Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_9.852.287ON37137119560.0
YIL094C (LYS12)2.287ON37137119090.0
Skud_9.792.287ON37137118990.0
Suva_9.1052.287ON37137118820.0
NCAS0B062502.287ON37337317530.0
KNAG0A054202.287ON37237117320.0
NDAI0B035502.287ON37237217240.0
TDEL0G021802.287ON36937116850.0
CAGL0G02585g2.287ON37237216500.0
ZYRO0A01914g2.287ON36837116130.0
KAFR0J013602.287ON37337215890.0
KLTH0G10384g2.287ON36737115770.0
KLLA0E08339g2.287ON36937115660.0
Kwal_27.115282.287ON36737115530.0
SAKL0E07656g2.287ON36837115460.0
Kpol_1003.392.287ON37037115340.0
TBLA0B059402.287ON36937215310.0
TPHA0C034102.287ON37137115290.0
Ecym_33262.287ON36637114180.0
ADL214C2.287ON36737113530.0
NDAI0C014105.473ON3693904822e-56
Smik_15.3165.473ON3693904742e-55
KLLA0F04103g2.278ON3613504663e-54
ADL223W2.278ON3623834655e-54
TPHA0D015602.278ON3603524646e-54
Skud_15.3005.473ON3693904622e-53
YOR136W (IDH2)5.473ON3693904612e-53
Suva_8.1885.473ON3693904603e-53
Kwal_23.50122.278ON3613704586e-53
KLLA0E03125g5.473ON3683804586e-53
SAKL0E07876g2.278ON3613704542e-52
Ecym_33162.278ON3623504542e-52
NCAS0H022505.473ON4223904582e-52
Kpol_543.85.473ON3683824517e-52
NCAS0B062902.278ON3593514507e-52
TBLA0B022405.473ON3733984519e-52
KNAG0B040705.473ON3733604492e-51
Ecym_23135.473ON3703534482e-51
TPHA0J027705.473ON3763754482e-51
KLTH0F15048g5.473ON3683784463e-51
CAGL0I07227g5.473ON3683894455e-51
AFR137C5.473ON3673664455e-51
Kwal_55.212735.473ON3683794447e-51
SAKL0G03520g5.473ON3693604431e-50
KAFR0B063705.473ON3783574403e-50
KLTH0G10186g2.278ON3603504394e-50
YNL037C (IDH1)2.278ON3603724384e-50
TDEL0A033705.473ON3714034394e-50
TDEL0C038402.278ON3613794385e-50
Smik_14.2902.278ON3603724376e-50
Skud_14.2932.278ON3613724342e-49
Kpol_440.125.473ON3683894333e-49
ZYRO0D11220g5.473ON3683524316e-49
Kpol_1039.352.278ON3593524281e-48
TBLA0B069102.278ON3653524272e-48
ZYRO0D02838g2.278ON3613724263e-48
NDAI0B035902.278ON3593514263e-48
CAGL0G02673g2.278ON3583704238e-48
KAFR0J014102.278ON3503794034e-45
KNAG0A052802.278ON3613813974e-44
TPHA0E014805.473ON3773603951e-43
TBLA0C015001.402ON3653723923e-43
Ecym_12961.402ON3633663618e-39
AAL012C1.402ON3723663601e-38
TDEL0B060001.402ON3623633591e-38
KLLA0D04906g1.402ON3623633531e-37
Kpol_1048.631.402ON3643613479e-37
Smik_3.661.402ON3643603452e-36
YCL018W (LEU2)1.402ON3643603452e-36
Suva_14.3022.278ON3002933402e-36
NDAI0G042301.402ON3633643433e-36
KLTH0H12188g1.402ON3643603433e-36
ZYRO0E04796g1.402ON3623633407e-36
Skud_3.431.402ON3643603407e-36
KNAG0I012801.402ON4473693431e-35
CAGL0H03795g1.402ON3653623391e-35
Suva_3.31.402ON3643603372e-35
Kwal_0.2251.402ON3643683355e-35
KAFR0I022001.402ON3653603275e-34
NCAS0C048701.402ON3653613128e-32
SAKL0D08690g1.402ON3643643111e-31
TPHA0B037301.402ON3653662891e-28
KAFR0H031601.396ON4211281425e-09
Kwal_23.42104.254ON4222061391e-08
Kpol_1055.784.254ON4271681363e-08
CAGL0H03663g1.396ON4181261345e-08
YDL066W (IDP1)4.254ON4281061345e-08
CAGL0D00770g4.254ON4231151337e-08
TPHA0B022104.254ON4331731337e-08
SAKL0H02860g4.254ON4212041311e-07
Skud_4.1894.254ON4291061292e-07
NDAI0D043604.254ON4241151292e-07
KNAG0H016701.396ON4241261283e-07
TBLA0C012901.396ON4181261274e-07
ZYRO0E05016g1.396ON4111271264e-07
Ecym_13061.396ON4151261257e-07
KAFR0I021301.396ON4081061257e-07
NCAS0G036201.396ON4181061248e-07
KNAG0I013201.396ON4121061248e-07
KLLA0B03355g4.254ON4291151241e-06
SAKL0D08426g1.396ON4111261231e-06
KLTH0H12012g1.396ON4131281231e-06
Smik_4.1694.254ON4281061231e-06
AER061C4.254ON4251151231e-06
AAL022W1.396ON4151261221e-06
KNAG0D044104.254ON4281591222e-06
Suva_4.1844.254ON4291061212e-06
YNL009W (IDP3)1.396ON4201911212e-06
NCAS0A087201.396ON4131291212e-06
CAGL0B04917g1.396ON4111301202e-06
Smik_14.3191.396ON4181261202e-06
KAFR0G032604.254ON4211061202e-06
Kpol_1048.701.396ON4191061202e-06
NCAS0A025104.254ON4261591202e-06
KLTH0D14476g4.254ON4202101203e-06
TDEL0B061001.396ON4141271203e-06
TDEL0E011604.254ON4231151193e-06
Skud_14.3181.396ON4201261194e-06
Smik_12.2351.396ON4121261184e-06
NDAI0G008501.396ON4191191185e-06
Suva_14.3391.396ON4171261185e-06
KLLA0F12342g1.396ON4151981175e-06
Skud_12.2391.396ON4121261177e-06
TBLA0A080104.254ON4281061167e-06
Kwal_0.1911.396ON4111271169e-06
ZYRO0B12496g4.254ON4221071151e-05
Suva_10.2711.396ON4121261151e-05
YLR174W (IDP2)1.396ON4121261141e-05
TPHA0B036601.396ON4221261122e-05
Ecym_32654.254ON4241071104e-05
Suva_14.303singletonON5350880.001
NDAI0G051601.396ON420127990.001
KNAG0A037508.531ON83086731.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_9.85
         (371 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   758   0.0  
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   739   0.0  
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   736   0.0  
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   729   0.0  
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   679   0.0  
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              671   0.0  
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   668   0.0  
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   653   0.0  
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   640   0.0  
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   625   0.0  
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   616   0.0  
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   612   0.0  
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   607   0.0  
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   602   0.0  
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   600   0.0  
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   595   0.0  
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   594   0.0  
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   593   0.0  
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   550   0.0  
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   525   0.0  
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   190   2e-56
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   187   2e-55
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   184   3e-54
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   183   5e-54
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   183   6e-54
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   182   2e-53
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   182   2e-53
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   181   3e-53
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   181   6e-53
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   181   6e-53
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   179   2e-52
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   179   2e-52
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    181   2e-52
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   178   7e-52
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   177   7e-52
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   178   9e-52
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   177   2e-51
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   177   2e-51
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   177   2e-51
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   176   3e-51
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   176   5e-51
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   176   5e-51
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   175   7e-51
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   175   1e-50
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   174   3e-50
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   173   4e-50
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   173   4e-50
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   173   4e-50
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   173   5e-50
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   172   6e-50
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   171   2e-49
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   171   3e-49
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   170   6e-49
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   169   1e-48
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            169   2e-48
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   168   3e-48
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   168   3e-48
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   167   8e-48
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   159   4e-45
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              157   4e-44
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   156   1e-43
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...   155   3e-43
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...   143   8e-39
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...   143   1e-38
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...   142   1e-38
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...   140   1e-37
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...   138   9e-37
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)   137   2e-36
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...   137   2e-36
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   135   2e-36
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...   136   3e-36
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...   136   3e-36
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...   135   7e-36
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)   135   7e-36
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...   136   1e-35
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}             135   1e-35
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)      134   2e-35
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...   133   5e-35
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...   130   5e-34
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...   124   8e-32
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...   124   1e-31
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...   115   1e-28
KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {O...    59   5e-09
Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W...    58   1e-08
Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON} (2078...    57   3e-08
CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly...    56   5e-08
YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}  IDP1Mitoch...    56   5e-08
CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly s...    56   7e-08
TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.2...    56   7e-08
SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly...    55   1e-07
Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W ...    54   2e-07
NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON} Anc_4...    54   2e-07
KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.3...    54   3e-07
TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {O...    54   4e-07
ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {...    53   4e-07
Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}...    53   7e-07
KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.3...    53   7e-07
NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {O...    52   8e-07
KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {O...    52   8e-07
KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly...    52   1e-06
SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly...    52   1e-06
KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} high...    52   1e-06
Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W ...    52   1e-06
AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON} S...    52   1e-06
AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic ho...    52   1e-06
KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {O...    52   2e-06
Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W ...    51   2e-06
YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}  IDP3Perox...    51   2e-06
NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa] ...    51   2e-06
CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {...    51   2e-06
Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174...    51   2e-06
KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {O...    51   2e-06
Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa] ...    51   2e-06
NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {O...    51   2e-06
KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]...    51   3e-06
TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa] ...    51   3e-06
TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.2...    50   3e-06
Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009...    50   4e-06
Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174...    50   4e-06
NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396     50   5e-06
Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009...    50   5e-06
KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} high...    50   5e-06
Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174...    50   7e-06
TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON} Anc_4...    49   7e-06
Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP...    49   9e-06
ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]...    49   1e-05
Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174...    49   1e-05
YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}  IDP2Cytos...    49   1e-05
TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.3...    48   2e-05
Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar t...    47   4e-05
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    39   0.001
NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa] ...    43   0.001
KNAG0A03750 Chr1 (487451..489943) [2493 bp, 830 aa] {ON} Anc_8.5...    33   1.7  

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/371 (100%), Positives = 371/371 (100%)

Query: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60
           MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI
Sbjct: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120
           DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180
           ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR
Sbjct: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240
           IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ
Sbjct: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300
           IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360
           SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360

Query: 361 QQVVEDVLSRL 371
           QQVVEDVLSRL
Sbjct: 361 QQVVEDVLSRL 371

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/371 (97%), Positives = 366/371 (98%)

Query: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60
           M RSVATRLS CRGLA+NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI
Sbjct: 1   MFRSVATRLSACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120
           DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180
           ANVRPVKSVEG K KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR
Sbjct: 121 ANVRPVKSVEGEKGKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240
           IATIA+DIALKRLQTRG+ATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ
Sbjct: 181 IATIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300
           IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360
           SAPDIAGKGIANPIATIRSTALMLEFLGHN AAQDIYKAVDANLREG+IKTPDLGGKAST
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIYKAVDANLREGSIKTPDLGGKAST 360

Query: 361 QQVVEDVLSRL 371
           QQVV+DVLSRL
Sbjct: 361 QQVVDDVLSRL 371

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/371 (96%), Positives = 365/371 (98%)

Query: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60
           M RSVATR+S CRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI
Sbjct: 1   MFRSVATRVSACRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120
           DLYAGFQTFQETGKALPDETV VLK+QCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF
Sbjct: 61  DLYAGFQTFQETGKALPDETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180
           ANVRPVKSVEG ++KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR
Sbjct: 121 ANVRPVKSVEGSRNKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240
           IATIA+DIALKRLQTRGEATLTVTHKSNVLSQ+DGLFREICKEVYESNKDKYGQIKYNEQ
Sbjct: 181 IATIALDIALKRLQTRGEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300
           IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360
           SAPDIAGKGIANPIATIRSTALMLEFLGHN AAQDIYKAVDANLREGAI TPDLGGKAST
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNGAAQDIYKAVDANLREGAITTPDLGGKAST 360

Query: 361 QQVVEDVLSRL 371
           QQVV+DVLSRL
Sbjct: 361 QQVVDDVLSRL 371

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/371 (94%), Positives = 365/371 (98%)

Query: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60
           M RSVATR+S CRGLA+NAARKSLTIGLIPGDGIGKEVIPAGKQ+LENLNSKHGLSFNFI
Sbjct: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60

Query: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120
           DLYAGFQTFQETGKALPDET+KVLK+QCQGALFGAVQSPTTKVEGYSSPIVALRREMGL+
Sbjct: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120

Query: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180
           ANVRPVKSVEG KDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADA KRISE+ATRR
Sbjct: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240
           IA IA+DIAL+RLQTRGEATLTVTHKSNVLSQSDGLFREICK+VYESNKDKYGQIKYNEQ
Sbjct: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300
           IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP+IVIGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360
           SAPDIAGKGIANPIATIRSTALMLEFLGHN+AAQDIYKAVDANLREGAI TPDLGGKAST
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360

Query: 361 QQVVEDVLSRL 371
           QQVV+DVLSRL
Sbjct: 361 QQVVDDVLSRL 371

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/373 (87%), Positives = 352/373 (94%), Gaps = 2/373 (0%)

Query: 1   MLRSVATRL--STCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFN 58
           MLR+ A+R   STCR  ATNA RK+LTIGLIPGDGIGKEVIPAGKQVLENLNSKHGL F+
Sbjct: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60

Query: 59  FIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMG 118
           FIDL AGFQTF +TGKALPDETV+VLK QCQGALFGAVQSPTTKVEGYSSPIVALR+EMG
Sbjct: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120

Query: 119 LFANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIAT 178
           LFANVRPVKSV G KD+P+DMVIVRENTEDLYIKIEKTYIDKATGTRVA+ATKRISEIAT
Sbjct: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180

Query: 179 RRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYN 238
           RRIATIA+DIAL+RL+  G+ATLTVTHKSNVLSQSDGLFREICK+VYESNKDKYG I YN
Sbjct: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240

Query: 239 EQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 298
           EQIVDSMVYR+FREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC
Sbjct: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300

Query: 299 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKA 358
           HGSAPDIAGKGIANPIATIRSTALMLEFLGHN+AAQDI++AV+AN+RE  IKTPDLGG +
Sbjct: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360

Query: 359 STQQVVEDVLSRL 371
           +TQQV EDVL+RL
Sbjct: 361 TTQQVTEDVLARL 373

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/371 (85%), Positives = 353/371 (95%)

Query: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60
           MLRS A +L+ CRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVL++LN KHGL+F+FI
Sbjct: 2   MLRSAANKLAGCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFI 61

Query: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120
           DL AGFQTFQ+TGKALPDETV++LKE+CQGALFGAVQSPTTKVEGYSSPIVALR+ MGL+
Sbjct: 62  DLQAGFQTFQDTGKALPDETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLY 121

Query: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180
           AN+RPVKSVEG  ++P+DM+IVRENTEDLYIKIEKTYIDKATGTRVA+ATKRISEIAT+R
Sbjct: 122 ANIRPVKSVEGSNERPVDMIIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQR 181

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240
           IATIA+DIAL+RLQ  G+ATLTVTHKSNVLSQSDGLFRE+C+E+YE+NKDKY  I YNEQ
Sbjct: 182 IATIALDIALQRLQNNGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQ 241

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300
           IVDSMVYR+FREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG
Sbjct: 242 IVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 301

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360
           SAPDIAGKGIANPIATIRSTALMLEFLGHN AAQDI+KAVDANLR+G +KT DLGG A+T
Sbjct: 302 SAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLVKTADLGGNATT 361

Query: 361 QQVVEDVLSRL 371
           Q VV+D+L+RL
Sbjct: 362 QNVVDDILARL 372

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/372 (85%), Positives = 354/372 (95%), Gaps = 1/372 (0%)

Query: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60
           MLR+ A+RL+TCRG ATNA RK+LTIGLIPGDGIGKEVIPAGKQVL+NLNSKHGL+F+FI
Sbjct: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60

Query: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120
           DL AGFQTF +TGKALPDET++VLK QCQGALFGAVQSPTTKVEGYSSPIVALR+EMGL+
Sbjct: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120

Query: 121 ANVRPVKSVEGGKDKPIDMVIVRENTED-LYIKIEKTYIDKATGTRVADATKRISEIATR 179
           ANVRPVKSVEG  DKP+DMVIVRENT   + IK+E+TYID+ATGTRVA+ATKRISEIATR
Sbjct: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180

Query: 180 RIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNE 239
           RIATIA+DIAL+RL+T G+ATLTVTHKSNVLSQSDGLFREICK+VYESNKDKYGQI YNE
Sbjct: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240

Query: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 299
           QIVDSMVYR+FREPQCFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH
Sbjct: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAS 359
           GSAPDIAGKGI+NPIATIRSTALMLEFLGHN AAQDI++AV+ANL+E  +KTPDLGGK++
Sbjct: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360

Query: 360 TQQVVEDVLSRL 371
           TQ+V EDVL+RL
Sbjct: 361 TQEVTEDVLARL 372

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/371 (84%), Positives = 347/371 (93%), Gaps = 2/371 (0%)

Query: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60
           MLRS   RL+T R  A+  A KS+ IGLIPGDGIGKEVIPAGKQVLENL+ KHGL+F+FI
Sbjct: 1   MLRSAIGRLATRRAYAS--APKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFI 58

Query: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120
           DL AG+ TFQETGKALP++TV+VLK QCQGALFGAVQSPTTKVEGYSSPIVALR+E+GL+
Sbjct: 59  DLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLY 118

Query: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180
           ANVRPVKSVEG KD+P+DMVIVRENTEDLYIK+EKTY+DKATGTRVA+ATKRISE+ATRR
Sbjct: 119 ANVRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRR 178

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240
           IATIA+DIAL+RL+T G ATLTVTHKSNVLSQSDGLFREICK+VYESNKDKYGQ+ YNEQ
Sbjct: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQ 238

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300
           IVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG
Sbjct: 239 IVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 298

