Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_9.87na 1ON63263232290.0
YIL092Wna 1ON63363613790.0
Skud_9.81na 1ON64864612501e-164
Suva_9.107na 1ON65766211501e-149
NDAI0E04940singletonON1931501112e-05
Suva_5.136.7ON102388771.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_9.87
         (632 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_9.87 Chr9 (168203..170101) [1899 bp, 632 aa] {ON} YIL092W (...  1248   0.0  
YIL092W Chr9 (189066..190967) [1902 bp, 633 aa] {ON} Putative pr...   535   0.0  
Skud_9.81 Chr9 (165744..167690) [1947 bp, 648 aa] {ON}  YIL092W ...   486   e-164
Suva_9.107 Chr9 (183200..185173) [1974 bp, 657 aa] {ON}  YIL092W...   447   e-149
NDAI0E04940 Chr5 (1121677..1122258) [582 bp, 193 aa] {ON}              47   2e-05
Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON} ...    34   1.3  

>Smik_9.87 Chr9 (168203..170101) [1899 bp, 632 aa] {ON} YIL092W
           (REAL)
          Length = 632

 Score = 1248 bits (3229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/632 (96%), Positives = 607/632 (96%)

Query: 1   MADKSSTNDGDSLVTNGHILSQRGSXXXXXXXXXXNVAPSIRWKNFGVARQADDEQQASL 60
           MADKSSTNDGDSLVTNGHILSQRGS          NVAPSIRWKNFGVARQADDEQQASL
Sbjct: 1   MADKSSTNDGDSLVTNGHILSQRGSKKAYNKCKKKNVAPSIRWKNFGVARQADDEQQASL 60

Query: 61  ILDKMSHLKKFSSNEGDDENLFVQWADDITDTLSGLWCTGIFLKLLISSALSGRAKEWFD 120
           ILDKMSHLKKFSSNEGDDENLFVQWADDITDTLSGLWCTGIFLKLLISSALSGRAKEWFD
Sbjct: 61  ILDKMSHLKKFSSNEGDDENLFVQWADDITDTLSGLWCTGIFLKLLISSALSGRAKEWFD 120

Query: 121 STLEGIDDNVVNAYTLEKFLALLSEEFDGAKLLRRERFTKLLRLPIDSEKSLETFSYISE 180
           STLEGIDDNVVNAYTLEKFLALLSEEFDGAKLLRRERFTKLLRLPIDSEKSLETFSYISE
Sbjct: 121 STLEGIDDNVVNAYTLEKFLALLSEEFDGAKLLRRERFTKLLRLPIDSEKSLETFSYISE 180

Query: 181 HLTPYYLSTSAALDLFLTKLEPQFQKELENSVFPMTLDMALLMTACEFAKRASSHRKDRK 240
           HLTPYYLSTSAALDLFLTKLEPQFQKELENSVFPMTLDMALLMTACEFAKRASSHRKDRK
Sbjct: 181 HLTPYYLSTSAALDLFLTKLEPQFQKELENSVFPMTLDMALLMTACEFAKRASSHRKDRK 240

Query: 241 KNTSDFDIGTSKKRATNLNKKCKTKIIRENNTNRKSNRKKCFSEKELLIPDLKRRKQSEC 300
           KNTSDFDIGTSKKRATNLNKKCKTKIIRENNTNRKSNRKKCFSEKELLIPDLKRRKQSEC
Sbjct: 241 KNTSDFDIGTSKKRATNLNKKCKTKIIRENNTNRKSNRKKCFSEKELLIPDLKRRKQSEC 300

Query: 301 GIQFPLVVPEHKEFPSERKVSVNVCISKNGQSNLSNPPDFHAYLKDTKSQQYADSATSNL 360
           GIQFPLVVPEHKEFPSERKVSVNVCISKNGQSNLSNPPDFHAYLKDTKSQQYADSATSNL
Sbjct: 301 GIQFPLVVPEHKEFPSERKVSVNVCISKNGQSNLSNPPDFHAYLKDTKSQQYADSATSNL 360

