Sbjct: 286 HVYKTRDRILRNSQKLQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQV 345

Query: 352 DKKGKFYDQFRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIII 411
           DK+GKF DQF D SLPP SKPKSF+HIFKGNT+DFFV+G KFTRK +KLYSNFYQSD+I 
Sbjct: 346 DKRGKFQDQFFDASLPPSSKPKSFKHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIF 405

Query: 412 CSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQH 471
           CSPLGIQ+ILENTDKKKRQDDFLSSIELMVIDQLHSIEYQN+SHI TIF HINKIP QQH
Sbjct: 406 CSPLGIQLILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQH 465

Query: 472 EADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSS 531
           +ADFSRIRMWYINEQA LFRQTMVFTKY SP ANSLING+C N AGRWKNH ++  E SS
Sbjct: 466 DADFSRIRMWYINEQATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSS 525

Query: 532 IGQLGLKVRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTD 591
           I QLGLKVRQIFQRFD++G S ++EPDYRFKFFTSVII SI+KS GYEDGIL+YIPDYTD
Sbjct: 526 INQLGLKVRQIFQRFDLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTD 585

Query: 592 FIRIRNYMKEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGV 651
           ++R+RN+++EKTT+LFGDINEYS Q+QL +NR+LFQQG++KV+LYTERLHH+RRYEIKGV
Sbjct: 586 YVRVRNHLREKTTLLFGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGV 645

Query: 652 KSVVFYKPPNNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAA 711
           KSV+FYKPP NPEFY E VR+IGK+AFLG+ DLNISTVRC+Y KLDGLSLER+VGTKRAA
Sbjct: 646 KSVIFYKPPTNPEFYREVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAA 705

Query: 712 VLSHAQKEVYEFK 724
           VL+H Q E+YEFK
Sbjct: 706 VLTHGQNEIYEFK 718

>TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa]
           {ON} Anc_2.292 YIL091C
          Length = 719

 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/728 (60%), Positives = 551/728 (75%), Gaps = 23/728 (3%)

Query: 7   REKNDHFRGYRKRGRQELRKIKRSS-VRRTKDESVNEV-----DHVADEIVHSTGEDKIS 60
           + +N++  GY KRGR + R IK+SS  +R K E    V     D  +DE V +T  DK +
Sbjct: 5   KPQNNYSEGYGKRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDESSDEDVSNTSIDKEA 64

Query: 61  DIGSEEDNLXXXXXXXXXXXXYDALLTILKSEHPEPKRRKTQADEDNKAAAKP-AGNENV 119
           ++  +                YDAL+TILKSEH EPK R    D  N+ + +    +E++
Sbjct: 65  EVTED---------LEKKKQVYDALVTILKSEHKEPKMR----DNLNETSKEEHLTDEDL 111

Query: 120 NVEYEPVDEQLEIENGLLGXXXXXXXXXXXXXXXXXX--XXXXXQDPFESHFNQVSEKYV 177
           + + +   E+ EIEN LL                           DPF+SHFNQ +E++ 
Sbjct: 112 DEDEKFETEEQEIENNLLSIKDDEEEGENNDDNAGESDDESDNKSDPFDSHFNQPTEQFT 171

Query: 178 DDLSNAFKSKSIKYKSVKASLGDDESYIYAKP-FMVGEEALVESPYRSSSIYSYFLKQRL 236
           +  ++AFK+K IKY+S+K  + + ES IY++P  +  E+  V+SP   SSI+SY LK+RL
Sbjct: 172 NKFADAFKNKQIKYRSIKYKINEYESSIYSEPRILEDEQTKVKSPVLKSSIHSYALKKRL 231

Query: 237 KVQNGLLDKKIDPLTCMQKKLIDPMFQYKDILXXXXXXXXXXXXXRDLYALHVLNHIYKT 296
           K+ N LLD  ++ LT +QK+L+DPMFQYKDIL             R LY LHVLNHIYKT
Sbjct: 232 KINNDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKT 291

Query: 297 RDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGK 356
           RDRILKNN ++QDNPD E LDQGFTRPKVLIV PTR+  Y +V++II KSGIDQ+DKK K
Sbjct: 292 RDRILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSK 351

Query: 357 FYDQFRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLG 416
           F DQF ++SL P SKPKSFQ +FKGN++D+FV+G+KFTRKAIKLYSNFYQSDII+CSPLG
Sbjct: 352 FRDQFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLG 411

Query: 417 IQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFS 476
           + MILENTDKKKRQDDFLSSIELM+IDQLHS+E+QNISH+ +IF+HINKIP +QH+ DFS
Sbjct: 412 LHMILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFS 471

Query: 477 RIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLG 536
           RI+MWYIN+QAKLFRQTM+FTKYISP+AN  +NG+C N +GRWKNHK+I    SSIGQLG
Sbjct: 472 RIKMWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLG 531

Query: 537 LKVRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIR 596
           L+V+Q+F RFDIIG SI++EPDYRFK+FTSVI+ SI KS  YEDG+L+YI DYTD++R+R
Sbjct: 532 LRVKQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVR 591

Query: 597 NYMKEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVF 656
           NY+KEKTTILFGDINEYS+Q+Q+N+NR+LFQQ R+KV+LYTERLHH+RRYEIKGVK++VF
Sbjct: 592 NYLKEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVF 651

Query: 657 YKPPNNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHA 716
           YK P NPEFYNE VR+IGKNAF GNTD+NIS VR IYSKLDGL+LERI+GTKRAAVL+H 
Sbjct: 652 YKAPTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHG 711

Query: 717 QKEVYEFK 724
           Q E YEFK
Sbjct: 712 QNETYEFK 719

>TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {ON}
           Anc_2.292 YIL091C
          Length = 710

 Score =  886 bits (2289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/728 (61%), Positives = 539/728 (74%), Gaps = 29/728 (3%)

Query: 2   NGESVREKNDHFRGYRKRGRQELRKIKRSSVRRTKDESVNEVDHVADEIV-HSTG---ED 57
           NG+  R       G  KRGR+ELR I+R    +  +E  +  +    E+  H  G    +
Sbjct: 7   NGDEARRN-----GTLKRGRKELRSIRRPQRNKAHEEPEHLNESSEGEVKNHHNGMQHNE 61