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360
           SAPDIAGKGI+NPIATIRST LMLEFLGHN  AQDIY+AVDANLRE  +KTPDLGG ++T
Sbjct: 299 SAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTT 358

Query: 361 QQVVEDVLSRL 371
           QQVVED+LS+L
Sbjct: 359 QQVVEDILSKL 369

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/372 (82%), Positives = 343/372 (92%), Gaps = 1/372 (0%)

Query: 1   MLRSVATRLSTCRGLA-TNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNF 59
           MLR  ATRL+  RG + T  A+K+LTIGLIPGDGIGKEVIPAGKQ+LE +  K  L F F
Sbjct: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60

Query: 60  IDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGL 119
           IDL+AG++TFQ TGKALPDETV+VL+  CQGALFGAVQSPTTKVEGYSSPIVALR+ MGL
Sbjct: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120

Query: 120 FANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATR 179
           FANVRPVK+VEG  D+P+DMVIVRENTEDLYIKIEKTY D ATGTRVA+ATKRISE+ATR
Sbjct: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180

Query: 180 RIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNE 239
           RIATIA+DIAL+RLQ+RG ATLTVTHKSNVLSQSDGLFREICK+VYESNKDKYG+I+YNE
Sbjct: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240

Query: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 299
           QIVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH
Sbjct: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAS 359
           GSAPDIAG+GIANPIATIRSTALMLEFLG+  AAQ IYKAVD+N+RE  IKTPDLGGK++
Sbjct: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360

Query: 360 TQQVVEDVLSRL 371
           TQQVV+D+LS++
Sbjct: 361 TQQVVDDILSKI 372

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/371 (80%), Positives = 338/371 (91%), Gaps = 3/371 (0%)

Query: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60
           M RS   +++  R  +   A KS+ IGLIPGDGIGKEVIPAGKQVLE L SKHGL F+FI
Sbjct: 1   MFRSSVAKVAARRAYS---APKSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFI 57

Query: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120
           DL AG++ FQ+ GKALPD+TVKVLKEQCQGALFGAVQSPTTKV GYSSPIVALR+E+GL+
Sbjct: 58  DLKAGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLY 117

Query: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180
           ANVRPVKSVE G D+ +DM+IVRENTEDLYIK EKTY+D+ATGTRVA+A KRISE+ATR+
Sbjct: 118 ANVRPVKSVEKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRK 177

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240
           IATIA+DI+L+RL++RG ATLTVTHKSNVLSQSDGLFREICK+VYE NKDKYG++KYNEQ
Sbjct: 178 IATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQ 237

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300
           IVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG
Sbjct: 238 IVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 297

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360
           SAPDIAGKGI+NPIATIRSTALMLEFLGH   AQDIYKAVDANL +G + TPDLGGKA+T
Sbjct: 298 SAPDIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATT 357

Query: 361 QQVVEDVLSRL 371
           QQVV+D+LS++
Sbjct: 358 QQVVDDILSKI 368

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/372 (79%), Positives = 337/372 (90%), Gaps = 2/372 (0%)

Query: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60
           MLRSV T+ +T R L+T    KSLTIGLIPGDGIGKEVIPAGKQVL+NL+S+HGL+FNFI
Sbjct: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60

Query: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120
           DL AGFQTF +TGKALPDETVKVLKEQCQG LFGAVQSPTT+V+ YSSPIVALR+E+ L+
Sbjct: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120

Query: 121 ANVRPVKSVEGGKD-KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATR 179
           AN+RPVKSV G    KP+DMVIVRENTEDLYIKIEK+Y D+  G RVA+ATKRI+E+ATR
Sbjct: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179

Query: 180 RIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNE 239
           +IA IA+D+AL+RL+T G+ATLTVTHKSNVLSQSDGLFREICK+VY++NKDKY  I YNE
Sbjct: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239

Query: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 299
           QI+DSMVYR+FREP+ FDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP+IV+GEPCH
Sbjct: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAS 359
           GSAPDIAGKGIANPIATIRSTALMLEFLGH  AAQDI+KAV++N+RE  IKTPDLGG +S
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359

Query: 360 TQQVVEDVLSRL 371
           TQ VV+DVL +L
Sbjct: 360 TQNVVDDVLEKL 371

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/371 (79%), Positives = 339/371 (91%), Gaps = 4/371 (1%)

Query: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60
           MLR+  T+L+  R  A+  A KSLTIGLIPGDGIGKEVIPAG+QVLENL+SKHGL F+FI
Sbjct: 1   MLRASFTQLAR-RSYAS--ASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFI 57

Query: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120
           DL AG+QTFQETGKALPDET+ +L+ QCQGALFGAVQSPT KVEGYSSPIVALR+++GL+
Sbjct: 58  DLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117

Query: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180
           ANVRPVKSV   +++P+DM+IVRENTEDLYIK EKTYID+ TGTRVA+A KRISE AT+ 
Sbjct: 118 ANVRPVKSVLP-QERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKN 176

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240
           IA IA++IAL+R +  GEATLTVTHKSNVLSQSDGLFRE+C++VYESNKDK+G IKYNEQ
Sbjct: 177 IANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQ 236

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300
           IVDSMVYR+FREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHG
Sbjct: 237 IVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHG 296

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360
           SAPDIAGKGI+NP+ATIRSTALMLEF+GH  AAQDI+KAVDANLR+ +IKTPDLGGK++T
Sbjct: 297 SAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTT 356

Query: 361 QQVVEDVLSRL 371
           QQVVEDVLSR+
Sbjct: 357 QQVVEDVLSRM 367

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/371 (78%), Positives = 337/371 (90%), Gaps = 3/371 (0%)

Query: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60
           M+R+   +LS  R  A+NA  K+LTIGLIPGDGIGKEVIPAGK++LE+LN K+GLSF FI
Sbjct: 1   MMRTRFIQLSR-RAYASNA--KNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFI 57

Query: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120
           DL AG++TFQ TGKALPDET+ +LK QC+GALFGAVQSPTTKVEGYSSPIVALR+ +GLF
Sbjct: 58  DLQAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLF 117

Query: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180
           ANVRPVKSV+G KD+ +D+VIVRENTEDLYIK+EK+YID+ATGTRVADATKRI+EIAT+ 
Sbjct: 118 ANVRPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKN 177

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240
           IATIA+ IA +RL+  G ATLTVTHKSNVLSQSDGLFRE+C+E YE+NKDKYG ++YNEQ
Sbjct: 178 IATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQ 237

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300
           IVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHG
Sbjct: 238 IVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHG 297

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360
           SAPDIAGKGI+NPIATIRSTALMLEFLG+   A+DI+KAVDAN+REG   TPDLGG ++T
Sbjct: 298 SAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTT 357

Query: 361 QQVVEDVLSRL 371
           QQV+EDVLS+L
Sbjct: 358 QQVLEDVLSKL 368

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/371 (78%), Positives = 333/371 (89%), Gaps = 4/371 (1%)

Query: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60
           MLR+   +L+     +  +A KSLTIGLIPGDGIG+EVIPAGK VLENL+SKHGL FNFI
Sbjct: 1   MLRTSFNQLAR---RSYTSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFI 57

Query: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120
           DL AG+QTF +TGKALPDET+ +LK +CQGALFGAVQSPT KVEGYSSPIVALR+++GL+
Sbjct: 58  DLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117

Query: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180
           ANVRPVKSV   ++KPIDMVIVRENTEDLYIK EKTYID+ TGTRVA+A KRISE+ATR 
Sbjct: 118 ANVRPVKSVLS-QEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRN 176

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240
           IA IA++IAL+R +  G ATLTVTHKSNVLSQSDGLFREIC++VYESN+DK+G I YNEQ
Sbjct: 177 IANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQ 236

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300
           IVDSMVYRLFREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHG
Sbjct: 237 IVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHG 296

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360
           SAPDIAGKGI+NP+ATIRSTALMLEF+GH  AAQDI+KAVDANLR+  +KTPDLGGK++T
Sbjct: 297 SAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTT 356

Query: 361 QQVVEDVLSRL 371
           QQVV+DVLSR+
Sbjct: 357 QQVVDDVLSRM 367

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/371 (77%), Positives = 331/371 (89%), Gaps = 3/371 (0%)

Query: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60
           MLRS  ++ +  R  A+  A K LTIGLIPGDGIGKEVIPAGK VLENL+SKH L FNFI
Sbjct: 1   MLRSTVSQFAR-RSYAS--AAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFI 57

Query: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120
           DL AG+QTF +TGKALPDET+++LK  CQGALFGAVQSPT KVEGYSSPIVALR+++GL+
Sbjct: 58  DLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117

Query: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180
           ANVRPVKSV+G  D+P+DM+IVRENTEDLYIK EKTYID+ TGTRVA+A KRISE AT  
Sbjct: 118 ANVRPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTD 177

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240
           IA IA++I+L+RL+  G+ATLTVTHKSNVLSQSDGLFRE+CK VYESNK++YG I YNEQ
Sbjct: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQ 237

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300
           IVDSMVYRLFREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG + ++GEPCHG
Sbjct: 238 IVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHG 297

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360
           SAPDIAGKGI+NPIATIRSTALMLEF+G+  AAQDI+KAVD N+RE  IKTPDLGGK++T
Sbjct: 298 SAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTT 357

Query: 361 QQVVEDVLSRL 371
           QQVV+D+LS++
Sbjct: 358 QQVVDDILSKM 368

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/371 (75%), Positives = 330/371 (88%), Gaps = 1/371 (0%)

Query: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60
           MLR+   R +  R    N AR +LTIGLIPGDGIGKEVIPAGK+VLE +  K+ + F FI
Sbjct: 1   MLRNGVYR-ACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFI 59

Query: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120
           DL+AG+QTF +TGKALPDETV +LK+QCQGALFGAVQSPTTKVEGYSSPIVALR+++GL+
Sbjct: 60  DLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLY 119

Query: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180
           AN+RPVKSV G  D+P+DMVIVRENTEDLYIK E+TYID+ATGT+VA+ATKRISE+ATR+
Sbjct: 120 ANIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRK 179

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240
           IA IA+DIAL+RL+  G+ATLTVTHKSNVLSQSDGLFRE+C++VYE NKD YG + YNEQ
Sbjct: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQ 239

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300
           IVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+I+IGEPCHG
Sbjct: 240 IVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHG 299

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360
           SAPDI+G+GI+NP+ATIRS ALML+FLG+N AA+DI  AVD N+R G IKTPDLGG +ST
Sbjct: 300 SAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSST 359

Query: 361 QQVVEDVLSRL 371
            +V +D+LS+L
Sbjct: 360 TEVTDDILSKL 370

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/372 (77%), Positives = 327/372 (87%), Gaps = 4/372 (1%)

Query: 1   MLRSVATRLSTCRGLATNAAR-KSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNF 59
           MLR+   + S     A NA+  K+LTIGLIPGDGIGKEVIPAGKQVL+NLN KHGL+F F
Sbjct: 1   MLRTSVRQFSVS---ARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEF 57

Query: 60  IDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGL 119
           IDL AG+QTF +TG ALP +TV +LK +CQGALFGAVQSPTTKVEGYSSPIV LR+E+GL
Sbjct: 58  IDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGL 117

Query: 120 FANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATR 179
           FANVRPVK+VEG   KPID+VIVRENTEDLYIKIEKTY D   G+R+A+ATKRI+E AT+
Sbjct: 118 FANVRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATK 177

Query: 180 RIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNE 239
           RIA  A+DIAL+RL+T+G ATLTVTHKSNVLSQSDGLFRE+CKEVYESNK  Y  + YNE
Sbjct: 178 RIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNE 237

Query: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 299
           QIVDSMVYRLFREP+CFDVIVAPNLYGDILSDGAAALVGSLG+VPSANVGP IVIGEPCH
Sbjct: 238 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCH 297

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAS 359
           GSAPDIAGKGIANPIATIRSTA MLE+LG++N AQDIYKAVDAN+R+  IKT DLGG ++
Sbjct: 298 GSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDST 357

Query: 360 TQQVVEDVLSRL 371
           TQQV++D+L +L
Sbjct: 358 TQQVIDDILGKL 369

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/371 (77%), Positives = 321/371 (86%)

Query: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60
           MLR         R +   + + +LTIGLIPGDGIGKEVIP+G+QVLE +  KHGL+FNFI
Sbjct: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60

Query: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120
           DL AG+QTF +TGKALP ETVK L+E C GALFGAVQSPTTKVEGYSSPIVALR+E+GL+
Sbjct: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120

Query: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180
           AN+RPVKSV+   +K +DMVIVRENTEDLYIK+EKTYID+ TGTRVADATKRISE+ATRR
Sbjct: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRR 180

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240
           IA IA+DIAL+RL+  G   LTVTHKSNVLSQSDGLFRE+CKEV+ESNK  Y  I+YNEQ
Sbjct: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQ 240

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300
           I+DSMVYRLFREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHG
Sbjct: 241 IIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHG 300

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360
           SAPDIAGKGI+NPIATIRSTALMLEFLGH+ AAQDI  AVD+NLRE  IKTPDLGGK ST
Sbjct: 301 SAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360

Query: 361 QQVVEDVLSRL 371
             VV DV+ RL
Sbjct: 361 SDVVNDVIRRL 371

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/371 (72%), Positives = 312/371 (84%), Gaps = 5/371 (1%)

Query: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60
           MLR    +LST     T    KS TIGLIPGDGIGKEVIP G++VLE +  K+G+ F +I
Sbjct: 1   MLRVGRGQLST----RTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYI 56

Query: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120
           DL AG+QTF +TGKALPD+TV+ L+  CQGALFGAVQSPTTKV+GYSSPIVALR+ +GL+
Sbjct: 57  DLQAGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLY 116

Query: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180
           AN+RPVKSV+G  D+P+D+VI RENTEDLYIK E+TYIDK TG RVA+A KRISE ATR 
Sbjct: 117 ANIRPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRN 176

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240
           IA IA++IAL+RL+ +G ATLTVTHKSNVLSQSDGLFREICK VY+SNK K+  ++YNEQ
Sbjct: 177 IANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQ 235

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300
           IVDSMVYRLF+EPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPS NVGP IVIGEPCHG
Sbjct: 236 IVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHG 295

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360
           SAPDI G+GIANPIATIRS AL+LEFLG   AA+ I K VD N+RE  IKTPDLGG ++ 
Sbjct: 296 SAPDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTG 355

Query: 361 QQVVEDVLSRL 371
           +QV  D+LSR+
Sbjct: 356 EQVANDILSRI 366

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/371 (68%), Positives = 309/371 (83%), Gaps = 4/371 (1%)

Query: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60
           M RS AT L      AT A  K+LTIGLIPGDGIGKEVIPAG++VLE +  KH + F++ 
Sbjct: 1   MHRSSATSLIHK---ATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYE 57

Query: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120
            L AG+QTF ETG ALP  TV+ L+E+CQGALFGAVQSPTTKVEGYSSPIVALRR++GL+
Sbjct: 58  HLDAGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLY 117

Query: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180
           AN+RPVKSV G   +P+D+VIVRENTEDLY++ E+TY+D ATG RVA+A KRISE AT R
Sbjct: 118 ANIRPVKSVSG-TGQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATER 176

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240
           IA I++ +AL+R +  G   LTVTHKSNVLSQ+DGLF+E+C+EVYE+NK  YG I+YNEQ
Sbjct: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQ 236

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300
           IVDSMVYRLF+EP CFDV+VAPNLYGD+LSDGAAALVGSLG+VPS NVG  I+IGEPCHG
Sbjct: 237 IVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHG 296

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360
           SAPDIAG+GIANPIATIRS +LML+FLG   AA DI +AV  NL++  + +PDLGGK +T
Sbjct: 297 SAPDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTT 356

Query: 361 QQVVEDVLSRL 371
           Q+V++D+L+R+
Sbjct: 357 QEVLDDILARI 367

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  190 bits (482), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 139/390 (35%), Positives = 203/390 (52%), Gaps = 40/390 (10%)

Query: 1   MLRSVATRLSTCRGLAT-------------NAARKSLTIGLIPGDGIGKEVIPAGKQVLE 47
           M R++  R +T R L+              N +    T+  I GDGIG E+  + KQ+ +
Sbjct: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60

Query: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYS 107
              +K  + +   D+   F     T   +P+  V+ + +    AL G + +P  K  G+ 
Sbjct: 61  A--AKVPIDWEPCDVSPLFINGLTT---IPEPAVQSINKNLV-ALKGPLATPIGK--GHR 112

Query: 108 SPIVALRREMGLFANVRPVKSVEGGKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTR 165
           S  + LR+  GLFANVRP KS+EG K     +D+VI+RENTE  Y  IE           
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPG----- 167

Query: 166 VADATKRISEIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVY 225
           V  + K I+  A+ R+   A + A    +  G   + V HKS +   +DGLF ++ KE+ 
Sbjct: 168 VVQSIKLITRDASERVIRYAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELS 223

Query: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGV 282
           +    +Y  I+   +++D+ V  +   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 224 Q----EYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGL 279

Query: 283 VPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDA 342
            PSAN+G E+ I E  HGSAPDIAG+  ANP A + S+ +ML  +G NN A  I KAV +
Sbjct: 280 TPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLS 339

Query: 343 NLREGAI-KTPDLGGKASTQQVVEDVLSRL 371
            +  G   +T DL GKA+T    + V+ RL
Sbjct: 340 TIASGPEGRTGDLAGKATTSSFTDAVIGRL 369

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  187 bits (474), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 140/390 (35%), Positives = 199/390 (51%), Gaps = 40/390 (10%)

Query: 1   MLRSVATRLSTCRGLAT-------------NAARKSLTIGLIPGDGIGKEVIPAGKQVLE 47
           MLR+   R ++ R LAT             N +    T+  I GDGIG E+  + K++  
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYS 107
             N    + + F D+   F     T   +PD  V+ + +    AL G + +P  K  G+ 
Sbjct: 61  AANVP--IEWEFCDVNPIFVNGLTT---IPDPAVQSITKNLV-ALKGPLATPIGK--GHR 112

Query: 108 SPIVALRREMGLFANVRPVKSVEGGKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTR 165
           S  + LR+  GLFANVRP KSVEG K   + +D+V++RENTE  Y  IE           
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG----- 167