Query: 361 INNRLISCTATDKLIGGKVVTMKNENTAYNEPTDGRPSSLENRNRAVKENTLQFMSSNSF 420
           INNRLISCTATDKLIGGKVVTMKNENTAYNEPTDGRPSSLENRNRAVKENTLQFMSSNSF
Sbjct: 361 INNRLISCTATDKLIGGKVVTMKNENTAYNEPTDGRPSSLENRNRAVKENTLQFMSSNSF 420

Query: 421 KECGKIHDSRTRSISGGNMTISSSQTMHMFSRPGSLAIDHQARNNEVSMSNRIKVVDNYN 480
           KECGKIHDSRTRSISGGNMTISSSQTMHMFSRPGSLAIDHQARNNEVSMSNRIKVVDNYN
Sbjct: 421 KECGKIHDSRTRSISGGNMTISSSQTMHMFSRPGSLAIDHQARNNEVSMSNRIKVVDNYN 480

Query: 481 PFTANLKVSKSSKNVPASMRMDDLSGTVGLKNALRTTYEENESYQLSSKKSYPLNNFAVR 540
           PFTANLKVSKSSKNVPASMRMDDLSGTVGLKNALRTTYEENESYQLSSKKSYPLNNFAVR
Sbjct: 481 PFTANLKVSKSSKNVPASMRMDDLSGTVGLKNALRTTYEENESYQLSSKKSYPLNNFAVR 540

Query: 541 TRNAHFNDRPSNYTSAHAXXXXXXXXXXXXXXXQCFTRPNSKEPSPKKVIISSCMVAQKK 600
           TRNAHFNDRPSNYTSAHA               QCFTRPNSKEPSPKKVIISSCMVAQKK
Sbjct: 541 TRNAHFNDRPSNYTSAHAITSVTYPSSSSISTIQCFTRPNSKEPSPKKVIISSCMVAQKK 600

Query: 601 ELANTKSKEAKNRSSFNEVTNPFLVNVIEKNK 632
           ELANTKSKEAKNRSSFNEVTNPFLVNVIEKNK
Sbjct: 601 ELANTKSKEAKNRSSFNEVTNPFLVNVIEKNK 632

>YIL092W Chr9 (189066..190967) [1902 bp, 633 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm and to
           the nucleus
          Length = 633

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/636 (48%), Positives = 394/636 (61%), Gaps = 21/636 (3%)

Query: 1   MADKSSTNDGDSLVTNGHILSQRGSXXXXXXXXXXNVAPSIRWKNFGVARQADDEQQASL 60
           MA +S TN+    + NG+ L  R               P I   NF V RQ DD++QA  
Sbjct: 9   MAYESGTNNYSDTIANGNTLPPRSKKGHSGRRKRSETLP-IACNNFCVTRQIDDDEQAFK 67

Query: 61  ILDKMSHLKKFSSNEGDDENLFVQWADDITDTLSGLWCTGIFLKLLISSALSGRAKEWFD 120
           +LDK+SHLKKFS+ +GDD N+FVQWADDITD L GL CTG FLKLLISSALSGRAK WFD
Sbjct: 68  MLDKVSHLKKFSAEDGDDNNIFVQWADDITDILFGLCCTGTFLKLLISSALSGRAKTWFD 127

Query: 121 STLEGIDDNVVNAYTLEKFLALLSEEFDGAKLLRRERFTKLLRLPIDSEKSLETFSYISE 180
           ST EGIDD+V+ AY+ EKFLALLSEEFDGA+ LRRE FT+LL L IDSEKSLE F++ S 
Sbjct: 128 STTEGIDDHVIKAYSFEKFLALLSEEFDGARSLRREIFTELLTLSIDSEKSLEAFAHKSG 187