Query: 58  KISDIGSEEDNLXXXXXXXXXXXXYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNE 117
           +I+++  +E+N             Y ALLTIL SEHP+PK ++    +  K  ++    E
Sbjct: 62  EIANVEEDEEN--------KRRKVYGALLTILNSEHPKPKPKQEVTVQSRKEDSESDVEE 113

Query: 118 NVNVEYEPVDEQLEIENGLLGXXXXXXXXXXXXXXXXXXXXXXXQDPFESHFNQVSEKYV 177
           +   E E +++ L                               QD F+SHFNQV E  V
Sbjct: 114 DERDEVEQLEDNL--------ARVDENPSEDDLSEDADEESDDEQDTFDSHFNQVPENVV 165

Query: 178 DDLSNAFKSKSIKYKSVKASLGDDESYIYAKPFMVGEEAL-VESPYRSSSIYSYFLKQRL 236
           D L  AFK + +KYKS K  +G++ES +Y+KP ++ +++  +E P R  S+ SY  KQRL
Sbjct: 166 DKLDAAFKERQLKYKSAKVPIGENESMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQRL 225

Query: 237 KVQNGLLDKKIDPLTCMQKKLIDPMFQYKDILXXXXXXXXXXXXXRDLYALHVLNHIYKT 296
           K+QN L   + + LT  Q+ L+DPM QY D+L             RDLYALHVLNH+YKT
Sbjct: 226 KIQNDL---EHENLTSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKT 282

Query: 297 RDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGK 356
           RD+ILKNNQR+ DNPD ++LDQGFTRPKVLIVVPTR+ AY+V++KII KSGIDQ+DKKGK
Sbjct: 283 RDKILKNNQRISDNPDADYLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGK 342

Query: 357 FYDQFRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLG 416
           F DQF ++SLPP SKPKSFQH+FKGNT+DFFV+G+KFTRKAIKLYSNFYQSDIIICSPLG
Sbjct: 343 FRDQFFEESLPPSSKPKSFQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLG 402

Query: 417 IQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFS 476
           IQ+ILENTDKKKRQDDFLSSIE+ + DQLHSIEYQN+SH+ TIFDH+N IP +QH+ DF 
Sbjct: 403 IQLILENTDKKKRQDDFLSSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFG 462

Query: 477 RIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLG 536
           R+R+WYINEQAKLFRQTM+FTKY+SP AN+LIN +C NM GRWKNH  I    SSIG+LG
Sbjct: 463 RVRLWYINEQAKLFRQTMIFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLG 522

Query: 537 LKVRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIR 596
           LKVRQIFQR D+   SI+EE D+RFKFFTSVIIPSI+KS GYEDGILVYIPDY DFIR+R
Sbjct: 523 LKVRQIFQRIDLGAASILEESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVR 582

Query: 597 NYMKEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVF 656
           NYMKEKTTI+FGDINEYSNQ+QLN+NR+LFQQGR KV+LYTERLHH+RRYEIKGVKSVVF
Sbjct: 583 NYMKEKTTIIFGDINEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVF 642

Query: 657 YKPPNNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHA 716
           Y+PP NPEFY+E VRFI K+A LG TDLNISTVR IYSKLDG+SLERIVGTKRAA+L+H 
Sbjct: 643 YQPPTNPEFYSEVVRFIAKSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHG 702

Query: 717 QKEVYEFK 724
           Q EVYEFK
Sbjct: 703 QNEVYEFK 710

>KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 704

 Score =  872 bits (2253), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/714 (61%), Positives = 537/714 (75%), Gaps = 17/714 (2%)

Query: 14  RGYRKRGRQELRKIKRSSVRRTK-DESVNEVDHVADEIVHSTGEDKISDIGSEEDNLXXX 72
           R   K GR++LR+I R+  +R + D+     D   D    S  ++    + +E +++   
Sbjct: 5   RAGPKSGRKQLREITRAGQKRVRYDDEATVADLTPDN--ESDSDNAEPSVAAEREDVEQH 62

Query: 73  XXXXXXXXXYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNENVNVEYEPVDEQLEI 132
                    Y+ALLT+LKSEHPE K +  +  + +   A+    EN  +  E  DEQ  I
Sbjct: 63  RGQA-----YNALLTLLKSEHPERKHKSNKKIKKDSQRAEEDSPENDGINSE--DEQQNI 115

Query: 133 ENGLLGXXXXXXXXXXXXXXXXXXXXXXXQ-DPFESHFNQVSEKYVDDLSNAFKSKSIKY 191
           EN L                         + DPFESHF++ SE  +      FK K++KY
Sbjct: 116 ENALDDVSGGVVDEEDMEDSLSDVDESEDESDPFESHFSKYSESRLYAFDKGFKDKTVKY 175

Query: 192 KSVKASLGDDESYIYAKPFMVGEEALVESPYRS-SSIYSYFLKQRLKVQNGLLDKKIDPL 250
           KS K  + ++ES IY+KP +  EE L   P +   ++ SYF+KQ+LK+ N   +  + PL
Sbjct: 176 KSSKTDVSEEESLIYSKPCLDDEEVL---PVKGKQTLSSYFIKQKLKLANDFQNNGL-PL 231

Query: 251 TCMQKKLIDPMFQYKDILXXXXXXXXXXXXXRDLYALHVLNHIYKTRDRILKNNQRLQDN 310
           T +QK+L+DPMFQYKD+L             RDLY+LH LNH+YKTRDRILKNNQ+LQ+N
Sbjct: 232 TEIQKELVDPMFQYKDMLYEYDDYADEDQY-RDLYSLHALNHVYKTRDRILKNNQKLQEN 290

Query: 311 PDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPES 370
            D E LDQGFTRPKVLIVVPTR+ A+++V KI+ KSG+DQ DKK KF DQF +DSLPP S
Sbjct: 291 NDEELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTS 350

Query: 371 KPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQ 430
           KPKSFQHIF+GNT+DFFV+GLKFTRK++K+YSNFYQSDIIICSPLGIQ+ILENTDKKKRQ
Sbjct: 351 KPKSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQ 410

Query: 431 DDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRMWYINEQAKLF 490
           DDFLSSIE+M+IDQLHSIEYQN  H+ TIF HINKIP+QQ EADFSRIRMWYINEQAK F
Sbjct: 411 DDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFF 470

Query: 491 RQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKVRQIFQRFDIIG 550
           RQT+VFTKYISP ANS++NG+C N+AGRWKNH+ I  E SSIGQLGLKVRQIFQRFD+ G
Sbjct: 471 RQTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAG 530