Query: 166 VADATKRISEIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVY 225
           V  + K I+  A+ R+   A + A    +  G   + V HKS +   +DGLF  + KE+ 
Sbjct: 168 VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKEL- 222

Query: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGV 282
                +Y  I    +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 223 ---SKEYPDITLETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGL 279

Query: 283 VPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDA 342
            PSAN+G +I I E  HGSAPDIAG+  ANP A + S+ +ML  +G  N A  I  AV +
Sbjct: 280 TPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVLS 339

Query: 343 NLREGA-IKTPDLGGKASTQQVVEDVLSRL 371
            +  G   +T DL G A+T    E V+ RL
Sbjct: 340 TIASGPENRTGDLAGAATTSSFTEAVIKRL 369

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  184 bits (466), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 128/350 (36%), Positives = 185/350 (52%), Gaps = 25/350 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVL 84
           T+ LIPGDG+GKEV  +  ++ EN N    + +  ID+ +G +  +   +A     V+ L
Sbjct: 31  TVTLIPGDGVGKEVTDSVVKIFENENIP--IDWETIDI-SGLENTENVQRA-----VESL 82

Query: 85  KEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKDK--PIDMVIV 142
           K    G L G   +P  +  G+ S  VALR+++ +FANV   KS+ G K +   IDMVI+
Sbjct: 83  KRNKVG-LKGIWHTPADQT-GHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDMVII 140

Query: 143 RENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQTRGEATLT 202
           RENTE  Y  +E   +       V ++ K ++   + RIA  A D ALK        ++ 
Sbjct: 141 RENTEGEYSGLEHESVPG-----VVESLKIMTRAKSERIARFAFDFALKN----NRKSVC 191

Query: 203 VTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIVAP 262
             HK+N++   DGLFR    E+     ++Y ++     IVD+   +   +P  FDV+V P
Sbjct: 192 AVHKANIMKLGDGLFRNTVNEI---GANEYPELDVKNIIVDNASMQAVAKPHQFDVLVTP 248

Query: 263 NLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGIANPIATIRSTA 321
           NLYG IL +  +AL+G  G+VP AN G E  + EP       DI G+ +ANP A I S+ 
Sbjct: 249 NLYGSILGNIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSST 308

Query: 322 LMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQQVVEDVLSRL 371
           LML  LG N  A  I KA    + EG   T D+GG AST +    V+ +L
Sbjct: 309 LMLRHLGLNAYADRISKATYDVISEGKSTTRDIGGSASTSEFTNAVIEKL 358

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  183 bits (465), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 136/383 (35%), Positives = 195/383 (50%), Gaps = 36/383 (9%)

Query: 1   MLRSVATRLSTCRGLATNAARKSL---------TIGLIPGDGIGKEVIPAGKQVLENLNS 51
           M R+  + + T RG A  A R+ L         T+ LIPGDGIGKEV  +  Q+ E  N 
Sbjct: 1   MFRNTLSHI-TKRGYA--AGREQLLPKKYGGRYTVTLIPGDGIGKEVTDSVVQIFEAENV 57

Query: 52  KHGLSFNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIV 111
              + +  ++L A  +  +   KA     V+ LK    G L G   +P  +  G+ S  V
Sbjct: 58  P--VDWESVELSALEENHEGVQKA-----VESLKRNKVG-LKGIWHTPADQT-GHGSLNV 108

Query: 112 ALRREMGLFANVRPVKSVEGGKDK--PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADA 169
           A R+++ +FANV   KS  G K K   +D+VI+RENTE  Y  +E   +       V ++
Sbjct: 109 AFRKQLDIFANVALFKSFPGVKTKLQDVDLVIIRENTEGEYSGLEHESVPG-----VVES 163

Query: 170 TKRISEIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNK 229
            K +++  + RIA  A D ALK         +   HK+N++   DGLFR    E+     
Sbjct: 164 LKIMTKAKSERIARFAFDFALKN----NRKAVCAVHKANIMKLGDGLFRNTVSEI---GA 216

Query: 230 DKYGQIKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG 289
            +Y ++  +  IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN G
Sbjct: 217 KEYPEVNVSSIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFG 276

Query: 290 PEIVIGEP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGA 348
            E  + EP C     DI G+ +ANP A I S+ LML  LG N  A  I +A    + EG 
Sbjct: 277 REYAVFEPGCRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNEYADRISRATYETIAEGK 336

Query: 349 IKTPDLGGKASTQQVVEDVLSRL 371
             T D+GG A+T +    V+ +L
Sbjct: 337 RTTKDIGGTATTTEFTNAVIDKL 359

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  183 bits (464), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 131/352 (37%), Positives = 189/352 (53%), Gaps = 29/352 (8%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNF--IDLYAGFQTFQETGKALPDETVK 82
           T+ LIPGDGIGKEV  +  ++     +  GL  ++  ID+  G     E  KA+  E++K
Sbjct: 30  TVTLIPGDGIGKEVTDSVVKIF----ASQGLPIDWERIDV-PGMSNENEVKKAV--ESLK 82

Query: 83  VLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKDK--PIDMV 140
             K   +G     +   +    GY S  VALR+++ +FANV   KS++G K K   +D+V
Sbjct: 83  RNKIGLKG-----IWHTSADQTGYGSLNVALRKQLDIFANVAIFKSLKGVKTKIPDVDLV 137

Query: 141 IVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQTRGEAT 200
           ++RENTE  Y  +E   +       V ++ K I++  T RIA  A D AL+       +T
Sbjct: 138 VIRENTEGEYSGLEHESVPG-----VVESLKIITKPKTERIARFAFDFALEN----NRST 188

Query: 201 LTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIV 260
           +T  HK+N++  SDGLF+    EV E    +Y  IK N  IVD+   +   +P  FDV+V
Sbjct: 189 VTAVHKANIMKLSDGLFKNTVAEVGEK---EYPDIKVNTIIVDNASMQAVAKPHQFDVMV 245

Query: 261 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGIANPIATIRS 319
            P++YG IL +  AAL+G  G++P AN G E  + EP       DI  + IANP A I S
Sbjct: 246 TPSMYGTILGNIGAALIGGPGLIPGANYGREHAVFEPGSRHVGLDIENQNIANPTAMILS 305

Query: 320 TALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQQVVEDVLSRL 371
             LML  LG    ++ I  AV A + EG   T D+GG AST +  + V+ +L
Sbjct: 306 ATLMLNQLGLREESKRISNAVYAVIEEGKTTTKDIGGNASTTEFTDAVIDKL 357

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  182 bits (462), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 140/390 (35%), Positives = 198/390 (50%), Gaps = 40/390 (10%)

Query: 1   MLRSVATRLSTCRGLAT-------------NAARKSLTIGLIPGDGIGKEVIPAGKQVLE 47
           MLRS   R ++ R LAT             N +    T+  I GDGIG E+  + K++  
Sbjct: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60

Query: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYS 107
             N    + +   D+   F     T   +PD  V+ +      AL G + +P  K  G+ 
Sbjct: 61  AANVP--IEWESCDVNPIFVNGLTT---IPDAAVQSITNNLI-ALKGPLATPIGK--GHR 112

Query: 108 SPIVALRREMGLFANVRPVKSVEGGKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTR 165
           S  + LR+  GLFANVRP KSVEG K   + +D+V++RENTE  Y  IE           
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG----- 167

Query: 166 VADATKRISEIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVY 225
           V  + K I+  A+ R+   A + A    +  G   + V HKS +   +DGLF  + KE+ 
Sbjct: 168 VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKELS 223

Query: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGV 282
           +    +Y  I    +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 224 K----EYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGL 279

Query: 283 VPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDA 342
            PSAN+G +I I E  HGSAPDIAG+  ANP A + S+ +ML  +G  N A  I  AV +
Sbjct: 280 TPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLS 339

Query: 343 NLREGA-IKTPDLGGKASTQQVVEDVLSRL 371
            +  G   +T DL G A+T    E V+ RL
Sbjct: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  182 bits (461), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 137/390 (35%), Positives = 198/390 (50%), Gaps = 40/390 (10%)

Query: 1   MLRSVATRLSTCRGLAT-------------NAARKSLTIGLIPGDGIGKEVIPAGKQVLE 47
           MLR+   R ++ R LAT             N +    T+  I GDGIG E+  + K++  
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYS 107
             N    + +   D+   F     T   +PD  V+ + +    AL G + +P  K  G+ 
Sbjct: 61  AANVP--IEWESCDVSPIFVNGLTT---IPDPAVQSITKNLV-ALKGPLATPIGK--GHR 112

Query: 108 SPIVALRREMGLFANVRPVKSVEGGKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTR 165
           S  + LR+  GLFANVRP KS+EG K   + +D+V++RENTE  Y  IE           
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG----- 167

Query: 166 VADATKRISEIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVY 225
           V  + K I+  A+ R+   A + A    +  G   + V HKS +   +DGLF  + KE+ 
Sbjct: 168 VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKEL- 222

Query: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGV 282
                +Y  +    +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 223 ---SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGL 279

Query: 283 VPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDA 342
            PSAN+G +I I E  HGSAPDIAG+  ANP A + S+ +ML  +G  N A  I  AV +
Sbjct: 280 TPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLS 339

Query: 343 NLREGA-IKTPDLGGKASTQQVVEDVLSRL 371
            +  G   +T DL G A+T    E V+ RL
Sbjct: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  181 bits (460), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 135/390 (34%), Positives = 200/390 (51%), Gaps = 40/390 (10%)

Query: 1   MLRSVATRLSTCRGLAT-------------NAARKSLTIGLIPGDGIGKEVIPAGKQVLE 47
           MLR+   R ++ R L+T             + +    T+  I GDGIG E+  + K++  
Sbjct: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYS 107
             +    +++ F D+   F     T   +PD  V+ + +    AL G + +P  K  G+ 
Sbjct: 61  AADVP--INWEFCDVNPIFVNGLTT---IPDPAVQSITKNLV-ALKGPLATPIGK--GHR 112

Query: 108 SPIVALRREMGLFANVRPVKSVEGGKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTR 165
           S  + LR+  GLFANVRP KS+EG K   + +D+V++RENTE  Y  IE           
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG----- 167

Query: 166 VADATKRISEIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVY 225
           V  + K I+  A+ R+   A + A    +  G   + V HKS +   +DGLF  + KE+ 
Sbjct: 168 VVQSIKLITREASERVIRYAFEYA----RAIGRPRIIVVHKSTIQRLADGLFVNVAKEL- 222

Query: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGV 282
                +Y  I +  +++D+ V  +   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 223 ---SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGL 279

Query: 283 VPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDA 342
            PSAN+G ++ I E  HGSAPDIAGK  ANP A + S+ +ML  +G  + A  I  AV +
Sbjct: 280 TPSANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLS 339

Query: 343 NLREGA-IKTPDLGGKASTQQVVEDVLSRL 371
            +  G   +T DL G A+T    E V+ RL
Sbjct: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  181 bits (458), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 132/370 (35%), Positives = 192/370 (51%), Gaps = 33/370 (8%)

Query: 13  RGLATNAARKSL--------TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYA 64
           R LAT AA + L        T+ LIPGDG+GKEV  +   + E+ N    + +  +++ +
Sbjct: 11  RSLATMAAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENIP--IDWETVEI-S 67

Query: 65  GFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVR 124
           G    +   KA     V+ LK    G L G   +P+ +  G+ S  VALR+++ +FANV 
Sbjct: 68  GLDNQEGVQKA-----VESLKRNKVG-LKGIWHTPSDQT-GHGSLNVALRKQLDIFANVA 120

Query: 125 PVKSVEG--GKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIA 182
             KSV G   +   +DMV++RENTE  Y  +E   +       V ++ K +++  + RI 
Sbjct: 121 LFKSVPGVPSRHSNVDMVVIRENTEGEYSGLEHESVPG-----VVESLKIMTKAKSERIG 175

Query: 183 TIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIV 242
             A D A+K        ++   HK+N++   DGLFR    EV      +Y +I     IV
Sbjct: 176 RFAFDFAVKN----NRKSVCAVHKANIMKLGDGLFRNCINEV---GAKEYPEIDVKNIIV 228

Query: 243 DSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGS 301
           D+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN G E  + EP     
Sbjct: 229 DNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGSRHV 288

Query: 302 APDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQ 361
             DI G+ +ANP A I S++LML  LG N  A  I KA    + E    T D+GG AST 
Sbjct: 289 GLDIKGQNVANPTAMILSSSLMLRHLGLNAYADRISKATYDVIAEAKTTTQDIGGSASTT 348

Query: 362 QVVEDVLSRL 371
           +  E ++S+L
Sbjct: 349 EFTEAIISKL 358

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  181 bits (458), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 134/380 (35%), Positives = 198/380 (52%), Gaps = 40/380 (10%)

Query: 11  TCRGLAT-------------NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSF 57
           +CR LAT             N      T+  I GDG+G E+  + K +     +K  + +
Sbjct: 10  SCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA--AKVPIEW 67

Query: 58  NFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREM 117
              D+   F     T   +PD  V  + +    AL G + +P  K  G+ S  + LR+  
Sbjct: 68  ESCDVSPIFVNGLTT---IPDPAVASINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTF 121

Query: 118 GLFANVRPVKSVEGGKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISE 175
           GLFANVRP KS+EG K   + +++V++RENTE  Y  IE      A G  V  + K I++
Sbjct: 122 GLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVV---APG--VVQSIKLITQ 176

Query: 176 IATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQI 235
            A+ R+   A + A    +    + + V HKS +   +DGLF ++ K++      +Y  I
Sbjct: 177 DASERVIRYAFEYA----RAVDRSKVLVVHKSTIQRLADGLFVDVAKKL----SSEYPDI 228

Query: 236 KYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEI 292
           +   +++D+ V +  + P+ +D  V+V PNLYGDILSD  + L  GSLG+ PSAN+G  +
Sbjct: 229 ELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTV 288

Query: 293 VIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAI-KT 351
            I E  HGSAPDIAG+  ANP A + S+ +ML  +G    A  I KAV   +   A  +T
Sbjct: 289 SIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRT 348

Query: 352 PDLGGKASTQQVVEDVLSRL 371
            DLGG AST    + V+ RL
Sbjct: 349 GDLGGSASTSSFTDAVIERL 368

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  179 bits (454), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 136/370 (36%), Positives = 190/370 (51%), Gaps = 33/370 (8%)

Query: 13  RGLATNAARKSL--------TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYA 64
           R LAT A  + L        T+ LIPGDG+GKEV  +   + E  N    + +  I++  
Sbjct: 11  RSLATVATEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFEAENVP--IDWETINI-T 67

Query: 65  GFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVR 124
           G  + +   KA     V+ LK    G L G   +P  +  G+ S  VA R+++ +FANV 
Sbjct: 68  GVDSEEGVQKA-----VESLKRNKIG-LKGIWHTPADQT-GHGSLNVAFRKQLDIFANVA 120

Query: 125 PVKSVEGGKDK--PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIA 182
             K+V G K K   ID+V++RENTE  Y  +E   +       V ++ K I++  + RIA
Sbjct: 121 LFKNVPGVKTKLSNIDLVVIRENTEGEYSGLEHESVPG-----VVESLKIITKAKSERIA 175

Query: 183 TIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIV 242
             A D ALK        ++   HK+N++   DGLFR    EV  S   +Y +I     IV
Sbjct: 176 RFAFDFALKN----NRKSVCAVHKANIMKLGDGLFRNTVNEVGAS---EYPEIDVKNIIV 228

Query: 243 DSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGS 301
           D+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN G E  + EP     
Sbjct: 229 DNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGSRHV 288

Query: 302 APDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQ 361
             DI GK +ANP A I S+ LML  LG N  A  I KA    + EG   T D+GG +ST 
Sbjct: 289 GLDIKGKDLANPTAMILSSTLMLRHLGLNGYADRISKATYDVIAEGKHTTKDIGGSSSTT 348

Query: 362 QVVEDVLSRL 371
           +  + V+ +L
Sbjct: 349 EFTKSVIDKL 358

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  179 bits (454), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 126/350 (36%), Positives = 183/350 (52%), Gaps = 24/350 (6%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVL 84
           T+ LIPGDG+GKEV  +   + E  N    + +  ++L    +  +   KA     V+ L
Sbjct: 31  TVTLIPGDGVGKEVTDSVVNIFEAENVP--IDWESVELSGLEENMEGVQKA-----VESL 83

Query: 85  KEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKDK--PIDMVIV 142
           K    G L G   +P  +  G+ S  VA R+++ +FANV   KS  G K K   +D+VI+
Sbjct: 84  KRNKVG-LKGIWSTPADQT-GHGSLNVAFRKQLDIFANVALFKSFPGVKTKLKDVDLVII 141

Query: 143 RENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQTRGEATLT 202
           RENTE  Y  +E   +       V ++ K +++  + RIA  A D ALK        ++ 
Sbjct: 142 RENTEGEYSGLEHESVPG-----VVESLKIMTKAKSERIARFAFDFALKN----NRRSVC 192

Query: 203 VTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIVAP 262
             HK+N++   DGLFR    E+      +Y +++    IVD+   +   +P  FDV+V P
Sbjct: 193 AVHKANIMKLGDGLFRNTVNEI---GAKEYPELEVKSIIVDNASMQAVAKPHQFDVLVTP 249

Query: 263 NLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGIANPIATIRSTA 321
           NLYG IL +  AAL+GS G+VP AN G E  + EP       DI G+ +ANP A I S+ 
Sbjct: 250 NLYGSILGNVGAALIGSPGLVPGANFGREYAVFEPGSRHVGLDIKGQDVANPTAMILSST 309

Query: 322 LMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQQVVEDVLSRL 371
           LML  LG N+ A  I KA    + EG   T D+GG AST Q  + ++ +L
Sbjct: 310 LMLRHLGLNDYADRISKATYEVIAEGKHTTKDIGGHASTTQFTKAIVDKL 359

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  181 bits (458), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 134/390 (34%), Positives = 198/390 (50%), Gaps = 40/390 (10%)

Query: 1   MLRSVATRLSTCRGLAT-------------NAARKSLTIGLIPGDGIGKEVIPAGKQVLE 47
           M RS   R +T R L+              N +    T+  I GDGIG E+  + KQ+  
Sbjct: 54  MFRSSILRTTTRRLLSVKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFS 113