Query: 181 HLTPYYLSTSAALDLFLTKLEPQFQKELENSVFPMTLDMALLMTACEFAKRASSHRKDRK 240
            LTPYYLS+ AALDLFLTKLEPQ QK+LEN  FPMTL++ALL+TACEFAKRAS+H+K R 
Sbjct: 188 RLTPYYLSSGAALDLFLTKLEPQLQKQLENCAFPMTLNLALLITACEFAKRASNHKKYRY 247

Query: 241 KNTSDFDIGTSKKRATNL-NKKCKTKIIRENNTNRKSNRKKCFSEKELLIPDLKRRKQSE 299
           KNT D DI T K + T + +K   TK I +N    KS++K  F +    IPD KRRKQ+E
Sbjct: 248 KNTRDSDICTPKSKNTAIVSKLSNTKTISKNKVIEKSDKKNYFDKNSQHIPDPKRRKQNE 307

Query: 300 CGIQFPLVVPEHKEFPSERKVSVNVCISKNGQSNLSNPPDFHAYLKDTKSQQYADSATSN 359
            G++  LV+ E K   + R VS N   SKNG +NLS   D H  LK++KSQQ A    S 
Sbjct: 308 PGMRLFLVMDEEKNILTSRNVSANAYTSKNGHTNLS---DLHTNLKNSKSQQCAVEPISI 364

Query: 360 LINNRLISCTATDKLIGGKVVTMKNENTAYNEPTDGRPSSLENRNRAVKENTLQFMSSNS 419
           L +  L++ T    LI  +V+  K E T Y+E  DG   SL  R  AVK+N+LQ ++SN 
Sbjct: 365 LNSGSLVTGTINIDLINDEVLGTKEETTTYDERMDGNSRSLNERCCAVKKNSLQPITSNI 424

Query: 420 FKECGKIHDSRTRSISGGNMTISSSQTMHMFSRPGSLAIDHQARNNEVSMSNRIKVVDNY 479
           F++  +I  ++  S+    ++ S S T +MF    S  + +  + NE+S S+++K +  +
Sbjct: 425 FQKNAEIQGTKIGSVLDSGISNSFSSTEYMFPPTSSATVSNPVKKNEISKSSQVKDIAQF 484

Query: 480 NPFTAN-----LKVSKSSKNVPASMRMDDLSGTVGLKNALRTTYEENESYQLSSKKSYPL 534
           NPF  N     L  S+S K+   SM ++ LS   GL+N     YE+++   L ++K YPL
Sbjct: 485 NPFMTNEKEKKLNPSESFKSPGVSMEINRLSRIAGLRNIPGNIYEDSKMLNLKTRKCYPL 544

Query: 535 NNFAVRTRNAHFNDRPSNYTSAHAXXXXXXXXXXXXXXXQCFTRPNSKEPSPKKVIISSC 594
           +NFAVRTR+AHFNDRPSNY S H                QC TR    +    K   S+ 
Sbjct: 545 HNFAVRTRSAHFNDRPSNYISPHETINATLRSPASFDSIQCITRSKRVDAETNKATGSA- 603

Query: 595 MVAQKKELANTKSKEAKNRSSFNEVTNPFLVNVIEK 630
               K E   TKS++      F EV NPFLVN   K
Sbjct: 604 ----KSENIETKSRK------FPEVINPFLVNTTNK 629

>Skud_9.81 Chr9 (165744..167690) [1947 bp, 648 aa] {ON}  YIL092W
           (REAL)
          Length = 648

 Score =  486 bits (1250), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 292/646 (45%), Positives = 390/646 (60%), Gaps = 18/646 (2%)

Query: 1   MADKSSTNDGDSLVTNGHILSQRGSXXXXXXXXXXNVAPSIRWKNFGVARQADDEQQASL 60
           M +KS TN G+  +TNG  L  R +          +V  SI+ KNFG+A+ ADDE+Q S 
Sbjct: 1   MVNKSKTNGGNDTITNGKTLPLRINKGTCRSRRKKSVVSSIKCKNFGLAKPADDEEQVSK 60