Query: 551 NSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYMKEKTTILFGDI 610
            + ++EPDYRFKFFTSVI+PSIVKS GYEDGIL+YIPDYTDFIR+RNY+KEKTTI+FG+I
Sbjct: 531 GTALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEI 590

Query: 611 NEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNETV 670
           NEYSNQ+QL +NR+ FQ G++KV+LYTERLHH+RRYEIK VKSV+FYKPP NPEFY+E V
Sbjct: 591 NEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVV 650

Query: 671 RFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEVYEFK 724
           R IGKN FLGN D+NISTVRCIYSK+DGLSLER+VG+KRAAVL+H Q EVYEFK
Sbjct: 651 RNIGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704

>Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa]
           {ON} complement(138925..141039) [2115 nt, 705 aa]
          Length = 704

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/563 (71%), Positives = 486/563 (86%), Gaps = 1/563 (0%)

Query: 163 DPFESHFNQVSEKYVDDLSNAFKSKSIKYKSVKASLGDDESYIYAKPFMVGEE-ALVESP 221
           D FESHFN VS+  VDD+S  FK K IKYKS+K SL   ES I+ KP ++ ++   +++P
Sbjct: 142 DTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKYSLDKKESAIFGKPLLLTQQDETIDNP 201

Query: 222 YRSSSIYSYFLKQRLKVQNGLLDKKIDPLTCMQKKLIDPMFQYKDILXXXXXXXXXXXXX 281
             +SS  SYF+KQRLK+QN LLD   + LT ++KKL+DPMFQYKD+L             
Sbjct: 202 VLTSSYDSYFIKQRLKIQNDLLDSSKENLTPLKKKLLDPMFQYKDVLCEYTNYENDEKEY 261

Query: 282 RDLYALHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDK 341
           R+LY+LHVLNHIYKTRD+ILK+NQRLQ+N D E LDQGFTRPKVLIVVPTR+ AY+VV+ 
Sbjct: 262 RELYSLHVLNHIYKTRDKILKDNQRLQENDDLECLDQGFTRPKVLIVVPTRDTAYQVVET 321

Query: 342 IISKSGIDQVDKKGKFYDQFRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLY 401
           II KSG+DQ+DKKGKF DQF DDSLPP SKPKSF+H+FKGNT+DFFV+G+KFTRKAIKLY
Sbjct: 322 IIEKSGLDQIDKKGKFKDQFFDDSLPPTSKPKSFRHVFKGNTNDFFVLGMKFTRKAIKLY 381

Query: 402 SNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFD 461
           SNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIE+M++DQLHSIEYQNISH++TI +
Sbjct: 382 SNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIEVMIVDQLHSIEYQNISHVYTILE 441

Query: 462 HINKIPDQQHEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKN 521
           HINKIP QQ EADFSRIRMWYIN+QAK  RQTM+FT+YISP AN++ING+C NMAGRWKN
Sbjct: 442 HINKIPQQQREADFSRIRMWYINDQAKFLRQTMLFTRYISPTANAIINGKCHNMAGRWKN 501

Query: 522 HKVIGSESSSIGQLGLKVRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDG 581
           +++I SE SSIGQLG+K++QIFQRFD++G ++++E DYRFK+FTSV++ +IVKS GYEDG
Sbjct: 502 NQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVDESDYRFKYFTSVVMQNIVKSTGYEDG 561

Query: 582 ILVYIPDYTDFIRIRNYMKEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLH 641
           ILVYIP+YTD++R+RNYMKEKTTILF +INEYS Q+QL++NRS+FQQGR KV+LYTERLH
Sbjct: 562 ILVYIPEYTDYMRLRNYMKEKTTILFSEINEYSTQKQLDSNRSMFQQGRTKVLLYTERLH 621

Query: 642 HYRRYEIKGVKSVVFYKPPNNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSL 701
           HYRRYE+KG+KSV+FYKPP NPEFYNE +RF  KNAFLG +D+NIST+R +YSKLDGL+L
Sbjct: 622 HYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAKNAFLGKSDINISTIRTVYSKLDGLAL 681

Query: 702 ERIVGTKRAAVLSHAQKEVYEFK 724
           +RIVG+KRAA+L H Q E Y+FK
Sbjct: 682 QRIVGSKRAAILCHGQNESYDFK 704

>KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 747

 Score =  865 bits (2236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/738 (59%), Positives = 535/738 (72%), Gaps = 42/738 (5%)

Query: 18  KRGRQELRKIKRSSV--RRTKDESVNEVDHVADEIVHSTGEDKISDIGSEEDNLXXXXXX 75
           K GR++LR I+++S   R   +ES NE ++ ++    +  EDK++     E         
Sbjct: 21  KSGRKQLRTIRKASGPRRGLAEESANEENNGSE----TEAEDKLAAPELNE----PAQDQ 72

Query: 76  XXXXXXYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNENVNVEYEPVDEQ------ 129
                 Y ALLT+LK+EH  P RRKT+ D D K +A P  N     E E  D +      
Sbjct: 73  RAGGEAYAALLTLLKAEHGGPARRKTKTD-DKKTSADPTSNVKDEEESESRDNEDEEEDE 131

Query: 130 ---LEIENGLLGXXXXXXXXXX-------------------XXXXXXXXXXXXXQDPFES 167
                IEN L+                                            D  E 
Sbjct: 132 DEEAAIENALMDEHTSGDEDDEGDDGSHQDDINGVTREGGDATELAAGFEEEDKPDTLEI 191

Query: 168 HFNQVSEKYVDDLSNAFKSKSIKYKSVKASLGDDESYIYAKPFMVGEEA-LVESPYRSSS 226
           HFN VSEK  + L  AFK+K ++Y+S K  +  ++ +IY++P +V E A  V +P  S S
Sbjct: 192 HFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEPASAVSAPDGSQS 251

Query: 227 IYSYFLKQRLKVQNGLLDKKIDPLTCMQKKLIDPMFQYKDILXXXXXXXXXXXXXRDLYA 286
           + SYF+KQRLK+QN LLD + D LT +QK+++DPMFQY+D+L             RDLYA
Sbjct: 252 LNSYFIKQRLKIQNDLLDSQ-DKLTPLQKQIVDPMFQYQDLLYEYEDYDKETEY-RDLYA 309