Query: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYS 107
              +K  + +   D+      F +    +P+  V+ + +    AL G + +P  K  G+ 
Sbjct: 114 A--AKVPIEWETCDVTP---LFIDGLTTIPEPAVQSINKNLV-ALKGPLATPIGK--GHR 165

Query: 108 SPIVALRREMGLFANVRPVKSVEGGKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTR 165
           S  + LR+  GLFANVRP +SV+G K     +D+V++RENTE  Y  IE           
Sbjct: 166 SLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPG----- 220

Query: 166 VADATKRISEIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVY 225
           V  + K I+  A+ R+    +  A +  +  G   L V HKS +   SDGLF  + KE+ 
Sbjct: 221 VVQSIKLITREASERV----IRYAFEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKEL- 275

Query: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGV 282
                +Y  I++  +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 276 ---SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGL 332

Query: 283 VPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDA 342
            PS N+G EI I E  HGSAPDIAGK +ANP A + S+ +ML  +G +  A  I  AV +
Sbjct: 333 TPSGNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLS 392

Query: 343 NLREGA-IKTPDLGGKASTQQVVEDVLSRL 371
            +  G   +T DL G A+T    + V+ +L
Sbjct: 393 TIASGPESRTGDLAGTATTSTFTDAVIKKL 422

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  178 bits (451), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 134/382 (35%), Positives = 201/382 (52%), Gaps = 33/382 (8%)

Query: 2   LRSVATRLSTCR---GLAT---NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGL 55
           LR+V+  LST +   G  T   + A    T+  I GDG+G E+  + K++     +K  +
Sbjct: 8   LRTVSRFLSTGQPSIGRFTGKPDPATGKFTVPFIEGDGVGPEISESVKKIFSA--AKVPI 65

Query: 56  SFNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRR 115
            +   D+   F   Q T   +P+  V+++ +    AL G + +P  K  G+ S  + LR+
Sbjct: 66  EWVPCDVGPIFVNGQTT---IPEPAVELINKHLI-ALKGPLATPIGK--GHRSLNLTLRK 119

Query: 116 EMGLFANVRPVKSVEGGKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRI 173
              LFANVRP +S+   K   + +D+V++RENTE  Y  IE           V  + K I
Sbjct: 120 TFNLFANVRPARSIPNYKSTYENVDLVLIRENTEGEYSGIEHVITPG-----VIQSIKLI 174

Query: 174 SEIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYG 233
           +  AT R+   A +      Q  G   L V HKS +   +DGLF ++ +E+      +Y 
Sbjct: 175 TREATERVVRYAFEYT----QAIGRPRLLVIHKSTIQRMADGLFVKVAEEL----ASEYP 226

Query: 234 QIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGP 290
            IK   +I+D  +  +  +P+ +   V V PNLYGDILSD  + L  GSLG+ PSAN+G 
Sbjct: 227 DIKLETEIIDKSILNVVSKPELYSDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGD 286

Query: 291 EIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGA-I 349
           ++ I E  HGSAPDIAG+  ANP A + S+ +ML+ +G +  A  I  AV   +  G+  
Sbjct: 287 KVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLKHMGLDEHANKIENAVLTTIASGSEN 346

Query: 350 KTPDLGGKASTQQVVEDVLSRL 371
           +T DL G AST    E+V+ RL
Sbjct: 347 RTADLSGTASTSSFTEEVIQRL 368

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  177 bits (450), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 189/351 (53%), Gaps = 26/351 (7%)

Query: 24  LTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKV 83
           +T+ L+PGDG+GKE+  +   + +  N    + +  +D+    Q   E G    +  V+ 
Sbjct: 29  MTVTLLPGDGVGKEITDSVVSIFQAENVP--IDWETVDIS---QLDHEDGV---NAAVES 80

Query: 84  LKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKDK--PIDMVI 141
           LK    G L G   +   +V G+ S  VA R+++ ++ANV   KS+ G K K   +D+VI
Sbjct: 81  LKRNKIG-LKGIWHTSADQV-GHGSLNVAFRKQLDIYANVAFCKSIPGVKTKIPNVDLVI 138

Query: 142 VRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQTRGEATL 201
           +RENTE  Y  +E   +       V ++ K ++++ + RIA  A D A++         +
Sbjct: 139 IRENTEGEYSGLEHESVPG-----VVESLKIVTKVNSERIAKFAFDFAMRH----DRKMV 189

Query: 202 TVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIVA 261
           T  HK+N++  SDGLFR     V E+    Y QIK +  IVD+   +   +P  FDV+V 
Sbjct: 190 TAVHKANIMKLSDGLFRNTVARVGEA----YPQIKNDSIIVDNASMQAVAKPHQFDVMVT 245

Query: 262 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGIANPIATIRST 320
           P++YG IL +  AAL+G  G+VP  N G E  + EP       DI G+ +ANP A I S+
Sbjct: 246 PSMYGTILGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDIKGQNVANPTAMILSS 305

Query: 321 ALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQQVVEDVLSRL 371
            L+L+ LG N+ A  I KAV   ++EG   T D+GG AST +  + V+ +L
Sbjct: 306 TLLLQHLGLNDTASRISKAVYDVIKEGNATTKDIGGNASTTEFTKAVIDKL 356

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  178 bits (451), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 134/398 (33%), Positives = 204/398 (51%), Gaps = 52/398 (13%)

Query: 1   MLRSVATRLSTCRGLAT-----------------NAARKSLTIGLIPGDGIGKEVIPAGK 43
           MLR++A + S  R  +T                 N +    T+  I GDG+G E+  + K
Sbjct: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60

Query: 44  QVLENLNSKHGLSFNFID----LYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSP 99
            + +   ++  + + + D    L  G  T       +P+  V+ + +  + AL G + +P
Sbjct: 61  DIFKA--AQVPVDWEYCDVSPLLINGLTT-------IPEPAVQQINKH-KIALKGPLATP 110

Query: 100 TTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKD--KPIDMVIVRENTEDLYIKIEKTY 157
             K  G+ S  + LR+  GLFANVRP +S+ G +   K +D+V++RENTE  Y  IE   
Sbjct: 111 IGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVV 168

Query: 158 IDKATGTRVADATKRISEIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLF 217
              A G  V  + K I+  A+ R+   A + A    +  G   L V HKS +   +DGLF
Sbjct: 169 ---APG--VVQSIKLITRDASERVIRYAYEYA----RAIGRPRLVVVHKSTIQKLADGLF 219

Query: 218 REICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAA 275
             I KE+      ++  IK   +++D+ V  + R+P  +   V V PNLYGDILSD  + 
Sbjct: 220 VNIAKEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDILSDLNSG 275

Query: 276 L-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQ 334
           L  GSLG+ PSAN+G E+ I E  HGSAPDIAG+  ANP A + S+ +ML ++G  + + 
Sbjct: 276 LSAGSLGLTPSANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSN 335

Query: 335 DIYKAVDANLREGA-IKTPDLGGKASTQQVVEDVLSRL 371
            I  A+   +  G+  +T DL G A+T    E V+  L
Sbjct: 336 KIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  177 bits (449), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 130/360 (36%), Positives = 190/360 (52%), Gaps = 27/360 (7%)

Query: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77
           N A     +  I GDGIG E+  + K + +   ++  +++ F D+   F     T   +P
Sbjct: 35  NPATGKFDVSFIEGDGIGPEISQSVKDIFKA--AEVPINWEFCDVTPIFVNGLTT---IP 89

Query: 78  DETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKD--K 135
           D  V  + +    AL G + +P  K  G+ S  + LR+   LFANVRP KS+EG K    
Sbjct: 90  DPAVASINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYS 146

Query: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQT 195
            +D+V++RENTE  Y  IE      A G  V  + K I+  A+ R+   A + A    + 
Sbjct: 147 DVDLVLIRENTEGEYSGIEHVV---APG--VVQSIKLITRDASERVIRYAFEYA----KA 197

Query: 196 RGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255
            G   + V HKS +   +DGLF  + KE+ +    +Y +IK   +++D+ V  +   P  
Sbjct: 198 IGRPRVVVVHKSTIQRLADGLFVNVAKELSK----EYPEIKLETELIDNTVLNVVSNPAG 253

Query: 256 FD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIAN 312
           +   V V PNLYGDILSD  + L  GSLG+ PSAN+G EI I E  HGSAPDIAG+  AN
Sbjct: 254 YTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVHGSAPDIAGQNKAN 313

Query: 313 PIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAI-KTPDLGGKASTQQVVEDVLSRL 371
           P A + S+ +ML  +G  + A  I +AV   +   +  +T DLGG A+T    + V+  L
Sbjct: 314 PTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  177 bits (448), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 126/353 (35%), Positives = 187/353 (52%), Gaps = 27/353 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVL 84
           T+  I GDGIG E+  + K +     +K  + + + D+   F     T   +PD  V+ +
Sbjct: 39  TVSFIEGDGIGPEISQSVKDIFSA--AKVPVEWEYCDVTPIFINGLTT---IPDPAVQSI 93

Query: 85  KEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKD--KPIDMVIV 142
            +    AL G + +P  K  G+ S  + LR+  GLFANVRP KS+EG K   + +D+V++
Sbjct: 94  NKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 150

Query: 143 RENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQTRGEATLT 202
           RENTE  Y  IE           V  + K I+  A+ R+   A + A    +  G   + 
Sbjct: 151 RENTEGEYSGIEHV-----VSPGVVQSIKLITRDASERVIRYAFEYA----RAVGRPKVV 201

Query: 203 VTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIV 260
           V HKS +   +DGLF  + +EV      +Y  I+   +++D+ V  +  +P+ +   V V
Sbjct: 202 VVHKSTIQRLADGLFVNVAQEV----GKEYPDIELQPELIDNTVLNVVSKPEKYSDSVAV 257

Query: 261 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 319
            PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  ANP A + S
Sbjct: 258 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNCANPTALLLS 317

Query: 320 TALMLEFLGHNNAAQDIYKAVDANL-REGAIKTPDLGGKASTQQVVEDVLSRL 371
           + +ML  +G +  A  I  AV A +  +   +T DL G A+T    + V+ RL
Sbjct: 318 SVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATTSSFTKAVIERL 370

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  177 bits (448), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 132/375 (35%), Positives = 191/375 (50%), Gaps = 27/375 (7%)

Query: 3   RSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDL 62
           RS++ + +  R      +  + T+  I GDG+G E+  + K +    N    + +   D+
Sbjct: 23  RSISNQPTIGRFTGKTNSSGTYTVPFIEGDGVGPEISKSVKDIFSAANVP--IQWQPCDV 80

Query: 63  YAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFAN 122
              F     T   +P+  VK +KE    AL G + +P  K  G+ S  + LR+   LFAN
Sbjct: 81  GPIFVNGLTT---IPEPAVKAIKESLV-ALKGPLATPVGK--GHRSLNLTLRKTFDLFAN 134

Query: 123 VRPVKSVEGGKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180
           VRP KSV   K   + +D+V++RENTE  Y  IE           V  + K I+  A+ +
Sbjct: 135 VRPAKSVPNYKSTYENVDLVLIRENTEGEYSGIEHIVTPG-----VVQSIKLITREASEK 189

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240
           +   A + A+      G   L V HKS +    DGLF +I  E+    + +Y  IK   Q
Sbjct: 190 VIRYAYEYAI----AVGRPRLIVVHKSTIQRLGDGLFVQIANEL----QSEYPSIKLETQ 241

Query: 241 IVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEP 297
           I+D+ V  +   P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E 
Sbjct: 242 ILDNTVLNVVSNPTLYKDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEA 301

Query: 298 CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGA-IKTPDLGG 356
            HGSAPDIAG+  ANP A + S+ +ML  +G    A  I  AV + +  G   +T DLGG
Sbjct: 302 VHGSAPDIAGQNKANPTALLLSSVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLGG 361

Query: 357 KASTQQVVEDVLSRL 371
            A+T    E V+ +L
Sbjct: 362 SATTSSFTECVIKKL 376

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  176 bits (446), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 135/378 (35%), Positives = 196/378 (51%), Gaps = 30/378 (7%)

Query: 3   RSVATRLSTCRGLAT---NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNF 59
           R +AT+     G  T   + A    T+  I GDG+G E+  A K +     +K  + +  
Sbjct: 12  RFLATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA--AKAPIQWES 69

Query: 60  IDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGL 119
            D+   F     T   +P      + +    AL G + +P  K  G+ S  + LR+  GL
Sbjct: 70  CDVSPLFINGLTT---IPQPAQDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGL 123

Query: 120 FANVRPVKSVEGGKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIA 177
           FANVRP KSV+G K     +D+V++RENTE  Y  IE           V  + K I++ A
Sbjct: 124 FANVRPAKSVQGYKTAYDNVDLVLIRENTEGEYSGIEHV-----VSPGVVQSIKLITQDA 178

Query: 178 TRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKY 237
           + R+   A + A  R   R +  + V HKS +   +DGLF  + +++ +    +Y  I+ 
Sbjct: 179 SERVIRYAFEYA--RAVERPK--VVVVHKSTIQRLADGLFVSVAEQLSK----EYPDIEL 230

Query: 238 NEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVI 294
             +++D+ V    R+P  +   V+V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I
Sbjct: 231 QTELIDNTVLHTVRDPTKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSI 290

Query: 295 GEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGA-IKTPD 353
            E  HGSAPDIAG+  ANP A + S+ +ML  +G    A  I KAV   +  G   +T D
Sbjct: 291 FEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGD 350

Query: 354 LGGKASTQQVVEDVLSRL 371
           LGG AST    E V+SRL
Sbjct: 351 LGGSASTSSFAEAVISRL 368

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  176 bits (445), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 134/389 (34%), Positives = 197/389 (50%), Gaps = 39/389 (10%)

Query: 1   MLRSVATRLSTCRGLAT------------NAARKSLTIGLIPGDGIGKEVIPAGKQVLEN 48
           ML   + RL+  R LAT            N +    T+  I GDGIG E+  + K++ + 
Sbjct: 1   MLGIRSFRLNARRFLATAQPSIGRFTGKPNPSTGKFTVSFIEGDGIGPEISSSVKRIFQA 60

Query: 49  LNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSS 108
            +    + +   D+   F     T   +PD  V+ + +    AL G + +P  K  G+ S
Sbjct: 61  ADVP--VEWETCDVTPIFVNGLTT---IPDPAVQSINKNLV-ALKGPLATPIGK--GHRS 112

Query: 109 PIVALRREMGLFANVRPVKSVEGGKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTRV 166
             + LR+   LFANVRP KS+EG K   + +D+V++RENTE  Y  IE           V
Sbjct: 113 LNLTLRKTFNLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHL-----VSPGV 167

Query: 167 ADATKRISEIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYE 226
             + K I+  A+ R+   A + A    +  G   L V HKS +   +DGLF  + KE+  
Sbjct: 168 VQSIKLITRDASERVIRYAYEYA----RAIGRPRLIVVHKSTIQRLADGLFVNVAKEL-- 221

Query: 227 SNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVV 283
               +Y  I+   +++D+    +   P  +   V V PNLYGDILSD  + L  GSLG+ 
Sbjct: 222 --AAEYPDIQLETELIDNTCLNVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLT 279

Query: 284 PSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDAN 343
           PSAN+G ++ I E  HGSAPDIAG+  ANP A + S+ +ML  +G    A  I KAV   
Sbjct: 280 PSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGMTEHADRIEKAVLGT 339

Query: 344 LREGA-IKTPDLGGKASTQQVVEDVLSRL 371
           +  G+  +T DLGG AST    + ++ +L
Sbjct: 340 IAGGSEYRTGDLGGSASTTSFTDAIIKKL 368

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  176 bits (445), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 131/366 (35%), Positives = 191/366 (52%), Gaps = 40/366 (10%)

Query: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFID----LYAGFQTFQETG 73
           NAA K  T+  I GDG+G E+  + K +    +    + + + D    L  G  T  E  
Sbjct: 30  NAAGK-YTVSFIEGDGVGPEISQSVKDIFSAASVP--VEWEYCDVTPLLVNGLTTIPEPA 86

Query: 74  KALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGK 133
            A  ++ +  LK        G + +P  K  G+ S  + LR+  GLFANVRP KS+EG K
Sbjct: 87  VASINKNLVALK--------GPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYK 136

Query: 134 D--KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALK 191
                +D+V++RENTE  Y  IE           V  + K I+  A+ R+   A + A  
Sbjct: 137 TTYSDVDLVLIRENTEGEYSGIEHV-----VSPGVVQSIKLITREASERVIRYAFEYA-- 189

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFR 251
             +T G   + V HKS +   +DGLF  + +E+      +Y  I+   +++D+ V  +  
Sbjct: 190 --RTVGRPKVVVVHKSTIQRLADGLFVNVAQEL----GREYPDIELQTELLDNTVLNVVT 243

Query: 252 EPQCFDVIVA--PNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGK 308
           +P+ +  +VA  PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+
Sbjct: 244 KPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVHGSAPDIAGQ 303

Query: 309 GIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANL---REGAIKTPDLGGKASTQQVVE 365
             ANP A + S+ +ML  +G +  A  I KAV + +   RE   +T DL G AST     
Sbjct: 304 NRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSREN--RTADLAGTASTSSFTN 361

Query: 366 DVLSRL 371
            V+ RL
Sbjct: 362 AVIERL 367

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  175 bits (444), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 137/379 (36%), Positives = 198/379 (52%), Gaps = 30/379 (7%)

Query: 2   LRSVATRLSTCRGLAT---NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFN 58
           LR  AT+     G  T   + A    T+  I GDG+G E+  A K +     +K  + + 
Sbjct: 11  LRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA--AKAPIQWE 68

Query: 59  FIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMG 118
             D+   F     T   +P      + +    AL G + +P  K  G+ S  + LR+  G
Sbjct: 69  TCDVTPLFINGLTT---IPQPAQDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFG 122

Query: 119 LFANVRPVKSVEGGKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEI 176
           LFANVRP KS++G K     +D+V++RENTE  Y  IE      A G  V  + K I++ 
Sbjct: 123 LFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVV---APG--VVQSIKLITQD 177