Query: 61  ILDKMSHLKKFSSNEGDDENLFVQWADDITDTLSGLWCTGIFLKLLISSALSGRAKEWFD 120
           ILDKM+HLKKFS++EGDDE+LFVQW DDI++TLSGLWCTG FLKLLISSALSGRAK+WFD
Sbjct: 61  ILDKMNHLKKFSADEGDDESLFVQWIDDISNTLSGLWCTGTFLKLLISSALSGRAKKWFD 120

Query: 121 STLEGIDDNVVNAYTLEKFLALLSEEFDGAKLLRRERFTKLLRLPIDSEKSLETFSYISE 180
            T EGIDD+++  YTLE FLALLS EFDGA+ LRRERF++LL LPIDSE SLE F+ IS 
Sbjct: 121 LTTEGIDDHLMKTYTLENFLALLSGEFDGARFLRRERFSELLNLPIDSETSLEKFANISG 180

Query: 181 HLTPYYLSTSAALDLFLTKLEPQFQKELENSVFPMTLDMALLMTACEFAKRASSHRKDRK 240
            LTPYYLS+SA LDL LTKL P  QK+L++S FPMTLD+ALLM ACEFAK AS  R D  
Sbjct: 181 LLTPYYLSSSATLDLLLTKLGPCLQKQLKSSAFPMTLDVALLMAACEFAKGASIERNDIN 240

Query: 241 KN----TSDFDIGTSKKRATNLNKKCKTKIIRENNTNRKSNRKKCFSEKELLIPDLKRRK 296
            N     +            +   K KT     +    K  RK   +E E  IP  KRRK
Sbjct: 241 DNIISSGATSSKKKKSTFKDSKKYKAKTTKGTTDIDFEKDVRKGYNNEMEPQIPSCKRRK 300

Query: 297 QSECGIQFPLVVPEHKE-FPSERKVSVNVCISKNGQSNLSNPPDFHAYLKDTKSQQYADS 355
           QSE   Q  L + ++ E  PSE  ++ N    +  +S+ +N  D  A LK  K Q Y  +
Sbjct: 301 QSEHCTQLSLAMTKNAETLPSENALA-NTYAPRKVRSSSNNSLDSFAPLKSNKHQSYVVN 359

Query: 356 ATSNLINNRLISCTATDKLIGGKVVTMKNENTAYNEPTDGRPSSLENRNRAVKENTLQFM 415
           A + L ++R  + T +  L   K    +++   Y++PTD    S    N A + +TL  M
Sbjct: 360 AIATLDSDRTFTSTTSTALADDKSEYTRDKTIFYDKPTDEPSLSSSGGNYAARRDTLHSM 419

Query: 416 SSNSFKECGKIHDSRTRSISGGNM----TISSSQTMHMFSRPGSLAIDHQARNNEVSMSN 471
           +S  FK+  ++ + R + ISGG++    T    Q MH+FSR   +  D   +  +   SN
Sbjct: 420 TSTPFKDSVQVPNPRLKDISGGDVSNRHTTRPYQAMHIFSRSALVVNDQTVKKTQFIKSN 479

Query: 472 RIKVVDNYNPFTAN-----LKVSKSSKNVPASMRMDDLSGTVGLKNALRTTYEENESYQL 526
           +I+ + N NPFT+N     +K  K  +   AS+++++LS  V L+   R+   EN+  +L
Sbjct: 480 QIEDIINSNPFTSNKNEKKVKALKGLETPIASVQVNELSCFVDLEKP-RSANIENKRSEL 538

Query: 527 SSKKSYPLNNFAVRTRNAHFNDRPSNYTSAHAXXXXXXXXXXXXXXXQCFTRPNSKEPSP 586
            ++K YPL+NFAVRTRNA F++RPSNYTSAH                Q F+R  S++   
Sbjct: 539 LTQKFYPLHNFAVRTRNAQFSERPSNYTSAHGIKGNIRPLSTNIQKIQSFSRSGSRKADT 598