Query: 287 LHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKS 346
           LHVLNHIYKTRDRILKNNQRLQ+NPD E LDQGFTRPKVLIV PTR+ AY ++ KII KS
Sbjct: 310 LHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAAYDILSKIIQKS 369

Query: 347 GIDQVDKKGKFYDQFRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQ 406
           G+DQVDKK KF DQF  ++LPP  KPKSFQ +FKGNT+DFFV+G KFTRK IKLYSNFYQ
Sbjct: 370 GLDQVDKKAKFKDQFFQEALPPSYKPKSFQQLFKGNTNDFFVLGAKFTRKTIKLYSNFYQ 429

Query: 407 SDIIICSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKI 466
           SDIIICSPLGIQ+ILENTDKKKRQDDFLSSIEL+V+DQLHSIE+QN+ H+ +IF+HINKI
Sbjct: 430 SDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLHLTSIFEHINKI 489

Query: 467 PDQQHEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIG 526
           P QQH+ADFSRI+MWYIN+QAKLFRQT++FTK+ SP ANSLING+C N AGRWKNH+VI 
Sbjct: 490 PQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNYAGRWKNHRVIF 549

Query: 527 SESSSIGQLGLKVRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYI 586
            E+SS+GQLG++ R IFQRFD++G S+ EEPD RFK F SVI+P+IVKS GYEDGIL+YI
Sbjct: 550 PENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKSTGYEDGILLYI 609

Query: 587 PDYTDFIRIRNYMKEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRY 646
           PDYTDF+R+RNY++EKTTILFGDINEYS QRQL +NR++FQQGR+KV+LYTERLHH+RRY
Sbjct: 610 PDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLLYTERLHHFRRY 669

Query: 647 EIKGVKSVVFYKPPNNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVG 706
           EIKGVK+V+FYKPP NPEF+ E  R++GK+AFLG  DLNIS VRC++SKLDGLSLERIVG
Sbjct: 670 EIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSKLDGLSLERIVG 729

Query: 707 TKRAAVLSHAQKEVYEFK 724
           T+RAAVL+H   E YEFK
Sbjct: 730 TERAAVLTHGPNETYEFK 747

>TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.292
           YIL091C
          Length = 716

 Score =  860 bits (2221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/725 (60%), Positives = 546/725 (75%), Gaps = 26/725 (3%)

Query: 14  RG-YRKRGRQELRKIKRSSVRRTKDESVN--------EVDHVADEIVHSTGEDKISDIGS 64
           RG ++KRGR +LR I+RS   + ++   N        +    AD +V     +  SD   
Sbjct: 4   RGEFKKRGRSQLRTIQRSKYAKKRNSGRNYDTNTKHNDESKPADALVSGEEAESESDDAK 63

Query: 65  EEDNLXXXXXXXXXXXXYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNENVNVEYE 124
           +E+++            Y ALLTILKSEHPE K++K + +++ + A   + +E     Y 
Sbjct: 64  DEEDVGKKRNQV-----YGALLTILKSEHPEKKKQKKKFNQEKEDAYNASDDE-----YN 113

Query: 125 PVDEQLEIENGLLGXXXXXXXXXXXXXXXXXXXXXXXQDP--FESHFNQVSEKYVDDLSN 182
             D+Q EIENGL                          D   F+ HFNQV E  VD +SN
Sbjct: 114 VSDKQ-EIENGLEDQQDDNEDENENDMENMENDDESDDDTDLFDIHFNQVPENVVDKISN 172

Query: 183 AFKSKSIKYKSVKASLGDDES--YIYAKPFMV-GEEALVESPYRSSSIYSYFLKQRLKVQ 239
            F +K IKY S K  L   E   +IY+KP +  G +  VESP + SS+ SYF+K+RL++ 
Sbjct: 173 GFDNKKIKYVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESPIKKSSLDSYFIKKRLEIT 232

Query: 240 NGLLDKKIDPLTCMQKKLIDPMFQYKDILXXXXXXXXXXXXXRDLYALHVLNHIYKTRDR 299
           N LLD K D LT +QK L+DPMFQY DIL             R+LY LH+LNH+YKTRD+
Sbjct: 233 NNLLDGK-DNLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRDK 291

Query: 300 ILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYD 359
           +LK+NQRLQ+N ++E LDQGFTRPKVLIVVPTR+ AY VV+ II KSG+DQV+KKGKF  
Sbjct: 292 VLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFKS 351

Query: 360 QFRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQM 419
           QF +DSLPP SKPKSFQ IFKGNT+DFFV+GLKFTRKA+KLYSNFYQSD+IICSPLG+ M
Sbjct: 352 QFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICSPLGLHM 411

Query: 420 ILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIR 479
           I ENTDKKK+QDDFLSSIE+ ++DQLHS+EYQNISHI  IF+H+NKIP +QH+ADFSRIR
Sbjct: 412 ITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLNKIPREQHDADFSRIR 471

Query: 480 MWYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKV 539
           MWYIN+QA+LFRQTM+FTKY+SP AN++ING+C N+AGRW+N   + SE SS+G+LGLK+
Sbjct: 472 MWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLKI 531

Query: 540 RQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYM 599
           RQIFQRFD++G ++ +EPD+RFKFF SV++ SI+KS GYEDGILVYIP+Y+D++R+RNYM
Sbjct: 532 RQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSDYMRVRNYM 591

Query: 600 KEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKP 659
           KEKTT+LFGDINEYS+QR+LN+NRSLFQQGR+KV+LYTERLHHYRRYEIKGVKSV+FY P
Sbjct: 592 KEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKSVIFYGP 651

Query: 660 PNNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKE 719
           P NPEFYNE VRFIGKNAFLGN D+NI+TVR +YSKLD LSLERIVGT+RAAVLS A+ E
Sbjct: 652 PTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAAVLSRAENE 711

Query: 720 VYEFK 724
           VYEFK
Sbjct: 712 VYEFK 716

>ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 709

 Score =  858 bits (2217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/724 (59%), Positives = 535/724 (73%), Gaps = 32/724 (4%)

Query: 10  NDHFRGYRKRGRQELRKIKRSSVRRTKDESVNEVD-HVADE----IVHSTGEDKISDIGS 64
            D   G RKRGR++LR I+R+   R   E V E +  VA E    +   + ED  +++  
Sbjct: 9   TDAIDGSRKRGRKDLRSIRRA---RNDKEPVEEPEIPVASEEDGELSEDSEEDATNEVQE 65