Query: 177 ATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIK 236
           A+ R+   A + A  R   R +  + V HKS +   +DGLF  + +++ +    +Y  I+
Sbjct: 178 ASERVIRYAFEYA--RAVERPK--VLVVHKSTIQRLADGLFVSVAEKLAK----EYPDIE 229

Query: 237 YNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIV 293
              +++D+ V    R+P  +   V+V PNLYGDILSD  + L  GSLG+ PSAN+G E+ 
Sbjct: 230 LQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVS 289

Query: 294 IGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGA-IKTP 352
           I E  HGSAPDIAG+  ANP A + S+ +ML  +G    A  I KAV + +  G   +T 
Sbjct: 290 IFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTG 349

Query: 353 DLGGKASTQQVVEDVLSRL 371
           DL G AST    E V+SRL
Sbjct: 350 DLAGSASTSSFAEAVISRL 368

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  175 bits (443), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 129/360 (35%), Positives = 186/360 (51%), Gaps = 27/360 (7%)

Query: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77
           N +    T+  I GDG+G E+  + K +     ++  + +   D+   F     T   +P
Sbjct: 31  NPSTGKYTVSFIEGDGVGPEISKSVKDIFAA--AEVPVEWESCDVTPLFINGLTT---IP 85

Query: 78  DETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKD--K 135
              V  + +    AL G + +P  K  G+ S  + LR+  GLFANVRP KSVEG K   +
Sbjct: 86  QPAVDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYE 142

Query: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQT 195
            +D+V++RENTE  Y  IE           V  + K I+  A+ R+   A + A    + 
Sbjct: 143 NVDLVLIRENTEGEYSGIEHV-----VSPGVVQSIKLITRDASERVIRYAFEYA----RA 193

Query: 196 RGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255
            G   + V HKS +   +DGLF ++ KE+      +Y  I+   Q++D+ V  +   P  
Sbjct: 194 VGRPKVMVVHKSTIQRLADGLFVDVAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGA 249

Query: 256 F--DVIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIAN 312
           +   V V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  AN
Sbjct: 250 YADTVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKAN 309

Query: 313 PIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGA-IKTPDLGGKASTQQVVEDVLSRL 371
           P A + S+ +ML  +G    A  I KAV + +  G   +T DL G AST    E V+ RL
Sbjct: 310 PTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  174 bits (440), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 128/357 (35%), Positives = 184/357 (51%), Gaps = 33/357 (9%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFID----LYAGFQTFQETGKALPDET 80
           T+  I GDGIG E+  + K + +  +    +++   D    L  G  T       +PDE 
Sbjct: 45  TVSFIEGDGIGPEISRSVKDIFQAASVP--ITWETCDVSPILVDGLTT-------IPDEA 95

Query: 81  VKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKD--KPID 138
           VK + +   G L G + +P  K  G+ S  + LR+   LFANVRP KSV G K     +D
Sbjct: 96  VKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVD 152

Query: 139 MVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQTRGE 198
           +V++RENTE  Y  IE           V  + K I+  A+ R+   A + A    +  G 
Sbjct: 153 LVLIRENTEGEYSGIEHVVTPG-----VVQSIKLITRDASERVIRYAFEYA----KAIGR 203

Query: 199 ATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD- 257
             + V HKS +   SDGLF  + KE+ +  +  +  I+ + +++D+ V  +   P  +  
Sbjct: 204 PKVIVVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVMNPSKYSD 261

Query: 258 -VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIA 315
            V V PNLYGDILSD  + L  GSLG+ PSAN+G +I I E  HGSAPDIAG+  ANP A
Sbjct: 262 AVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGSAPDIAGQNKANPTA 321

Query: 316 TIRSTALMLEFLGHNNAAQDIYKAVDANLREGAI-KTPDLGGKASTQQVVEDVLSRL 371
            + S+ +ML  +G N     I  AV   +   +  +T DLGG A+T    E V+  L
Sbjct: 322 LLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  173 bits (439), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 122/350 (34%), Positives = 183/350 (52%), Gaps = 25/350 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVL 84
           T+ LIPGDG+GKEV  +   + E+ N    + +  +++ +G    +   KA     V  L
Sbjct: 30  TVTLIPGDGVGKEVTDSVVSIFESENVP--IDWETVEI-SGLDNEEGVQKA-----VDSL 81

Query: 85  KEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEG--GKDKPIDMVIV 142
           K    G L G   +P+ +  G+ S  VALR+++ +FANV   K+V G   +   +D+V++
Sbjct: 82  KRNKVG-LKGIWHTPSDQT-GHGSLNVALRKQLDIFANVALFKTVPGVPSRHSNVDLVVI 139

Query: 143 RENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQTRGEATLT 202
           RENTE  Y  +E   +       V ++ K +++  + RI   A D ALK        ++ 
Sbjct: 140 RENTEGEYSGLEHESVPG-----VVESLKIMTKAKSDRIGRFAFDFALKN----NRKSVC 190

Query: 203 VTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIVAP 262
             HK+N++   DGLFR    E+      +Y +I+    IVD+   +   +P  FDV+V P
Sbjct: 191 AVHKANIMKLGDGLFRNCINEI---GAKEYPEIEVKNIIVDNASMQAVAKPHQFDVLVTP 247

Query: 263 NLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGIANPIATIRSTA 321
           NLYG IL +  AAL+G  G+VP AN G E  + EP       DI G+ +ANP A I S+A
Sbjct: 248 NLYGSILGNIGAALIGGPGLVPGANFGREFAVFEPGSRHVGLDIKGQNVANPTAMILSSA 307

Query: 322 LMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQQVVEDVLSRL 371
           LML  LG N+ A  I KA    + E    T D+GG AST    + ++ +L
Sbjct: 308 LMLRHLGLNSYADRISKATYDVIAEAKNTTKDIGGSASTTDFTQAIIEKL 357

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  173 bits (438), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 126/372 (33%), Positives = 194/372 (52%), Gaps = 26/372 (6%)

Query: 3   RSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDL 62
           R++AT     R L      +  T+ LIPGDG+GKE+  + + + E  N    + +  I++
Sbjct: 9   RTLATAAQAERTLPKKYGGR-FTVTLIPGDGVGKEITDSVRTIFEAENIP--IDWETINI 65

Query: 63  YAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFAN 122
               QT  + G     E V+ LK    G L G   +P  +  G+ S  VALR+++ ++AN
Sbjct: 66  K---QTDHKEGVY---EAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYAN 117

Query: 123 VRPVKSVEGGKDK--PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180
           V   KS++G K +   ID++++RENTE  +  +E   +       V ++ K ++   T R
Sbjct: 118 VALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPG-----VVESLKVMTRPKTER 172

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240
           IA  A D A K        ++T  HK+N++   DGLFR I  E+    + +Y  I  +  
Sbjct: 173 IARFAFDFAKKY----NRKSVTAVHKANIMKLGDGLFRNIITEI---GQKEYPDIDVSSI 225

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CH 299
           IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G +  + EP   
Sbjct: 226 IVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSR 285

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAS 359
               DI G+ +ANP A I S+ LML  LG N  A  I KAV   + EG   T D+GG +S
Sbjct: 286 HVGLDIKGQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIAEGKHTTRDIGGSSS 345

Query: 360 TQQVVEDVLSRL 371
           T     +++++L
Sbjct: 346 TTDFTNEIINKL 357

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  173 bits (439), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 138/403 (34%), Positives = 194/403 (48%), Gaps = 64/403 (15%)

Query: 1   MLRSVATRLSTCRGLATNAARK---------------SLTIGLIPGDGIGKEVIPAGKQV 45
           MLRS   R +  R LA+   ++                 T+  I GDG+G E+  + K  
Sbjct: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVK-- 58

Query: 46  LENLNSKHGLSFNFIDLYAGFQT--FQETGKALP--DETVKVLKEQCQG-------ALFG 94
                          D++A  +     E+    P     V  + EQ Q        AL G
Sbjct: 59  ---------------DIFAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKG 103

Query: 95  AVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKD--KPIDMVIVRENTEDLYIK 152
            + +P  K  G+ S  + LR+  GLFANVRP KSVEG K   + +D+V++RENTE  Y  
Sbjct: 104 PLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAG 161

Query: 153 IEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQ 212
           IE   +       V  + K I+  A+ R+   A + A    +  G   L V HKS +   
Sbjct: 162 IEHVIVPG-----VVQSIKLITREASERVIRYAYEYA----RAVGRPKLVVVHKSTIQRL 212

Query: 213 SDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILS 270
           +DGLF  + KE+      ++  I+   +++D+ V  +   P  +   V V PNLYGDILS
Sbjct: 213 ADGLFVTVAKEL----AHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDILS 268

Query: 271 DGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGH 329
           D  + L  GSLG+ PS N+G ++ I E  HGSAPDIAG+  ANP A + S+ +ML  +G 
Sbjct: 269 DLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGL 328

Query: 330 NNAAQDIYKAVDANLREGA-IKTPDLGGKASTQQVVEDVLSRL 371
              A  I KAV   +  G   +T DL G AST    E V+SRL
Sbjct: 329 FEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  173 bits (438), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 135/379 (35%), Positives = 190/379 (50%), Gaps = 29/379 (7%)

Query: 1   MLRS-VATRLSTCRGLATNAARKS----LTIGLIPGDGIGKEVIPAGKQVLENLNSKHGL 55
           MLRS V  R+      A     K       + LIPGDG+GKEV  +   + E  N    +
Sbjct: 1   MLRSAVGKRMFASVAAAEKVLPKKYGGRFVVTLIPGDGVGKEVTDSVVSIFEAENLP--I 58

Query: 56  SFNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRR 115
            ++ +D+ +G    +E  +A  D     LK    G L G   +      G  S  VALR+
Sbjct: 59  DWDRVDI-SGLD-HEEGVQAAVDS----LKRNKIG-LKGIWHTSAADQAGKGSLNVALRK 111

Query: 116 EMGLFANVRPVKSVEGGKDK--PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRI 173
           E+ ++ANV   KSV G K K   +D+V++RENTE  Y  +E   +       V ++ K +
Sbjct: 112 ELDIYANVALFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESVPG-----VVESLKIM 166

Query: 174 SEIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYG 233
           +E  T RIA  A D A K         +T  HK+N++   DGLFR +   V E    +Y 
Sbjct: 167 TEDKTERIARFAFDFAKKY----NRHAVTAVHKANIMKLGDGLFRNVVTRVGEQ---EYP 219

Query: 234 QIKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIV 293
            +K    IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G E  
Sbjct: 220 DVKVGSIIVDNASMQTVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANYGREYA 279

Query: 294 IGEP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTP 352
           + EP       DI  K IANP A I S +LML+ LG + +A  I  AV   + EG   TP
Sbjct: 280 VFEPGSRHVGLDIKDKNIANPTAMILSASLMLDHLGLSTSATKISNAVHQVIAEGKSTTP 339

Query: 353 DLGGKASTQQVVEDVLSRL 371
           D+GG AST +  + V+ +L
Sbjct: 340 DIGGSASTTEFTQAVIEKL 358

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  172 bits (437), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 126/372 (33%), Positives = 193/372 (51%), Gaps = 26/372 (6%)

Query: 3   RSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDL 62
           R++AT     R L      +  T+ LIPGDG+GKE+  + K + E    K  + +  +++
Sbjct: 9   RTLATAAQAERALPKKYGGR-FTVTLIPGDGVGKEITDSVKTIFEA--EKIPVDWETVNI 65

Query: 63  YAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFAN 122
               QT  + G     E V+ LK    G L G   +P  +  G+ S  VALR+++ ++AN
Sbjct: 66  K---QTDHKEGVY---EAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYAN 117

Query: 123 VRPVKSVEGGKDK--PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180
           V   KS++G K +   ID++++RENTE  +  +E   +       V ++ K ++   T R
Sbjct: 118 VALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPG-----VVESLKIMTRPKTER 172

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240
           IA  A D A K         +T  HK+N++   DGLFR I  E+    + +Y  I  +  
Sbjct: 173 IARFAFDFAKKY----NRKAVTAVHKANIMKLGDGLFRNIITEI---GQKEYPDIDVSSI 225

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CH 299
           IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G +  + EP   
Sbjct: 226 IVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSR 285

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAS 359
               DI G+ +ANP A I S+ LML  LG N  A  I KAV   + EG   T D+GG +S
Sbjct: 286 HVGLDIKGQNVANPTAMILSSVLMLNHLGLNEYATRISKAVHETIAEGKHTTKDIGGSSS 345

Query: 360 TQQVVEDVLSRL 371
           T     +++++L
Sbjct: 346 TTDFTNEIINKL 357

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  171 bits (434), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 126/372 (33%), Positives = 195/372 (52%), Gaps = 26/372 (6%)

Query: 3   RSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDL 62
           R++AT     R L      +  T+ LIPGDG+GKE+  + + + E    +  + +  I++
Sbjct: 9   RTLATAAQAERTLPKKYGGR-FTVTLIPGDGVGKEITDSVRTIFEA--ERIPVDWETINI 65

Query: 63  YAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFAN 122
               QT  + G     E V+ LK    G L G   +P  +  G+ S  VALR+++ ++AN
Sbjct: 66  K---QTDHKEGVY---EAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYAN 117

Query: 123 VRPVKSVEGGKDK--PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180
           V   KS++G K +   ID++++RENTE  +  +E   +       V ++ K +++  T R
Sbjct: 118 VALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPG-----VVESLKVMTKPKTER 172

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240
           IA  A D A K         +T  HK+N++   DGLFR I  E+ ++   +Y  I  +  
Sbjct: 173 IARFAFDFAKKY----NRKAVTAVHKANIMKLGDGLFRNIITEIGQT---EYPDIDVSSI 225

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CH 299
           IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G +  + EP   
Sbjct: 226 IVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSR 285

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAS 359
               DI G+ +ANP A I S+ LML  LG N  A  I KAV   + EG   T D+GG +S
Sbjct: 286 HVGLDIKGQNVANPTAMILSSVLMLNHLGLNENATRISKAVHETIAEGKHTTRDIGGSSS 345

Query: 360 TQQVVEDVLSRL 371
           T     +V+++L
Sbjct: 346 TTDFTNEVINKL 357

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  171 bits (433), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 129/389 (33%), Positives = 196/389 (50%), Gaps = 39/389 (10%)

Query: 1   MLRSVATRLSTCRGLAT------------NAARKSLTIGLIPGDGIGKEVIPAGKQVLEN 48
           MLR+   R S  R + T            N      T+  I GDG+G E+  + K +   
Sbjct: 1   MLRNTIYRGSFARMMTTGQPNIGRFTGKPNPVTGKYTVPFIEGDGVGPEISKSVKDIFAA 60

Query: 49  LNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSS 108
             +K  + +   D+   F     T   +PD  V+ + +    AL G + +P  K  G+ S
Sbjct: 61  --AKVPIEWEPCDVGPIFVNGLTT---IPDAAVQSINKHLV-ALKGPLATPIGK--GHRS 112

Query: 109 PIVALRREMGLFANVRPVKSVEGGKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTRV 166
             + LR+   LFANVRP +SV   K   + +D+V++RENTE  Y  IE           V
Sbjct: 113 LNLTLRKTFNLFANVRPARSVPNYKTTYQNVDLVLIRENTEGEYSGIEH-----VISPGV 167

Query: 167 ADATKRISEIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYE 226
             + K I++ A+ R+    +  A +  +  G   L V HKS +   +DGLF  + KE+  
Sbjct: 168 IQSIKLITKDASERV----IRYAFEYTRAIGRPRLVVVHKSTIQRMADGLFVNVAKEL-- 221

Query: 227 SNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVV 283
               +Y  I+   +++D+ +  +   P+ +   V V PNLYGDILSD  + L  GSLG+ 
Sbjct: 222 --ASEYPDIELQTELIDNTILNVVTHPESYTDAVSVCPNLYGDILSDLNSGLSAGSLGLT 279

Query: 284 PSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDAN 343
           PSAN+G ++ I E  HGSAPDIAG+  ANP A + S+ +ML  +G N  A  I  A+ + 
Sbjct: 280 PSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNEHATKIENAILST 339

Query: 344 LREGA-IKTPDLGGKASTQQVVEDVLSRL 371
           +  G+  +T DL G A+T    E V+++L
Sbjct: 340 IASGSENRTGDLAGTATTSSFTEAVINKL 368

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  170 bits (431), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 126/352 (35%), Positives = 183/352 (51%), Gaps = 27/352 (7%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVLK 85
           +  I GDGIG E+  + K +     +K  + F  + +            ++P+E  K + 
Sbjct: 38  VSFIEGDGIGPEISKSVKDIFAA--AKVPVDFESVVVKP---ILVNGVTSIPEEAQKSIN 92

Query: 86  EQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKD--KPIDMVIVR 143
                AL G + +P  K  G+ S  + LR+  GLFAN+RP KSVEG K     +++V++R
Sbjct: 93  TNLV-ALKGPLATPVGK--GHRSMNLTLRKTFGLFANLRPAKSVEGFKTIYDNVNLVLIR 149

Query: 144 ENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQTRGEATLTV 203
           ENTE  Y  IE   +       V  + K I+  A+ R+   A + A    + R    L V
Sbjct: 150 ENTEGEYAGIEHAIVPG-----VVQSIKLITREASERVIRFAYEYARAAERPR----LIV 200

Query: 204 THKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVA 261
            HKS +   SDGLF ++ KE+    + ++  IK   +++D+ V     +P  +   V V 
Sbjct: 201 VHKSTIQRLSDGLFVDVAKEL----QSEFPDIKLETELIDNAVLNTVTDPTKYSDAVSVC 256

Query: 262 PNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRST 320
           PNLYGDILSD  + L  GSLG+ PS N+G ++ I E  HGSAPDIAGK  ANP A + S+
Sbjct: 257 PNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSS 316

Query: 321 ALMLEFLGHNNAAQDIYKAVDANLREGA-IKTPDLGGKASTQQVVEDVLSRL 371
            +ML  +G +  A  I KAV   +  G   +T DL G AST    E V+ +L
Sbjct: 317 VMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSSFTEAVIKKL 368