Query: 587 KKVIISSCMVAQKKELANTKSKEAKNRSSFNEVTNPFLVNVIEKNK 632
              +ISS M+ Q K   N++++E  NR +FN+VTNPFL N +   K
Sbjct: 599 NTEVISSHMLVQHKRSVNSENREG-NR-TFNDVTNPFLANTMSGRK 642

>Suva_9.107 Chr9 (183200..185173) [1974 bp, 657 aa] {ON}  YIL092W
           (REAL)
          Length = 657

 Score =  447 bits (1150), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 293/662 (44%), Positives = 383/662 (57%), Gaps = 41/662 (6%)

Query: 1   MADKSSTNDGDSLVTNGHILSQRGSXXXXXXXXXXNVAPSIRWKNFGVARQADDEQQASL 60
           M +KS  N G     NG+  S R +          +VA S+R +NFG+AR  DDE+Q S+
Sbjct: 1   MVNKSKFNGG-----NGNAPSSRNNKKKYNNYRKKSVASSVRCENFGIARTDDDEKQVSM 55

Query: 61  ILDKMSHLKKFSSNEGDDENLFVQWADDITDTLSGLWCTGIFLKLLISSALSGRAKEWFD 120
           I DKM+HLKKFS+ E DD+NLFVQW+DDITDTLSGLW TG FLKLLISSAL+GRAK+WFD
Sbjct: 56  IFDKMNHLKKFSAEEDDDKNLFVQWSDDITDTLSGLWWTGTFLKLLISSALTGRAKKWFD 115

Query: 121 STLEGIDDNVVNAYTLEKFLALLSEEFDGAKLLRRERFTKLLRLPIDSEKSLETFSYISE 180
           ST EGIDD+ +  YTLEKFLALLS EFDG ++LRRE F +LL+L I+SE SLE F+ ISE
Sbjct: 116 STTEGIDDHSIRTYTLEKFLALLSGEFDGVRVLRRESFAELLKLSINSETSLEKFAKISE 175

Query: 181 HLTPYYLSTSAALDLFLTKLEPQFQKELENSVFPMTLDMALLMTACEFAKRASSHRKDRK 240
            LTPYYLS+SAALDLFLTKL+P  QK+L ++ FPMTLD+ALL+ ACEFAK  S  RKD+ 
Sbjct: 176 FLTPYYLSSSAALDLFLTKLKPCLQKQLGDAAFPMTLDIALLVAACEFAKGTSEERKDKN 235

Query: 241 KNTS---------DFDIGTSKKRAT-NLNKKCKTKIIREN--NTNRKSNRKKCFSEKELL 288
              +         D D  T KKR T   NKKCK K I EN  N  +KSN KK  +E+EL 
Sbjct: 236 AENNNNNNDSNPIDLDPSTRKKRDTVKTNKKCKRKSIHENIDNAIKKSNGKKNVNEEELQ 295

Query: 289 IPDLKRRKQSECGIQFPLVVPEHKE-FPSERKVSVNVCISKNGQSNLSNPPDFHAYLKDT 347
           +   KRR+Q+E G Q  L      +  P  + +S N+  S N Q N S+  D +  LK  
Sbjct: 296 VLHPKRRRQNESGKQISLPTAALADILPLNQNIS-NINAS-NKQFNASSSLDSYTSLKSN 353

Query: 348 KSQQYADSATSNLINNR--LISCTATDKLIGGKVVTMKNENTAYNEPTDGRPSSLENRNR 405
             Q +  + T  L  NR   I+  A   L   KV  +KNE   ++E  +  P SL + N 
Sbjct: 354 SFQHHLTNETPILDGNRSFPITTPAVASLAYDKVENIKNETNIHDEAINDIPLSLASSND 413

Query: 406 AVKENTLQFMSSNSFKECGKIHDSRTRSISGGN----MTISSSQTMHMFS-----RPGSL 456
            VK++  + MS  S +    + +S  +S   G+         S   H+ S     +P   
Sbjct: 414 FVKKSVAESMSWKSIRGNVGVPNSNVKSFLRGDESNHQMARRSHATHVSSHSNIFKPAQT 473