Query: 65  EEDNLXXXXXXXXXXXXYDALLTILKSEHPEPK---RRKTQADEDNKAAAKPAGNENVNV 121
           +ED+             Y ALLTILKSEHPE +   RRK + D  + +++    +E    
Sbjct: 66  QEDS---------KEKAYGALLTILKSEHPEDRQRERRKKKQDLQDPSSSDDELSE---- 112

Query: 122 EYEPVDEQLEIENGLLGX-XXXXXXXXXXXXXXXXXXXXXXQDPFESHFNQVSEKYVDDL 180
                DE+ E+E  L+                         +DPFESHFN  SE  +D L
Sbjct: 113 -----DEKGEVEANLVDTPGEEEPQSEEELSEGDEDESEDERDPFESHFNMQSES-IDSL 166

Query: 181 SNAFKSKSIKYKSVKASLGDDESYIYAKPFMVGEEALVESPYRSSSIYSYFLKQRLKVQN 240
             A+K K I  KS K  + DDES IY K  + G+    E P     + SY LK++LK+QN
Sbjct: 167 DEAWKQKKIVNKSGKIRVDDDESLIYTKT-LAGKGQEFELPSHKGHLSSYPLKRKLKIQN 225

Query: 241 GLLDKKIDPLTCMQKKLIDPMFQYKDILXXXXXXXXXXXXXRDLYALHVLNHIYKTRDRI 300
            LL+ + D LT +Q+K++DP+FQY+D+L             RDLY LHVLNHIYKTRDRI
Sbjct: 226 NLLESQDDVLTPLQRKIVDPIFQYRDLLYEYEDYEQDEDEYRDLYVLHVLNHIYKTRDRI 285

Query: 301 LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQ 360
           LK+NQRL  NPD E LDQGFTRPKVLIV PTR+ AY++V K+I KSG+DQVDKK K  DQ
Sbjct: 286 LKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKSKLRDQ 345

Query: 361 FRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQMI 420
           F +D LPP SKPKSF+H FKGNT+DFFV+G+KFTRKAI+LYSNFYQSD+I+CSPLG+Q+I
Sbjct: 346 FFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSPLGLQLI 405

Query: 421 LENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRM 480
           LENTD+KKRQDDFLSSIELM+IDQL+SIE+QN+SH+FTIF H+NKIP +QH+ DF R+RM
Sbjct: 406 LENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDTDFGRVRM 465

Query: 481 WYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKVR 540
           WYINEQAKL RQT++FT+Y++P AN L+NG+C N+ GRWKNH  I  E SS+ +LG +VR
Sbjct: 466 WYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVR 525

Query: 541 QIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYMK 600
           QIFQR D+ G S+++EPDYRF+FFTSVI+PSI KS GYEDGIL+YIPDY DFIR+RNY+K
Sbjct: 526 QIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILLYIPDYADFIRVRNYLK 585

Query: 601 EKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPP 660
           +KTTILFGDINEYS+ RQL + RSLFQQGR+KV+LYTERLHH+RRYEIKGVKSV+FY+PP
Sbjct: 586 DKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQPP 645

Query: 661 NNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEV 720
           +NPEFYNE VR+IGK+AFLG+TDLNISTVRC+YSKLDGL+LERIV +KRAAVL+H Q E+
Sbjct: 646 SNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLALERIVSSKRAAVLTHGQNEI 705

Query: 721 YEFK 724
           YEFK
Sbjct: 706 YEFK 709

>Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}
           similar to Ashbya gossypii ADL209C
          Length = 708

 Score =  848 bits (2190), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/713 (58%), Positives = 529/713 (74%), Gaps = 14/713 (1%)

Query: 18  KRGRQELRKIKRSSVRRTKDESVNEVDHVADEIVHSTGEDKISDIG-SEEDNLXXXXXXX 76
           KRGR++LRKI R    R++D++    +  A E   +   D+ ++I   E +         
Sbjct: 4   KRGRKQLRKITRIGRNRSEDKA----NGSALEKRGNNDGDEYAEIAMGEHEKAADDDQEE 59

Query: 77  XXXXXYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNENVNVEYEPVDEQLEIENGL 136
                Y ALL+IL S HPE +R++ + ++   A  +   N + N E    DE   I   L
Sbjct: 60  RTAHVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYE---TDEVATISASL 116

Query: 137 LGXXXXXXXXXXXXXXXXXXXXXXXQ-DPFESHFNQVSEKYVDDLSNAFKSKSIKYKSVK 195
                                    + DPFE HFNQ+SE   + L  AFK K+++Y+S K
Sbjct: 117 DDSVDKDEEVEEDDGVYSDGEDSEDERDPFEYHFNQISEMDTNKLDAAFKEKTVQYESTK 176

Query: 196 AS-LGDDESYIYAKPF---MVGEEALVESPYRSSSIYSYFLKQRLKVQNGLLDKKIDPLT 251
              + D+E +I++KP    + G +A+ ++P    +I+SYF+K++LKV NGLLD K  PLT
Sbjct: 177 LPYMHDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGLLDDKKKPLT 236

Query: 252 CMQKKLIDPMFQYKDILXXXXXXXXXXXXXRDLYALHVLNHIYKTRDRILKNNQRLQDNP 311
            + K L+DP+FQY+D+L             RDLY LH+LNHIYKTRDRILKNN +LQ+N 
Sbjct: 237 PLSKTLVDPIFQYRDLLFEYEDFSQETEY-RDLYTLHILNHIYKTRDRILKNNHKLQEND 295

Query: 312 DTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPESK 371
           D E LDQGFTRPKVL+V PTR  AY +++KII KSG+DQVDKK KF DQF +DSLPP SK
Sbjct: 296 DQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSK 355

Query: 372 PKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQD 431
           PKSFQH+FKGNT+DFFV+G+KFTRK +KLYSNFYQSD+I+CSPLGIQ+ILENTDKKKRQD
Sbjct: 356 PKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKRQD 415

Query: 432 DFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRMWYINEQAKLFR 491
           DFLSSIE++V+DQLHS+E+QN +H+ +IF HINKIP +QH++DFSRIRMWYIN+QA+LFR
Sbjct: 416 DFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFR 475