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  169 bits (428), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 117/352 (33%), Positives = 180/352 (51%), Gaps = 30/352 (8%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVL 84
           T+ L+PGDG+G+E+  +   + E  N           L   ++  + +G  L  E V   
Sbjct: 30  TVTLLPGDGVGREITDSVVSIFEAEN-----------LPIDWERVELSG--LEQEDVHTA 76

Query: 85  KEQCQGALFG--AVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKDK--PIDMV 140
            E  +    G   +   +   +G++S  VALR+E+ ++ANV   KS +G   +   +D+V
Sbjct: 77  VESLKRNKIGLKGIWHTSADHDGHTSWNVALRKELDIYANVAIFKSFKGVDTRIPDVDLV 136

Query: 141 IVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQTRGEAT 200
           I+RENTE  Y  +E   +       V ++ K ++   T RIA  A D A+K        +
Sbjct: 137 IIRENTEGEYSGLEHESVPG-----VVESLKIMTAQKTERIARFAFDYAMKY----NRKS 187

Query: 201 LTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIV 260
           +T  HK+N++   DGLFR +  E+      +Y ++  +  IVD+   +   +P  FDV+V
Sbjct: 188 VTAVHKANIMKLGDGLFRNLVTEI---GAKEYPEVGVSSIIVDNASMQAVAKPHQFDVMV 244

Query: 261 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGIANPIATIRS 319
           AP++YG IL +  AAL+G  G+VP AN G +  + EP       DI  + IANP A I S
Sbjct: 245 APSMYGTILGNIGAALIGGPGLVPGANYGRDYAVFEPGSRHVGLDIENQNIANPTAMILS 304

Query: 320 TALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQQVVEDVLSRL 371
             LML  LG  N A  I KAV   + EG   T D+GG A+T +    V+++L
Sbjct: 305 ATLMLNHLGFRNDAARISKAVHEVIAEGKTTTRDIGGSATTTEFTNAVIAKL 356

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  169 bits (427), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 121/352 (34%), Positives = 187/352 (53%), Gaps = 29/352 (8%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVL--ENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVK 82
           T+ LIPGDG+GKEV  +   +   ENL     + +  +D+ +G     E G      ++K
Sbjct: 35  TVTLIPGDGVGKEVTDSVVSIFNAENLP----IDWERVDI-SGLD--HEEGVEAAVNSLK 87

Query: 83  VLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKDK--PIDMV 140
             K   +G     +   +     + S  VALR+++ ++ANV   K++ G K +   +D+V
Sbjct: 88  RNKIGLKG-----IWHTSAGQSDHGSLNVALRKQLDIYANVAHFKTLPGVKTRIPDVDLV 142

Query: 141 IVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQTRGEAT 200
           I+RENTE  Y  +E   +       V ++ K I++  + RIA  A D A KR   +    
Sbjct: 143 IIRENTEGEYSGLEHESVPG-----VVESLKIITKEKSERIARFAFDFA-KRFDRK---L 193

Query: 201 LTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIV 260
           +T  HK+N++   DGLFR     + E+   +Y  IK +  IVD+   +   +P  FDV+V
Sbjct: 194 VTAVHKANIMKLGDGLFRNSVTSIGET---EYPDIKVSSIIVDNASMQSVAKPHQFDVLV 250

Query: 261 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGIANPIATIRS 319
            P++YG IL +  AAL+G  G+VP AN G E  + EP       DI G+ +ANP A I S
Sbjct: 251 TPSMYGTILGNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDIKGQNVANPTAMILS 310

Query: 320 TALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQQVVEDVLSRL 371
           + L+L+ LG NN A+ I  AV   + EG + T D+GG AST +   +++ +L
Sbjct: 311 STLLLKHLGLNNEAKKIEDAVYKTIAEGKVTTRDIGGSASTTEFTNEIIKKL 362

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  168 bits (426), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 124/372 (33%), Positives = 198/372 (53%), Gaps = 25/372 (6%)

Query: 3   RSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDL 62
           R++AT  +T + L      +  T+ LIPGDG+GKEV  +   + +  N    + ++ +D+
Sbjct: 9   RTLATVATTEKMLPKKYGGR-YTVTLIPGDGVGKEVTDSVVSIFKAENVP--VDWDRVDI 65

Query: 63  YAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFAN 122
            +G    ++   A     V+ LK    G L G   +      G+ S  VALR+E+ ++AN
Sbjct: 66  -SGVDRAEDVKSA-----VESLKRNRIG-LKGIWHTSPADQAGHGSLNVALRKELDIYAN 118

Query: 123 VRPVKSVEGGKDK--PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180
           V   KS+ G + K   +D+V++RENTE  +  +E   +       V ++ K +++    R
Sbjct: 119 VARFKSIPGVQVKIPDVDLVVIRENTEGEFSGLEHESVPG-----VVESLKIMTQDNIER 173

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240
           IA  A D A K  + +    +   HK+N++   DGLF+ + +EV E    +Y +++    
Sbjct: 174 IARFAFDYAKKNDRKQ----VVAVHKANIMKMGDGLFKNLVQEVGEK---EYPELQVGNI 226

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CH 299
           IVD+   +    P  FDV+V P++YG IL +  AAL+G  G+V  AN G ++ + EP   
Sbjct: 227 IVDNASMQTVANPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANYGRDVALFEPGSR 286

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAS 359
               DI G+ +ANP A I S+ L+L  LG N +A  I KAV A + EG   T D+GG AS
Sbjct: 287 HVGLDIKGQNVANPTAMILSSVLLLNHLGLNTSADRISKAVHAVIAEGKSVTRDIGGTAS 346

Query: 360 TQQVVEDVLSRL 371
           T +  E V+++L
Sbjct: 347 TTEFTEAVINKL 358

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  168 bits (426), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 118/351 (33%), Positives = 188/351 (53%), Gaps = 25/351 (7%)

Query: 24  LTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKV 83
            T+ L+PGDG+GKE+  +   + ++ N    + +  +D+     T  E  KA  D     
Sbjct: 28  FTVTLLPGDGVGKEITDSVVSIFKSENVP--IDWETVDISGLDHT--EGVKAAVDS---- 79

Query: 84  LKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKDK--PIDMVI 141
           LK    G L G   +P  +V G+ S  VA R+++ ++ANV   KS+EG K K   +D+V+
Sbjct: 80  LKRNKIG-LKGIWHTPADQV-GHGSLNVAFRKQLDIYANVAIFKSIEGVKTKIPNVDLVV 137

Query: 142 VRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQTRGEATL 201
           +RENTE  Y  +E   +       V ++ K I++  + RIA  A D A    +     ++
Sbjct: 138 IRENTEGEYSGLEHESVPG-----VVESLKIITKSKSERIARFAFDFA----KRNNRKSV 188

Query: 202 TVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIVA 261
           T  HK+N++  SDGLFR    ++ E   ++Y +I+ +  IVD+   +   +P  FDV+V 
Sbjct: 189 TAVHKANIMKLSDGLFRNTVSKIGE---EEYPEIQTSSIIVDNASMQAVAKPHQFDVMVT 245

Query: 262 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGIANPIATIRST 320
           P++YG I+ +  AAL+G  G+VP  N G +  + EP       DI G+ +ANP A + S 
Sbjct: 246 PSMYGTIVGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDIKGQNVANPTAMLLSA 305

Query: 321 ALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQQVVEDVLSRL 371
            L+L+ LG   +A  I  AV   + EG   T D+GG AST +  + V+++L
Sbjct: 306 TLLLDHLGLEKSANRIKSAVYDVIAEGKATTQDIGGSASTTEFTQAVINKL 356

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  167 bits (423), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 121/370 (32%), Positives = 191/370 (51%), Gaps = 33/370 (8%)

Query: 13  RGLATNAARKSL--------TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYA 64
           RG+A+ A    L        T+ LIPGDG+GKE+  +   + E  N    + +  +D+  
Sbjct: 8   RGMASMAKELVLPKKYGGRYTVTLIPGDGVGKEITDSVVSIFEAENIP--VDWERVDIST 65

Query: 65  GFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVR 124
                Q+  +A+  E++K  K   +G     +   +  +  + S  VALR+++ +FA+V 
Sbjct: 66  S-DNIQDVSQAV--ESLKRNKIGLKG-----IWHTSADIADHGSFNVALRKQLDMFAHVA 117

Query: 125 PVKSVEGGKDK--PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIA 182
             KSV G K K   +D+V++RENTE  Y  +E   +       V ++ K I++  + RIA
Sbjct: 118 FFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESVPG-----VVESLKIITKAKSERIA 172

Query: 183 TIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIV 242
             A D A K        ++   HK+N++   DGLFR    E+     ++Y  I+ +  IV
Sbjct: 173 RFAFDFAKKY----NRKSVCAVHKANIMKMGDGLFRNTVTEI---GANEYPDIQTSSIIV 225

Query: 243 DSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGS 301
           D+   +   +P  FDV+V P++YG I+ +  AAL+G  G+V  A+ G E  + EP     
Sbjct: 226 DNASMQAVAKPHQFDVMVTPSMYGTIIGNIGAALIGGPGLVAGAHYGREHAVFEPGSQHV 285

Query: 302 APDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQ 361
             DI GK +ANP A I S+ LML+ LG   +A+ I KA    +  G + T D+GG AST 
Sbjct: 286 GLDIKGKNVANPTAMILSSTLMLQHLGLTESAKRIAKATHDVISLGQVTTKDIGGSASTT 345

Query: 362 QVVEDVLSRL 371
           +  E ++ RL
Sbjct: 346 EFTEAIIKRL 355

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  159 bits (403), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 120/379 (31%), Positives = 194/379 (51%), Gaps = 41/379 (10%)

Query: 1   MLRSVATRLSTCRGLATNAARK---SLTIGLIPGDGIGKEVIPAGKQVL--ENLNSKHGL 55
           MLR+   R    R ++T + +K      I LIPG+GIGKEV  + + +   ENL     +
Sbjct: 1   MLRNTLLR----RSISTISPKKYGGRFQITLIPGNGIGKEVTDSVRSIFQAENL----PI 52

Query: 56  SFNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRR 115
            +  +++ +        G     +++K  K   +G         +  ++G  S  VALR+
Sbjct: 53  DWEIVNIES-----HRDGIKTAVDSIKRNKIALKGIW------SSDPIDG--SLNVALRK 99

Query: 116 EMGLFANVRPVKSVEGGKDK--PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRI 173
           ++ +FANV   KS +    +   +D+V++RENTE  +  +E   +D      V ++ K +
Sbjct: 100 QLDIFANVAIFKSFDNVNTRIPNVDLVVIRENTEGEFSGLEHESVDG-----VVESLKIV 154

Query: 174 SEIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYG 233
           ++  T RIA  A D A K  +      +T  HK+N++   DGLF+ I   +     ++Y 
Sbjct: 155 TKPKTERIARFAFDFAKKHNRNH----VTAVHKANIMKLGDGLFKNIVAHI---GNNEYP 207

Query: 234 QIKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIV 293
           +IK +  IVD+   +   +P  FDV+V+P++YG IL +  AAL+G  G+VP AN G +  
Sbjct: 208 EIKNSSIIVDNASMQAVAKPHQFDVLVSPSMYGTILGNIGAALIGGPGLVPGANFGRDYA 267

Query: 294 IGEP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTP 352
           + EP       DI G+ +ANP A I S   ML  LG  + A+ I  AV   + +G   T 
Sbjct: 268 VFEPGSRHVGLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAVKHVIAQGTTVTK 327

Query: 353 DLGGKASTQQVVEDVLSRL 371
           D+GG AST +  + V++ L
Sbjct: 328 DIGGTASTTEFTDAVINEL 346

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  157 bits (397), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 121/381 (31%), Positives = 189/381 (49%), Gaps = 35/381 (9%)

Query: 1   MLRSVATRLSTCRGLAT-------NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKH 53
           MLR    RL + R LAT       N      T+ L+PGDG+GKE   +   V    N   
Sbjct: 1   MLR----RLVSKRSLATLPETLFPNKYGGRYTVTLLPGDGVGKECTDSVVSVFNAENIP- 55

Query: 54  GLSFNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVAL 113
            + +  +++ +G    +    A     V+ L+    G L G   +      G+ S  VA 
Sbjct: 56  -IDWEIVNI-SGLDHKEGVAAA-----VQSLRRNKIG-LKGLWHTSNADQSGHGSLNVAF 107

Query: 114 RREMGLFANVRPVKSVEGGKDK--PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATK 171
           R+++ ++ANV   KS++G K     +D+V++RENTE  +  +E   ++      V ++ K
Sbjct: 108 RKQLDIYANVAVFKSLKGVKTMIPDVDLVVIRENTEGEFSGLEHESVEG-----VVESLK 162

Query: 172 RISEIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDK 231
             +   T RIA  A + A    Q  G   +   HK+N++   DGLFR     + E    +
Sbjct: 163 VTTLPKTERIARFAFNYA----QKNGRKAVCAVHKANIMKLGDGLFRNTVTSIGEK---E 215

Query: 232 YGQIKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE 291
           Y  I+ +  IVD+   +   +P  FDV+V P++YG I+ +  AAL+G  G+V  AN G E
Sbjct: 216 YPDIETSSIIVDNASMQAVAKPHQFDVLVTPSMYGTIIGNIGAALIGGPGLVAGANFGRE 275

Query: 292 IVIGEP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIK 350
             + EP       DI G+ IANP A + S+ALML  LG   + + I  AV   + EG ++
Sbjct: 276 YAVFEPGSRHVGLDIKGQNIANPTAMLLSSALMLNHLGLTKSGKRISDAVREVIAEGDVR 335

Query: 351 TPDLGGKASTQQVVEDVLSRL 371
           T D+GG A+T +  + V+ +L
Sbjct: 336 TKDIGGDATTTEFTQAVIEKL 356

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  156 bits (395), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 117/360 (32%), Positives = 183/360 (50%), Gaps = 28/360 (7%)

Query: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77
           N    + T+  I GDG+G E+  + + + +   +K  + +   D+       + T   +P
Sbjct: 39  NPETGNYTVPFIEGDGVGPEISKSVRTIFKA--AKVPIDWVNCDIGPLLINGETT---IP 93

Query: 78  DETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVE--GGKDK 135
              V  +      AL G + +P    +G+ S  + LR+  GLFANVRP KS+       +
Sbjct: 94  QTAVDQINNSLI-ALKGPLATPVG--QGHRSINLTLRKTFGLFANVRPAKSIPNLASTYE 150

Query: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQT 195
            +D++++RENTE  Y  IE   +       V  + K I+  A+ ++    +  A +  ++
Sbjct: 151 NVDLIVIRENTEGEYSGIEHEIVPG-----VVQSIKLITRKASEKV----IKYAFEYTRS 201

Query: 196 RGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255
            G + L V HK+ +  + DGLF +  +E+     DKY  +    +++D+ V      P+ 
Sbjct: 202 IGRSNLIVVHKATIQRRGDGLFVQTAQEM----ADKYPDVNLKLELIDNTVLNCIMNPEK 257

Query: 256 F--DVIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIAN 312
           +   V V PNLYGDILSD  + L  GSLG+ PSAN+G E V+ E  HGSAPDIAG+  AN
Sbjct: 258 YADSVSVCPNLYGDILSDLNSGLSTGSLGLTPSANIG-ETVLYEAVHGSAPDIAGQDKAN 316

Query: 313 PIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGA-IKTPDLGGKASTQQVVEDVLSRL 371
           P A + S+ +ML  +G    A  I  AV   +  G   +T DLGG A+T    + V+  L
Sbjct: 317 PTALLLSSVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  155 bits (392), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 127/372 (34%), Positives = 193/372 (51%), Gaps = 44/372 (11%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLENLNSK-HGLSFNFIDLYAGFQTFQETGKALPDETVKV 83
            I ++PGD +G+E++    +VL+ +  K HG+ FNF     G     +TG  LPDET++ 
Sbjct: 6   NIVVLPGDHVGQEIVEEAVKVLKIVEEKRHGVKFNFQYHLIGGDAIDKTGDPLPDETLEA 65

Query: 84  LKEQCQGALFGAVQSP---TTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKDKPI--- 137
            K Q    L GAV  P   T KV      ++ +R+E+GL+ N+RP K +    DK I   
Sbjct: 66  AK-QSDAVLLGAVGGPKWGTGKVRPEQG-LLKIRKELGLYGNLRPCKFI---SDKLIGLS 120

Query: 138 ----------DMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMD 187
                     D V+VRE    +Y   E+   D   G+ VA  +++ S    +RI  +A  
Sbjct: 121 PLKEEVCKGTDFVVVRELVGGIYFG-ERQEDD---GSGVAWDSEKYSIEEVKRITKMA-- 174

Query: 188 IALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVY 247
            A   LQ      +    K+NVL+ S  L+R    E       ++  +K   Q++DS   
Sbjct: 175 -AFLSLQNDPPLPIWSLDKANVLASSR-LWRAAVDETIA----EFPNLKVQHQLIDSAAM 228

Query: 248 RLFREP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHG 300
            L + P Q   +I+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHG
Sbjct: 229 MLVKNPTQLNGIILTNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHG 288

Query: 301 SAPDIAGKGIANPIATIRSTALMLEF-LGHNNAAQDIYKAVDANLREGAIKTPDLGGKAS 359
           SAPD+A +G  NP+ATI S A+ML+  L      + I +AV   L  G I+T DLGG ++
Sbjct: 289 SAPDLA-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAVSVVLDRG-IRTADLGGNST 346

Query: 360 TQQVVEDVLSRL 371
           T ++ + V   L
Sbjct: 347 TSELGDAVAQEL 358

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score =  143 bits (361), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 124/366 (33%), Positives = 187/366 (51%), Gaps = 37/366 (10%)

Query: 28  LIPGDGIGKEVIPAGKQVLENLN-SKHGLSFNFIDLYAGFQTFQETGKALPDETVKVLKE 86
           ++PGD IG+EVI    +VL  +  ++  ++F F     G      TG  L D+T++  K 
Sbjct: 9   VLPGDYIGQEVIAETIKVLNAIQEARPSINFEFEYHLIGGAAINATGAPLSDKTIEAAK- 67