Query: 457 AIDHQARNNEVSMSNRIKVVDNYNPFTANLKV-----SKSSKNVPASMRMDDLSGTVGLK 511
           A     + N  + +N+I  ++  NPFT N        SK  KN   S++++  S  + L+
Sbjct: 474 ACYDSNKTN-FTENNKIGEINKLNPFTKNENTIKSDKSKGPKNPVTSVKVNKPSYFIDLE 532

Query: 512 NALRTTYEENESYQLSSKKSYPLNNFAVRTRNAHFNDRPSNYTSAHAXXXXXXXXXXXXX 571
              ++ + EN S  L ++KSYPL+NFAVRTRNA FNDRPSNYTSAH              
Sbjct: 533 KP-QSMHNENRSVGLLAQKSYPLHNFAVRTRNARFNDRPSNYTSAHGNLNAIHPLSLKIN 591

Query: 572 XXQCFTRPNSKEPSPKKVIISSCMVAQKKELANT-KSKEAKNRSSFNEVTNPFLVNVIEK 630
             QC ++P  +E    K +    M  Q+K   N+  +K+   RS  N V NPFL N + +
Sbjct: 592 NIQCLSKPGKREADTNKEVNVPKMTVQEKGTVNSIIAKDNDGRS--NSVENPFLGNTLNE 649

Query: 631 NK 632
            K
Sbjct: 650 TK 651

>NDAI0E04940 Chr5 (1121677..1122258) [582 bp, 193 aa] {ON}
          Length = 193

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 71/150 (47%), Gaps = 8/150 (5%)

Query: 60  LILDKMSHLKKFSSNEGD--DENLFVQWADDITDTLSGLWCTGIFLKLLISSALSGRAKE 117
           L L  +    KFS    D  D N    WA+ I  TL      G     L+ S LS  A+ 
Sbjct: 36  LTLRALESCVKFSGGLSDTIDVN---TWAEKIAWTLKNSAAKGFDAASLVESRLSSPAEN 92

Query: 118 WFDSTLEGIDDNVVNAYTLEKFLALLSEEFDGAKLLRRERFTKLLRLPIDSEKSLETFSY 177
           WF  T++ + D + +    + FL L+ E+F     L+ +R +KL+ L I S +S   F  
Sbjct: 93  WFIETIKDLGDTIESERP-QFFLNLVIEKFKDLN-LKTKRLSKLMNLRITSGESGHIFER 150

Query: 178 ISEHLTPYYLSTSAALDLFLTKLEPQFQKE 207
            S  L   Y+S    L++F++K+ P F ++
Sbjct: 151 TSLELPEEYISRQCLLEIFVSKV-PSFIRD 179

>Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON}
           YEL055C (REAL)
          Length = 1023

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 6/88 (6%)

Query: 342 AYLKDTKSQQY-ADSATSNLINNRLISCTATDK---LIGGKVVTMKNENTAYNEPTDGRP 397
           A +KD  + +  +DS   + + NRLI   A+D+    +G  +   +  N A N P+  RP
Sbjct: 27  ALIKDLSALELPSDSEEWSYVLNRLIKGLASDRNSARLGFSLCLTEVINLAMNMPSGQRP 86

Query: 398 SSLENRNRAVKENTLQFMSSNSFKECGK 425
             LE+ N  +  +TL F+   +  E GK
Sbjct: 87  KGLESMNDFL--DTLSFILDINVNETGK 112

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.127    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,114,600
Number of extensions: 3004550
Number of successful extensions: 9828
Number of sequences better than 10.0: 123
Number of HSP's gapped: 10367
Number of HSP's successfully gapped: 125
Length of query: 632
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 516
Effective length of database: 40,180,143
Effective search space: 20732953788
Effective search space used: 20732953788
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)