Query: 492 QTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKVRQIFQRFDIIGN 551
           QT++FTKY+SP ANSLING+CCN +GR+KN + I  E S+I QLGLKVRQ+F RFD+   
Sbjct: 476 QTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLFTG 535

Query: 552 SIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYMKEKTTILFGDIN 611
           S ++EPDYRFKFFTSV +P I KS GYEDGIL+YIPDYTDF+R+RNY K++T ILFG+I 
Sbjct: 536 SSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGEIT 595

Query: 612 EYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNETVR 671
           EYS+QRQ+ +NR+LFQQG++KV+LYTERLHH+RRY+IKGVKSV+FYKPP+NPEFY E +R
Sbjct: 596 EYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIR 655

Query: 672 FIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEVYEFK 724
            IGKNAFLGN DLNISTVRC Y KLD LSLERIVG+KRAAVL+ +Q E+YEFK
Sbjct: 656 CIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708

>CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091c
          Length = 700

 Score =  845 bits (2182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/570 (67%), Positives = 475/570 (83%), Gaps = 7/570 (1%)

Query: 162 QDPFESHFN-QVSEKYVDDLSNAFKSKSIKYKSVKASLGD------DESYIYAKPFMVGE 214
           +DPF++HFN + + K+ + L NA K   ++YKS+K  +G        E  I++ P++ GE
Sbjct: 131 KDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYIEGE 190

Query: 215 EALVESPYRSSSIYSYFLKQRLKVQNGLLDKKIDPLTCMQKKLIDPMFQYKDILXXXXXX 274
              +E P    S+ SYFLK+RL++QN LLD + + LT +Q+K++DPM QYKDIL      
Sbjct: 191 TPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEYDTY 250

Query: 275 XXXXXXXRDLYALHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREV 334
                  RDLY LHVLNH+YKTRD+I+KNNQ+LQDNPD+E LDQGFTRPKVLI+ PTR+ 
Sbjct: 251 GKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRDS 310

Query: 335 AYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFT 394
           AY++V K+I KSG+DQVDKKGKF DQF D S PP SKPKSFQHIFKGNT+D+FV+G+KFT
Sbjct: 311 AYQIVTKLIEKSGLDQVDKKGKFRDQFYDPSFPPSSKPKSFQHIFKGNTNDYFVLGVKFT 370

Query: 395 RKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNIS 454
           RKAIKLYSNFYQSDII+CSPLG+QMI+ENTDKKKRQDDFLSS+E+ +IDQ HSIEYQN +
Sbjct: 371 RKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYT 430

Query: 455 HIFTIFDHINKIPDQQHEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCCN 514
           H+FTIFDH+NKIP +QH+ADFSRIRMWYIN+QAK FRQTM+FTKYISP ANSL+N +C N
Sbjct: 431 HLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIKCRN 490

Query: 515 MAGRWKNHKVIGSESSSIGQLGLKVRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVK 574
           + GRWKNHK++ SE SS+G +GLKVRQIFQRF+++GNS+ +EPDYRFKFFTSV+I +I K
Sbjct: 491 LEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISNITK 550

Query: 575 SVGYEDGILVYIPDYTDFIRIRNYMKEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVM 634
           S GY+DG L+YIP+Y+D++R+RNYMKEKT+ILFGDINEYS QR L +NR+LF QGRLKV+
Sbjct: 551 STGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVL 610

Query: 635 LYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYS 694
           LYTERLHH+RRYE+KGVK+VVFYKPP++PEFY E VR+IGK  FLG+ DLNISTVRC YS
Sbjct: 611 LYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYS 670

Query: 695 KLDGLSLERIVGTKRAAVLSHAQKEVYEFK 724
           KLDGL+LE+IVGTKR  VL+H Q E YEFK
Sbjct: 671 KLDGLALEKIVGTKRTGVLTHGQNETYEFK 700

>Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091C -
           Protein required for cell viability [contig 27] FULL
          Length = 727

 Score =  845 bits (2183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/743 (57%), Positives = 532/743 (71%), Gaps = 42/743 (5%)

Query: 5   SVREKNDHFR----GYRKRGRQELRKIKRSSVRRTKDESVNEVDHVADEIVHSTGEDKIS 60
           S R   DH R     + K GR++LR I+++S   +K      V+   +EI      +++ 
Sbjct: 4   SKRRYTDHDRHDGEKFTKGGRKQLRSIRKASRYDSKKPEDEPVETPEEEI------NEVE 57

Query: 61  DIGSEEDNLXXXXXXXXXXXXYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAG---NE 117
           D+   E+              Y ALLT+LK+EH   K+         K  A P G    E
Sbjct: 58  DV--HEERTEVSRKQESNGEAYAALLTLLKAEHGTGKK---------KVKAGPQGEGSGE 106

Query: 118 NVNVEYEPVDEQ-----------LEIENGLL----GXXXXXXXXXXXXXXXXXXXXXXXQ 162
           +   E  P  EQ             IENGL                              
Sbjct: 107 SQISEISPEAEQDEEEEEEEEEETAIENGLAEHLDSDGDEAAEIGDEEDDNNGDQDENAS 166

Query: 163 DPFESHFNQVSEKYVDDLSNAFKSKSIKYKSVKASLGDDESYIYAKPFM-VGEEALVESP 221
           DP E+HFN V EK  D L  AFK+K ++Y+S K  +  +E +IY++P + +     ++ P
Sbjct: 167 DPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQVP 226

Query: 222 YRSSSIYSYFLKQRLKVQNGLLDKKIDPLTCMQKKLIDPMFQYKDILXXXXXXXXXXXXX 281
             + S+  YF+KQRLK+QN LLD K + LT +QKK++DP+FQY+D+L             
Sbjct: 227 QGTQSLSPYFIKQRLKIQNDLLDSK-NNLTPLQKKIVDPIFQYQDLLYEYENYDQETEY- 284

Query: 282 RDLYALHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDK 341
           RDLYALH L+HIYKTRDRILKNNQRLQDNPD E LDQGFTRPKVLIVVPTR+VAY V+ K
Sbjct: 285 RDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSK 344

Query: 342 IISKSGIDQVDKKGKFYDQFRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLY 401
           II KSG+DQVDKK KF DQF  DSLPP+ KPKSFQ +FKGNT+DFFV+G KFTRK IKLY
Sbjct: 345 IIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLY 404

Query: 402 SNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFD 461
           SNFYQSDII+CSPLGIQ+ILENTDKKKRQDDFLSSIEL+VIDQLHSIE+QN+ H+ +IF+
Sbjct: 405 SNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFE 464