Query: 87  QCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLFANVRPV----KSVEG-GKDKP-- 136
                L GAV  P     G   P   ++A+R+E+GL+AN+RP     KS+ G    KP  
Sbjct: 68  AADAVLLGAVGGPEWD-SGAVRPEQGLLAIRKELGLYANLRPCSFISKSLLGLSPLKPEI 126

Query: 137 ---IDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRL 193
               D VI+RE    +Y    K   D   G         +SE+   RI  +   +AL   
Sbjct: 127 AQGTDFVILRELVGGIYFGERKE--DDGDGVAWDSEKYTVSEV--ERITRMGAFLAL--- 179

Query: 194 QTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREP 253
           Q      L    K+NVL+ S  L+R   + V E+ K ++ Q+    Q++DS    + + P
Sbjct: 180 QHDPPLPLWSFDKANVLASSR-LWR---RTVNETIKREFPQLSVQHQLIDSAAMIMIKNP 235

Query: 254 QCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE------IVIGEPCHGSAPDIA 306
           + F+ +++  N++GDI+SD A+ + GSLG++PSA++  E        + EPCHGSAPD+ 
Sbjct: 236 RKFNGIVITSNIFGDIISDAASVIPGSLGLLPSASLASEPDKNNAFGLYEPCHGSAPDLE 295

Query: 307 GKGIANPIATIRSTALMLEF-LGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQQVVE 365
            KG ANPIA I S A+ML+  L   +  + I  AV   +  G I+T DLGG  +T +V +
Sbjct: 296 -KGQANPIACILSAAMMLKLSLNMVDEGKAIENAVKQVIESG-IRTGDLGGNNTTTEVGD 353

Query: 366 DVLSRL 371
            V   L
Sbjct: 354 AVTHAL 359

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score =  143 bits (360), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 125/366 (34%), Positives = 196/366 (53%), Gaps = 49/366 (13%)

Query: 26  IGLIPGDGIGKEVIPAGKQVL----ENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETV 81
           I ++PGD IG+EV+    +VL    ++L+  H   F+F     G      TG ALPDE +
Sbjct: 7   IVVLPGDHIGREVVEEAVKVLGAVEQSLSDVH---FDFQYHLVGGAAIDATGSALPDEAL 63

Query: 82  KVLKEQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLFANVRPVKS-----VEGGK 133
              KE     L GAV  P  +  G   P   ++ LR+E+G++AN+RP        +E   
Sbjct: 64  GAAKE-ADAVLLGAVGGPKWQ-GGAVRPEQGLLKLRQELGVYANLRPCNFAADSLLELSP 121

Query: 134 DKP-----IDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDI 188
            +P      D+++VRE     Y    + + D+  G  VA  T + +    +RIA +A  +
Sbjct: 122 LRPEIARDTDIMVVRELLGGSYFG--ERHEDEGDG--VAWDTDKYTVKEVQRIARMAGFL 177

Query: 189 ALKRLQTRGEATLTVTH--KSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMV 246
           AL+      +  L V    K+NVL+ S  L+R+  +E ++S   ++  ++   Q++DS  
Sbjct: 178 ALQH-----DPPLPVWSLDKANVLASSR-LWRKTVEETFQS---EFPNVQLQHQLIDSAA 228

Query: 247 YRLFREPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCH 299
             L + P+ F+ V+V  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCH
Sbjct: 229 MILVKNPRAFNGVVVTSNMFGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCH 288

Query: 300 GSAPDI-AGKGIANPIATIRSTALMLEF-LGHNNAAQDIYKAVDANLREGAIKTPDLGGK 357
           GSAPD+ AGK  ANPI  I S A+ML+  L    A + + +AV   L  G ++T DL G 
Sbjct: 289 GSAPDLPAGK--ANPIGCILSAAMMLKLSLNMVAAGEAVEQAVQEVLDSG-VRTGDLLGS 345

Query: 358 ASTQQV 363
           +ST +V
Sbjct: 346 SSTSEV 351

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score =  142 bits (359), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 121/363 (33%), Positives = 188/363 (51%), Gaps = 37/363 (10%)

Query: 23  SLTIGLIPGDGIGKEVIPAGKQVLENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETV 81
           S  I ++PGD +G+E+     +VL+ ++  +   +FNF     G      TG  LPDE +
Sbjct: 2   SKNIVVLPGDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPDEAL 61

Query: 82  KVLKEQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLFANVRP----------VKS 128
           +  K +    L GAV  P     G   P   ++ +R+E+ L+AN+RP          +  
Sbjct: 62  EASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLELSP 119

Query: 129 VEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDI 188
           ++    +  D V+VRE    +Y    K    +  G  VA  +++ S    +RI  +A  +
Sbjct: 120 LKAQYAQGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEQYSVPEVQRITRMAAFL 175

Query: 189 ALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYR 248
           AL   Q      +    K+NVL+ S  L+R   K V ++ K+++  +  N Q++DS    
Sbjct: 176 AL---QHNPPLPIWSLDKANVLASSR-LWR---KTVEKTIKEEFPTLSVNHQLIDSAAMI 228

Query: 249 LFREP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGS 301
           L + P Q   +I+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGS
Sbjct: 229 LVKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGS 288

Query: 302 APDIAGKGIANPIATIRSTALMLEF-LGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360
           APD+A KG  NP+ATI S A+ML+  L        I KAV   L +G I+T DLGG  ST
Sbjct: 289 APDLA-KGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAVKKVLDDG-IRTGDLGGSNST 346

Query: 361 QQV 363
            +V
Sbjct: 347 SEV 349

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score =  140 bits (353), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 119/363 (32%), Positives = 185/363 (50%), Gaps = 37/363 (10%)

Query: 23  SLTIGLIPGDGIGKEVIPAGKQVLENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETV 81
           S  I ++PGD +GKEV     +VL  +   +  + FNF     G      TG  LPDE +
Sbjct: 2   SKNIVVLPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPDEAL 61

Query: 82  KVLKEQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLFANVRP----------VKS 128
           +  K +    L GAV  P     G   P   ++ +R+E+GL+AN+RP          +  
Sbjct: 62  EASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASDSLLDLSP 119

Query: 129 VEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDI 188
           ++    K  D V+VRE    +Y    K    +  G  VA  +++ S    +RI  +A  +
Sbjct: 120 LKPEYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFL 175

Query: 189 ALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYR 248
           AL   Q      +    K+NVL+ S  L+R   K V E+ K ++ Q+    Q++DS    
Sbjct: 176 AL---QQNPPLPIWSLDKANVLASSR-LWR---KTVEETIKTEFPQLTVQHQLIDSAAMI 228

Query: 249 LFREPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGS 301
           L + P   + V++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGS
Sbjct: 229 LVKSPTKLNGVVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGS 288

Query: 302 APDIAGKGIANPIATIRSTALMLEF-LGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360
           APD+    + NPIATI S A+ML+  L      + + +AV  N+ +  ++T DLGG  ST
Sbjct: 289 APDLPANKV-NPIATILSAAMMLKLSLDLVEEGRALEEAV-RNVLDAGVRTGDLGGSNST 346

Query: 361 QQV 363
            +V
Sbjct: 347 TEV 349

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score =  138 bits (347), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 121/361 (33%), Positives = 181/361 (50%), Gaps = 38/361 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLENL--NSKHGLSFNFIDLYAGFQTFQETGKALPDETVKV 83
           I ++PGD +G+E++    +VLE +  +S  G+ F F     G  +   TG  LPDE +  
Sbjct: 6   IVVLPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLPDEALDA 65

Query: 84  LKEQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLFANVRPVKSVEGGK------- 133
            K      L GAV  P     G   P   ++ +R+E+ L+AN+RP   V           
Sbjct: 66  AK-NSDAVLLGAVGGPKWGT-GDVRPEQGLLKIRKELQLYANLRPCNFVSDSLLGLSPLK 123

Query: 134 ---DKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIAL 190
               K  D  +VRE    +Y    K   D   G+        I E+  +RI  +A  +AL
Sbjct: 124 EEIAKGTDFTVVRELVGGIYFGDRKE--DDGDGSAWDCEKYTIPEV--QRITRMAAFLAL 179

Query: 191 KRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLF 250
              Q      +    K+NVL+ S  L+R   K V E+ K+++  +K   Q++DS    L 
Sbjct: 180 ---QHDPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPNLKVQHQLIDSAAMILV 232

Query: 251 REPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 303
           + P+  + +I+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 233 KSPRQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAP 292

Query: 304 DIAGKGIANPIATIRSTALMLEF-LGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQQ 362
           D+  KG  NPIATI S A+ML+  L   +    I +AV   L  G I+T DL G  ST +
Sbjct: 293 DLP-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAVKQVLDAG-IRTADLKGSNSTSE 350

Query: 363 V 363
           V
Sbjct: 351 V 351

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  137 bits (345), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 117/360 (32%), Positives = 185/360 (51%), Gaps = 37/360 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETVKVL 84
           I ++PGD +G+E+     +VL+ ++  +  ++F+F +   G      TG  LPDE ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISEVRSDVNFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 85  KEQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLFANVRP----------VKSVEG 131
           K +    L GAV  P     G   P   ++ +R+E+ L+AN+RP          +  ++ 
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 132 GKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALK 191
              K  D V+VRE    +Y    K    +  G  VA  +++ +    +RI  +A   A  
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMA---AFM 177

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFR 251
            LQ      +    K+NVL+ S  L+R   K V E+ K+++  +K   Q++DS    L +
Sbjct: 178 ALQHEPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 252 EPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 304
            P   + +I+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 305 IAGKGIANPIATIRSTALMLEF-LGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQQV 363
           +  K   NPIATI S A+ML+  L      + I  AV   L  G I+T DLGG  ST +V
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAG-IRTGDLGGSNSTTEV 351

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score =  137 bits (345), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 117/360 (32%), Positives = 184/360 (51%), Gaps = 37/360 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETVKVL 84
           I ++PGD +G+E+     +VL+ ++  +  + F+F +   G      TG  LPDE ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 85  KEQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLFANVRP----------VKSVEG 131
           K +    L GAV  P     G   P   ++ +R+E+ L+AN+RP          +  ++ 
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 132 GKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALK 191
              K  D V+VRE    +Y    K    +  G  VA  +++ +    +RI  +A   A  
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMA---AFM 177

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFR 251
            LQ      +    K+NVL+ S  L+R   K V E+ K+++  +K   Q++DS    L +
Sbjct: 178 ALQHEPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 252 EPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 304
            P   + +I+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 305 IAGKGIANPIATIRSTALMLEF-LGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQQV 363
           +  K   NPIATI S A+ML+  L      + I  AV   L  G I+T DLGG  ST +V
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAG-IRTGDLGGSNSTTEV 351

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  135 bits (340), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 155/293 (52%), Gaps = 25/293 (8%)

Query: 24  LTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKV 83
            T+ LIPGDG+GKEV  + K + E  N    + +  I++    QT  + G    +E V+ 
Sbjct: 29  FTVTLIPGDGVGKEVTDSVKTIFEAENIP--IDWETINIK---QTDHKEGV---NEAVES 80

Query: 84  LKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKDK--PIDMVI 141
           L+    G L G   +P  +  G+ S  VALR+++ ++ANV   KS++G K +   ID+++
Sbjct: 81  LRRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 142 VRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQTRGEATL 201
           +RENTE  +  +E   +       V ++ K +++  T RIA  A D A K         +
Sbjct: 139 IRENTEGEFSGLEHESVPG-----VVESLKIMTKPKTERIARFAFDFAKKY----NRKAV 189

Query: 202 TVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIVA 261
           T  HK+N++   DGLFR I  E+    + +Y  I  +  IVD+   +   +P  FDV+V 
Sbjct: 190 TAVHKANIMKLGDGLFRNIITEI---GQKEYPDIDVSSIIVDNASMQAVAKPHQFDVLVT 246

Query: 262 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGIANP 313
           P++YG IL +  AAL+G  G+V  AN G +  + EP       DI G+ +ANP
Sbjct: 247 PSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANP 299

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score =  136 bits (343), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 119/364 (32%), Positives = 188/364 (51%), Gaps = 45/364 (12%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETVKVL 84
           I ++PGD +G+E+     +VL+ +    + ++F+F     G      TG  LPDE ++  
Sbjct: 6   IVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVPLPDEALEAS 65

Query: 85  KEQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLFANVRPV----KSVEGGKD--- 134
           K      L GAV  P     G   P   ++ +R+E+GL+AN+RP     +S+ G      
Sbjct: 66  K-NSDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASESLLGLSPLRP 123

Query: 135 ---KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALK 191
              K  D ++VRE    +Y    K    +  G  VA  +++ S    +RI  +A  +AL 
Sbjct: 124 EIAKGTDFMVVRELVGGIYFGKRK----EDEGDGVAWDSEQYSVPEVQRITRMAAFLAL- 178

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFR 251
             Q      +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    L +
Sbjct: 179 --QHNPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQNQLIDSAAMILVK 232

Query: 252 EP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 304
            P Q   +I+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 233 NPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 292

Query: 305 IAGKGIANPIATIRSTALMLE----FLGHNNAAQD-IYKAVDANLREGAIKTPDLGGKAS 359
           +  KG  NPIATI S A+ML+     +   +A ++ + K +DA +R G     DLGG  S
Sbjct: 293 LP-KGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVKKVLDAGIRTG-----DLGGSNS 346

Query: 360 TQQV 363
           T +V
Sbjct: 347 TTEV 350

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score =  136 bits (343), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 117/360 (32%), Positives = 184/360 (51%), Gaps = 37/360 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETVKVL 84
           I ++PGD +G+E+     +VL+ ++  +  + F F     G      TG+ LPD +++  
Sbjct: 7   IVVLPGDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLPDASLEAA 66

Query: 85  KEQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLFANVRP----------VKSVEG 131
           K +    L GAV  P     G   P   ++ +R+E+ L+AN+RP          +  ++ 
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKA 124

Query: 132 GKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALK 191
              +  D V+VRE    +Y    K    +  G  VA  +++ S    +RI  +A  +AL 
Sbjct: 125 EHARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFLAL- 179

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFR 251
             Q      +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    + +
Sbjct: 180 --QHNPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMIMVK 233

Query: 252 EP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 304
            P Q   VI+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 NPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 293

Query: 305 IAGKGIANPIATIRSTALMLEF-LGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQQV 363
           +  KG  NPIATI S A+MLE  L        + +AV   L  G I+T DL G  STQ+V
Sbjct: 294 LE-KGKVNPIATILSAAMMLELSLDMFEEGTAVEEAVRRVLDSG-IRTGDLRGSNSTQEV 351

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score =  135 bits (340), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 120/363 (33%), Positives = 186/363 (51%), Gaps = 37/363 (10%)

Query: 23  SLTIGLIPGDGIGKEVIPAGKQVLENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETV 81
           S  I ++PGD  G+E+     +VLE ++       FNF     G      TG  LPD+ +
Sbjct: 2   SKNIVVLPGDHAGQEIAQEAIKVLEAISEVSPEAKFNFQHHLIGGAAIDATGSPLPDDAL 61

Query: 82  KVLKEQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLFANVRP----------VKS 128
              K+     L GAV  P     G   P   ++ +R+E+ L+AN+RP          +  
Sbjct: 62  AAAKKADA-VLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSP 119

Query: 129 VEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDI 188
           ++    K  D V+VRE    +Y    K    +  G  VA  +++ ++   +R+  +A  +
Sbjct: 120 LKPQHAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYTKPEVQRLTRMAAFL 175

Query: 189 ALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYR 248
           AL   Q      +    K+NVL+ S  L+R   K V E+ K+++ Q+K N Q++DS    
Sbjct: 176 AL---QHNPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLKLNHQLIDSAAMI 228

Query: 249 LFREP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGS 301
           L + P Q   +++  NL+GDI+SD A+ + GSLG++PSA++   P+      + EPCHGS
Sbjct: 229 LVKSPTQLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLASLPDTNEAFGLYEPCHGS 288

Query: 302 APDIAGKGIANPIATIRSTALMLEF-LGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360
           APD+  KG  NPIA I S A+ML+  L  +   + + KAV   L  G ++T DLGG  ST
Sbjct: 289 APDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQVLDSG-VRTGDLGGSNST 346

Query: 361 QQV 363
            +V
Sbjct: 347 SEV 349

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  135 bits (340), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 116/360 (32%), Positives = 183/360 (50%), Gaps = 37/360 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETVKVL 84
           I ++PGD +G+E+     +VL+ ++  +  + F+F +   G      TG  LPDE ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 85  KEQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLFANVRP----------VKSVEG 131
           K +    L GAV  P     G   P   ++ +R+E+ L+AN+RP          +  ++ 
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPIKP 124

Query: 132 GKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALK 191
              K  D V+VRE    +Y    K    +  G  VA   ++ +    +RI  +A   A  
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGERK----EDDGDGVAWDCEQYTVPEVQRITRMA---AFM 177

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFR 251
            LQ      +    K+NVL+ S  L+R   K V E+ K+++  +K   Q++DS    L +
Sbjct: 178 ALQHEPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 252 EPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 304
            P   + +I+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 305 IAGKGIANPIATIRSTALMLEF-LGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQQV 363
           +  K   NP+ATI S A+ML+  L      + I  AV   L  G I+T DLGG  ST +V
Sbjct: 294 LP-KNKVNPVATILSAAMMLKLSLNLPEEGKAIEDAVKRVLDAG-IRTGDLGGSNSTTEV 351

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score =  136 bits (343), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 120/369 (32%), Positives = 188/369 (50%), Gaps = 37/369 (10%)

Query: 17  TNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNS-KHGLSFNFIDLYAGFQTFQETGKA 75
           T  A+ +  I ++PGD +G+E+     +VL  ++S +  ++F+F     G      TG  
Sbjct: 81  TAMAQTTKHIVVLPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAIDATGVP 140

Query: 76  LPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLFANVRPVKS---- 128
           LPDE ++  K +    L GAV  P     G   P   ++ +R+E+ L+AN+RP       
Sbjct: 141 LPDEALEASK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDS 198

Query: 129 -VEGGKDKP-----IDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIA 182
            ++    KP      D+ IVRE    +Y    K   D+  G         +SE+  +RI 
Sbjct: 199 LLDLSPLKPEIVKGTDICIVRELVGGIYFGERKE--DEGDGVAWDSEKYSVSEV--QRIT 254