Query: 462 HINKIPDQQHEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKN 521
           HINKIP QQH+ADFSRI+MWYIN+QAKLFRQT++FT++ +P ANSLING+C N AGRWKN
Sbjct: 465 HINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKN 524

Query: 522 HKVIGSESSSIGQLGLKVRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDG 581
           H ++G+E SS+ QLG++ R +FQRFD+ G +  +EPD+RFK F SVI+P+IV+S GYEDG
Sbjct: 525 HTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDG 584

Query: 582 ILVYIPDYTDFIRIRNYMKEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLH 641
           IL+YIPDYTDFIR+RNY++EKTTILFGDI+EYS QRQL ANR+LFQQGR+KV+LYTERLH
Sbjct: 585 ILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLH 644

Query: 642 HYRRYEIKGVKSVVFYKPPNNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSL 701
           H+RRYEIKGVK+V+FYKPP NPEF+ ETVR++ K+AFLG  DLNIS VRC+YSKLDGL+L
Sbjct: 645 HFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLAL 704

Query: 702 ERIVGTKRAAVLSHAQKEVYEFK 724
           ERIVGT+RAA+L+H   E YEFK
Sbjct: 705 ERIVGTERAAILTHGPNETYEFK 727

>ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL091C
          Length = 704

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/724 (56%), Positives = 522/724 (72%), Gaps = 49/724 (6%)

Query: 18  KRGRQELRKIKR--SSVRRTKDESVNEVDHVADEIV--HSTGEDKISDIGSEEDNLXXXX 73
           KRGR++LR I R   ++   +DE+ +  +H  +E      T   K  +  +E+D      
Sbjct: 13  KRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNHPAEDDG----- 67

Query: 74  XXXXXXXXYDALLTILKSEHPEPKRRKTQADEDNKAAAK----------PAGNENVNVEY 123
                   Y ALLT+L +EH + ++++ +  E   A A            A  EN   + 
Sbjct: 68  -GARESQSYGALLTLLSAEHGKQRKKRLRKAEAEAAEAAEAGEDPEEAITAALENSAQDA 126

Query: 124 EPVDEQLEIENGLLGXXXXXXXXXXXXXXXXXXXXXXXQDPFESHFNQVSEKYVDDLSNA 183
           E  ++  + ++G                          QD F+ HFN+VS   V  L  A
Sbjct: 127 EDAEDAFD-DSG---------------------ESDEEQDHFDVHFNRVSAADVAQLDAA 164

Query: 184 FKSKSIKYKSVKASLGDDESYIYAKPFMV--GEEALVESPYRSSSIYSYFLKQRLKVQNG 241
           FK+   +Y+  K + G++E  +Y+KP     G E  V  P RS  +  Y +KQRL++ NG
Sbjct: 165 FKNGRAQYRVQKEARGEEE-ILYSKPVASSEGTEGPVRVPARS--LRGYAIKQRLRMHNG 221

Query: 242 LL-DKKIDPLTCMQKKLIDPMFQYKDILXXXXXXXXXXXXXRDLYALHVLNHIYKTRDRI 300
           L  D    PLT  QK L+DPMFQY+DIL             R+LY LH+LNH+YKTRDRI
Sbjct: 222 LTADDPEKPLTPQQKVLLDPMFQYQDILYEYEGYDREREY-RELYTLHILNHVYKTRDRI 280

Query: 301 LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQ 360
           LKNNQ+LQDNPD E LDQGFTRPK L+VVPTR  AY VVD ++ +SGI+QVDKK KF DQ
Sbjct: 281 LKNNQKLQDNPDQELLDQGFTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQ 340

Query: 361 FRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQMI 420
           F D SLPP SKPKSFQH+FKGNT+DFFV+G+KFTRKAI+LYSNFYQSD+I+CSPLG+Q+I
Sbjct: 341 FYDPSLPPASKPKSFQHVFKGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLI 400

Query: 421 LENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRM 480
           +ENTDKKKRQDDFLSSIE+MV+DQLHSIE+QNI+H+  IF HINKIP QQ +ADFSRIRM
Sbjct: 401 IENTDKKKRQDDFLSSIEVMVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRM 460

Query: 481 WYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKVR 540
           WYI +QAKLFRQTMVFT+YISP AN+L+N +C N AGR K+H+V+ +E S IGQLGLK+R
Sbjct: 461 WYIEDQAKLFRQTMVFTRYISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLR 520

Query: 541 QIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYMK 600
           QIFQRF+++G S ++EPD+RFKFFTSV++P I K+ GY+ GIL+YIP+YTDFIR+RNY+K
Sbjct: 521 QIFQRFEVLGGSTVDEPDFRFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLK 580

Query: 601 EKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPP 660
           +KT ILFGDINEYS+QRQL +NR+LFQ GR+KV+LYTERLHH+RR+E+KGVKSV+ YKPP
Sbjct: 581 DKTRILFGDINEYSDQRQLTSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPP 640

Query: 661 NNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEV 720
           +NPEFY E +R+IGK+AFLG  DLNI+TVRC+YSK+D L+LERIVGTKRAAVL+H Q EV
Sbjct: 641 SNPEFYQELLRYIGKSAFLGVADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEV 700

Query: 721 YEFK 724
           YEFK
Sbjct: 701 YEFK 704

>Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON}
           YDR243C (REAL)
          Length = 587

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 102/251 (40%), Gaps = 37/251 (14%)

Query: 394 TRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMVIDQL--HSIEYQ 451
           T K  K++S     D  + S +G     E +       D L +    +ID L  H +  +
Sbjct: 273 TEKVTKIWSRENNYDCRVISIVGGHSFEEISFSLSEGCDILVATPGRLIDSLDNHLLVMK 332

Query: 452 NISHIFTIFDHINKIPDQQHEADFSRIRMWY-INEQAKLFRQTMVFTKYISPAANSLING 510
            +  +  + D  +K+ D   E   + I     +N  +   RQT++FT  ++P    +  G
Sbjct: 333 QVETL--VLDEADKMIDLGFEDQVTNILTKVDVNVDSATNRQTLMFTATMTPVIEKIAAG 390

Query: 511 RCCNMAGRWKNHKVIGSESSSIGQLGLKVRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIP 570
                  R   +  IG ++ S       +RQ+ +  D          + +FK   SV+I 
Sbjct: 391 YM-----RKPVYATIGLDTGS----EPLIRQVVEYAD--------NEEEKFKKLKSVVIK 433

Query: 571 SIVKSVGYEDGILVYI--PDYTDFI--RIRNYMKEKTTILFGDINEYSNQRQLNANRSLF 626
                  YE  I+++I      D++  R +     K TIL G      +Q Q   +  LF
Sbjct: 434 -------YESPIIIFINYKQTADWLAERFQTETNMKVTILHGS----KSQEQREHSLQLF 482

Query: 627 QQGRLKVMLYT 637
           + G++++M+ T
Sbjct: 483 RTGKVQIMIAT 493

>TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 540
           aa] {ON} Anc_2.164 YNL112W
          Length = 540

 Score = 35.0 bits (79), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 6/115 (5%)

Query: 573 VKSVGYEDGILVYIPDYTDFIRIRNYMKEKTTILFGDINEYSNQRQLNANRSLFQQGRLK 632
           V S   E  ILV+         I  Y++E        I+   +QR+ +   + F++GR  
Sbjct: 354 VASQDKESKILVFASTKRTCDEITKYLREDGWPALA-IHGDKDQRERDWVLAEFREGRSP 412

Query: 633 VMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNETVRFIGKNAFLGNTDLNIS 687
           +M+ T+     R  ++KG+  V+ Y  P N E Y   V  IG+    G T   IS
Sbjct: 413 IMVATDVAA--RGIDVKGINYVINYDMPGNIEDY---VHRIGRTGRAGATGTAIS 462

>Kpol_1005.11 s1005 complement(18157..19677) [1521 bp, 506 aa] {ON}
           complement(18157..19677) [1521 nt, 507 aa]
          Length = 506

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 9/95 (9%)

Query: 595 IRNYMKEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSV 654
           + N ++   T L GD+N+  NQR    +  LF+ GR  +++ T+     R  +I  V  V
Sbjct: 345 LANLLEFSATALHGDLNQ--NQR--TGSLDLFKAGRRSILVATD--VAARGLDIPSVDIV 398

Query: 655 VFYKPPNNPEFYNETVRFIGKNAFLGNTDLNISTV 689
           + Y  P + + Y   +  +G+ A  G +  +IS V
Sbjct: 399 INYDIPVDSKSY---IHRVGRTARAGRSGKSISLV 430

>Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON}
           YDR243C (REAL)
          Length = 604

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 54/249 (21%), Positives = 101/249 (40%), Gaps = 37/249 (14%)

Query: 396 KAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMVIDQL--HSIEYQNI 453
           K  K++S     D  + S +G   + E +       D L +    +ID L  H +  + +
Sbjct: 292 KVTKIWSRESNYDCRVVSIVGGHSLEEISYSLSEGCDILVATPGRLIDSLENHLLVMKQV 351

Query: 454 SHIFTIFDHINKIPDQQHEADFSRIRMWY-INEQAKLFRQTMVFTKYISPAANSLINGRC 512
             +  + D  +K+ D   E   + I     ++  +   RQT++FT  ++P    +  G  
Sbjct: 352 ETL--VLDEADKMIDLGFEDQVTTILTKVDVSADSATNRQTLMFTATMTPVIEKIAAGYM 409

Query: 513 CNMAGRWKNHKVIGSESSSIGQLGLKVRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSI 572
                R   +  IG ++ S       ++QI +  D          + +FK   S++    
Sbjct: 410 -----RKPVYATIGVDTGS----EPLIQQIVEYAD--------NEEQKFKKLKSIV---- 448

Query: 573 VKSVGYEDGILVYI--PDYTDFI--RIRNYMKEKTTILFGDINEYSNQRQLNANRSLFQQ 628
                YE  I+++I      D++  R +     + TIL G      +Q Q   +  LF+ 
Sbjct: 449 ---TKYEPPIIIFINYKQTADWLAERFQKETNMRVTILHGS----KSQEQREHSLQLFRS 501

Query: 629 GRLKVMLYT 637
           GR++VM+ T
Sbjct: 502 GRVQVMIAT 510

>ZYRO0G16764g Chr7 complement(1375587..1376681) [1095 bp, 364 aa]
           {ON} similar to uniprot|P38772 Saccharomyces cerevisiae
           YHR040W BCD1 Essential protein required for the
           accumulation of box C/D snoRNA
          Length = 364

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 10/69 (14%)

Query: 330 PTREVAYRV--VDKIISKSGIDQVDKKGKFYDQFRDDSLPPESKPKSFQHIFKGNTSDFF 387
           P   +++R+   D ++   G    DK  +FY   ++D   PE+KP+  Q + KG      
Sbjct: 171 PFSHISHRIKETDTLVEGMGKIIYDKCCEFYHLIKEDEPAPETKPERTQCLVKG------ 224

Query: 388 VVGLKFTRK 396
             GLKF  K
Sbjct: 225 --GLKFYTK 231

>KLTH0G04004g Chr7 complement(316665..319922) [3258 bp, 1085 aa]
           {ON} similar to uniprot|P27692 YML010W Saccharomyces
           cerevisiae SPT5 Protein that forms a complex with Spt4p
           and mediates both activation and inhibition of
           transcription elongation
          Length = 1085

 Score = 32.0 bits (71), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 43/86 (50%), Gaps = 6/86 (6%)

Query: 531 SIGQLGLKVRQIFQRFDIIGNSIIEEPDYRF--KFFTSV--IIPSIVKSVGYEDGILVYI 586
           S+G   LK+  IFQR +  G   IE P      KF T V  I P+    +  ++  L+  
Sbjct: 331 SMGNKKLKIMSIFQRDNYSGRIYIEAPKQSVIEKFTTGVPDIYPAQKLLIPVQELPLLLK 390

Query: 587 PDYTDFIRIR--NYMKEKTTILFGDI 610
           PD +D +R+   +Y++ K  I  GD+
Sbjct: 391 PDKSDDVRLEEGSYVRIKRGIYKGDL 416

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,626,433
Number of extensions: 3424423
Number of successful extensions: 11147
Number of sequences better than 10.0: 39
Number of HSP's gapped: 11416
Number of HSP's successfully gapped: 41
Length of query: 724
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 607
Effective length of database: 40,065,477
Effective search space: 24319744539
Effective search space used: 24319744539
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)