Query: 183 TIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIV 242
            +A  +AL   Q      +    K+NVL+ S  L+R   K V E+ K+++  +    Q++
Sbjct: 255 RMAGFLAL---QHNPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLI 307

Query: 243 DSMVYRLFREPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIG 295
           DS    L + P   + V++A N++GDI+SD A+ + GSLG++PSA++   P+      + 
Sbjct: 308 DSAAMILVKNPTHLNGVVIANNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLY 367

Query: 296 EPCHGSAPDIAGKGIANPIATIRSTALMLEF-LGHNNAAQDIYKAVDANLREGAIKTPDL 354
           EPCHGSAPD+  KG  NP+ATI S A+ML+  L        + KAV   L  G ++T DL
Sbjct: 368 EPCHGSAPDLP-KGKVNPVATILSVAMMLKLSLNMTEEGIAVEKAVKQVLDSG-VRTADL 425

Query: 355 GGKASTQQV 363
            G  ST +V
Sbjct: 426 RGSNSTSEV 434

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score =  135 bits (339), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 119/362 (32%), Positives = 182/362 (50%), Gaps = 38/362 (10%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLENLNS--KHGLSFNFIDLYAGFQTFQETGKALPDETVK 82
           TI ++PGD +G+E+     +VL  +       ++F F     G      TG  LPDE ++
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALE 65

Query: 83  VLKEQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLFANVRPVKS-----VEGGKD 134
             K +    L GAV  P     G   P   ++ +R+E+ L+AN+RP        ++    
Sbjct: 66  ASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPL 123

Query: 135 KP-----IDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIA 189
           KP      D V+VRE    +Y    K    +  G  VA  +++ S    +RI  +A   A
Sbjct: 124 KPEIARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMA---A 176

Query: 190 LKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRL 249
              LQ      +    K+NVL+ S  L+R   K V E+ K+++ Q+    Q++DS    L
Sbjct: 177 FMALQHNPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLTVQHQLIDSAAMIL 232

Query: 250 FREPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSA 302
            + P   + +I+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSA
Sbjct: 233 VKNPTHLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSA 292

Query: 303 PDIAGKGIANPIATIRSTALMLEF-LGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQ 361
           PD+  KG  NP+ATI S A+ML+  L      + I +AV   L  G I+T DL G  ST 
Sbjct: 293 PDLP-KGKVNPVATILSAAMMLKLSLDLFEEGEIIEQAVKKVLDSG-IRTADLKGTNSTT 350

Query: 362 QV 363
           +V
Sbjct: 351 EV 352

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  134 bits (337), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 120/360 (33%), Positives = 183/360 (50%), Gaps = 37/360 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETVKVL 84
           I ++PGD +G+E+     +VL+ ++  +  + F+F     G      TG  L DE ++  
Sbjct: 7   IVVLPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDATGVPLTDEALEAS 66

Query: 85  KEQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLFANVRPVKS-----VEGGKDKP 136
           K +    L GAV  P     G   P   ++ +R+E+ L+AN+RP        +E    KP
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLELSPIKP 124

Query: 137 -----IDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALK 191
                 D V+VRE    +Y    K    +  G  VA  +++ +    +RI  +A   A  
Sbjct: 125 QFARGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMA---AFM 177

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFR 251
            LQ +    +    K+NVL+ S  L+R   K V E+ K+++  +K   Q++DS    L +
Sbjct: 178 ALQHQPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 252 EP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 304
            P Q   +I+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 NPTQLNGIIITSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 305 IAGKGIANPIATIRSTALMLEF-LGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQQV 363
           +  K   NPIATI S A+ML+  L      Q I  AV   L  G I+T DLGG  ST +V
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNMTAEGQAIEDAVKKVLDAG-IRTGDLGGSNSTIEV 351

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score =  133 bits (335), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 122/368 (33%), Positives = 190/368 (51%), Gaps = 37/368 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETVKVL 84
           I ++PGD +G+E+     +VL+ ++  +    F F     G      TG+ LPD +++  
Sbjct: 7   IVVLPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLIGGAAIDATGEPLPDASLEAA 66

Query: 85  KEQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLFANVRPVK-SVEGGKD----KP 136
           K +    L GAV  P     G   P   ++ +R+E+ L+AN+RP   + E   D    KP
Sbjct: 67  K-KSDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKP 124

Query: 137 -----IDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALK 191
                 D V+VRE    +Y    K    + TG  VA  +++ S    +RI  +A  +AL+
Sbjct: 125 ECARGTDFVVVRELVGGIYFGERK----EDTGDGVAWDSEQYSVPEVQRITRMAAFLALQ 180

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFR 251
                   +L    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    L +
Sbjct: 181 HSPPLPVWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILVK 233

Query: 252 EP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 304
            P Q   VI+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 NPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPD 293

Query: 305 IAGKGIANPIATIRSTALMLEF-LGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQQV 363
           +  KG  NPIATI S A+ML+  L        + +AV   L  G ++T DL G ++T +V
Sbjct: 294 LP-KGKVNPIATILSAAMMLKLSLDMFEEGAAVEEAVRKVLDSG-VRTADLKGTSTTSEV 351

Query: 364 VEDVLSRL 371
            E V+  L
Sbjct: 352 GEAVVKAL 359

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score =  130 bits (327), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 120/360 (33%), Positives = 182/360 (50%), Gaps = 37/360 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETVKVL 84
           I + PGD IG E++    +VL+ +      +SF +     G      TG+ L DE ++V 
Sbjct: 7   ITVFPGDHIGTEIVRETVKVLDAIAEVSPNVSFKYNYQLIGGAAIDATGEPLTDEALQVA 66

Query: 85  KEQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLFANVRPVKSV-EGGKD-KPI-- 137
           K      L GAV  P     G   P   ++ +R+E+G++AN+RP + V E   D  P+  
Sbjct: 67  K-NSDAILLGAVGGPKWG-HGLVRPEQGLLKIRKELGVYANLRPCQFVSETLLDLSPLKR 124

Query: 138 ------DMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALK 191
                 D VIVRE    +Y    +   D   G      +  + EI  +RI  +A  +AL 
Sbjct: 125 EIVQGTDFVIVRELVGGIYFGERQEAGDD--GVAWDKESYSVPEI--QRITRMAAFLAL- 179

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFR 251
             Q      +    K+NVL+ S  L+R   K V E+ K+++  +  N  ++DS    L +
Sbjct: 180 --QHNPPLPVWSLDKANVLATSR-LWR---KTVEETIKNEFPTLTINHHLIDSAAMTLVQ 233

Query: 252 EPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 304
            P   + V++  N++GDI+SD A+ + GSLG++PSA++   P+    + + EPCHGSAPD
Sbjct: 234 NPTKLNGVVITTNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGLYEPCHGSAPD 293

Query: 305 IAGKGIANPIATIRSTALMLEF-LGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQQV 363
           +     ANPIATI S A+M +  L        I +AV   +  G IKT DLGGK +T +V
Sbjct: 294 LPADH-ANPIATILSAAMMCKLSLNLTKEGNAIEEAVKRTIDAG-IKTGDLGGKNTTTEV 351

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score =  124 bits (312), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 113/361 (31%), Positives = 178/361 (49%), Gaps = 38/361 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLENLNSKHG--LSFNFIDLYAGFQTFQETGKALPDETVKV 83
           I ++PGD +G E+     +VL+ +       + F+F     G       G  L DE ++ 
Sbjct: 7   IVVLPGDHVGGEITEEAIKVLKAIEQVESSKVKFDFQYHLIGGAAIDAAGVPLTDEALEA 66

Query: 84  LKEQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLFANVRP----------VKSVE 130
            K +    L GAV  P     G   P   ++ +R+E+GL+AN+RP          +  + 
Sbjct: 67  SK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASEPLLGLSPLR 124

Query: 131 GGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIAL 190
               K  D ++VRE    +Y    K    +  G  VA  +++ S     RI  +A  +AL
Sbjct: 125 PEIAKGTDFMVVRELVGGIYFGERK----EDDGDGVAWDSEKYSVPEVERITRMAAFLAL 180

Query: 191 KRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLF 250
              Q      +    K+NVL+ S  L+R   K V  + K+++  +    Q++DS    L 
Sbjct: 181 ---QHNPPLPIWSLDKANVLASSR-LWR---KTVEATIKNEFPTLTVQNQLIDSAAMILV 233

Query: 251 REP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 303
           + P Q   +I+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 234 KNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAP 293

Query: 304 DIAGKGIANPIATIRSTALMLEF-LGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQQ 362
           D+  K   NP+ATI S A+ML+  L      + + +AV   L  G ++T DLGG  STQ+
Sbjct: 294 DLP-KNKVNPVATILSAAMMLKLSLNMVKEGEAVEEAVRRVLDAG-VRTGDLGGSNSTQE 351

Query: 363 V 363
           V
Sbjct: 352 V 352

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score =  124 bits (311), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 112/364 (30%), Positives = 185/364 (50%), Gaps = 45/364 (12%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETVKVL 84
           I ++PGD +G+E+     +VL+ ++  +  + F++     G      TG  LPDE +   
Sbjct: 7   IVVLPGDHVGQEITAEAIRVLDAISEVRPDVKFDYQYHLIGGAAIDATGVPLPDEALDAA 66

Query: 85  KEQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLFANVRP----------VKSVEG 131
           K+     L GAV  P     G   P   ++ +R+E+ L+AN+RP          +  ++ 
Sbjct: 67  KKADA-VLLGAVGGPKWGT-GQVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLKP 124

Query: 132 GKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALK 191
              K  D V+VRE    +Y    K    +  G  VA  +++ S    +RI  +A  +AL 
Sbjct: 125 EYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFLAL- 179

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFR 251
             Q      +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    L +
Sbjct: 180 --QQNPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILVK 233

Query: 252 EPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 304
            P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 SPTKLNGIVITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPD 293

Query: 305 IAGKGIANPIATIRSTALMLE----FLGHNNAAQD-IYKAVDANLREGAIKTPDLGGKAS 359
           +  K   NPIATI S A+ML+     +   NA ++ + + +DA +R     T DL G+ S
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAVRRVLDAGIR-----TADLRGENS 347

Query: 360 TQQV 363
           T +V
Sbjct: 348 TSEV 351

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  115 bits (289), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 113/366 (30%), Positives = 178/366 (48%), Gaps = 46/366 (12%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLENLNS--KHGLSFNFIDLYAGFQTFQETGKALPDETVK 82
            I ++PGD +G EV     ++L+ +     + + FNF     G      TG  LPDE+++
Sbjct: 6   NIVVLPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLIGGAAIDATGNPLPDESLE 65

Query: 83  VLKEQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLFANVRP----------VKSV 129
             K +    L GAV  P     G   P   ++ +R+E+ L+AN+RP          +  +
Sbjct: 66  ASK-RADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPL 123

Query: 130 EGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIA 189
           +    K  D  +VRE    +Y    K    +  G  VA  +++ S    +RI  +A  +A
Sbjct: 124 KEKYAKGTDFTVVRELVGGIYFGKRK----EDDGDGVAWDSEQYSVPEVQRITRMAAFLA 179

Query: 190 LKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRL 249
           +   Q      +    K+NVL+ S  L+R   K V E+ ++++  +K + Q++DS    L
Sbjct: 180 M---QHNPPLPIWSLDKANVLASSR-LWR---KTVEETIQNEFPSLKVSHQLIDSAAMIL 232

Query: 250 FREP-QCFDVIVAPNLYGDILSDGAAALVG--------SLGVVPSANVGPEIVIGEPCHG 300
            + P Q   +I+  N++GDI+SD A+ + G        SL  +P  N      + EPCHG
Sbjct: 233 VKNPTQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSA--FGLYEPCHG 290

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLR---EGAIKTPDLGGK 357
           SAPD+  KG  NPI TI S A+ML+ L  N   + I  AV+  +R   +  I+T DLGG 
Sbjct: 291 SAPDLP-KGKVNPIGTILSVAMMLK-LSLNLKEEGI--AVEEAVRRVLDNNIRTADLGGS 346

Query: 358 ASTQQV 363
            ST  +
Sbjct: 347 NSTSDI 352

>KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {ON}
           Anc_1.396 YLR174W
          Length = 421

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 67/128 (52%), Gaps = 13/128 (10%)

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNK----DKYGQIK 236
            A  + ++ALKR     +  L  T K+ VL + DG F++I +E+YES+     D+ G I 
Sbjct: 195 FARASFEMALKR-----KMPLFFTTKNTVLKRYDGKFKDIFQEMYESDYKVQFDEIG-IL 248

Query: 237 YNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVI 294
           Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V P+     
Sbjct: 249 YEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSMLVAPDGKTFE 307

Query: 295 GEPCHGSA 302
            E  HG+ 
Sbjct: 308 SEAAHGTV 315

>Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W
           (IDP1) - Mitochondrial form of NADP-specific isocitrate
           dehydrogenase [contig 1] FULL
          Length = 422

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 96/206 (46%), Gaps = 20/206 (9%)

Query: 103 VEGYSSPIVALRREMGLFANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKAT 162
           V G+  PI+     +G  A+    ++ +   +K   + +V    +    KI + +  K T
Sbjct: 129 VPGWQKPII-----IGRHAHGDQYRATDAIIEKAGKLELVHRPADGSEPKILQVHEFKGT 183

Query: 163 GTR-VADATKRISEIATRRIATIAMDIAL-KRLQTRGEATLTVTHKSNVLSQSDGLFREI 220
           G R VA A     E + R  A  +  +AL KRL       L ++ K+ +L Q DG F++I
Sbjct: 184 GARGVALAMYNTDE-SIRGFAHASFKLALSKRL------NLFMSTKNTILKQYDGRFKDI 236

Query: 221 CKEVYESNKDKYGQ---IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALV 277
            +EVY        +   I Y  +++D MV ++ +    F V+   N  GD+LSD  A   
Sbjct: 237 FQEVYAQEYQTQFRDEGISYEHRLIDDMVAQMIKSRGGF-VMALKNYDGDVLSDIVAQGF 295

Query: 278 GSLGVVPSANVGPE--IVIGEPCHGS 301
           GSLG++ S  V P+      E  HG+
Sbjct: 296 GSLGLMTSMLVTPDGKTFESEAAHGT 321

>Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON}
           (207889..209172) [1284 nt, 428 aa]
          Length = 427

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 83/168 (49%), Gaps = 14/168 (8%)

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQ--IKYNEQIVDSMVYR 248
           +L    +  L ++ K+ +L + DG F++I +E+YES+ K ++    I Y  +++D MV +
Sbjct: 209 KLAINKKLNLFLSTKNTILKKYDGRFKDIFQEIYESDYKSQFENLGISYEHRLIDDMVAQ 268

Query: 249 LFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAP--- 303
           + +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+     
Sbjct: 269 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHY 327

Query: 304 ---DIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGA 348
              +   +   N IA+I + +  L   G  ++  D+ K   ANL E A
Sbjct: 328 RQYEQGKETSTNSIASIFAWSRGLAKRGELDSTPDVIKF--ANLLESA 373

>CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174w IDP2 isocitrate dehydrogenase or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3 or uniprot|P21954
           Saccharomyces cerevisiae YDL066w IDP1
          Length = 418

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 67/126 (53%), Gaps = 11/126 (8%)

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVY-ESNKDKYGQ--IKY 237
            A  + ++A+KR     +  L  T K+ +L + DG F++I +++Y E  K K+ +  I Y
Sbjct: 193 FARASFELAIKR-----KLPLFFTTKNTILKKYDGRFKDIFQKMYDEDYKGKFKELGISY 247

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 295
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  + P+  I   
Sbjct: 248 EHRLIDDMVAQMIKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLLTPDGKIFES 306

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 307 EAAHGT 312

>YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}
           IDP1Mitochondrial NADP-specific isocitrate
           dehydrogenase, catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate; not required for mitochondrial
           respiration and may function to divert
           alpha-ketoglutarate to biosynthetic processes
          Length = 428

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 59/106 (55%), Gaps = 6/106 (5%)

Query: 201 LTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQ--IKYNEQIVDSMVYRLFREPQCFD 257
           L ++ K+ +L + DG F++I +EVYE+  K K+ Q  I Y  +++D MV ++ +    F 
Sbjct: 224 LFLSTKNTILKKYDGRFKDIFQEVYEAQYKSKFEQLGIHYEHRLIDDMVAQMIKSKGGF- 282

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 301
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 283 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066w IDP1 isocitrate dehydrogenase or uniprot|P41939
           Saccharomyces cerevisiae YLR174w IDP2 or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3
          Length = 423

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 63/115 (54%), Gaps = 6/115 (5%)

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQ--IKYNEQIVDSMVYR 248
           +L  + +  L ++ K+ +L + DG F++I +EVY+S  K K+ +  I Y  +++D MV +
Sbjct: 210 KLALQKKLNLFLSTKNTILKKYDGRFKDIFQEVYDSEYKQKFAELNITYEHRLIDDMVAQ 269

Query: 249 LFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 301
           + +    F ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 270 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFESEAAHGT 323

>TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.254
           YDL066W
          Length = 433

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 86/173 (49%), Gaps = 19/173 (10%)

Query: 201 LTVTHKSNVLSQSDGLFREICKEVYESN-KDKYG--QIKYNEQIVDSMVYRLFREPQCFD 257
           L ++ K+ +L + DG F+++ +EV++S  KDK+    IKY  +++D MV ++ +    + 
Sbjct: 229 LFLSTKNTILKKYDGRFKDVFQEVFDSTYKDKFEALNIKYEHRLIDDMVAQMIKSKGGY- 287

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAP-----DIAGKGI 310
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+          GK  
Sbjct: 288 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHYRQHQQGKQT 347

Query: 311 A-NPIATIRSTALMLEFLGH-NNA------AQDIYKAVDANLREGAIKTPDLG 355
           + N IA+I + +  L   G  +N       AQ + KA    ++E  I T DL 
Sbjct: 348 STNSIASIFAWSRGLAKRGELDNTPDVMKFAQTLEKATLDTVQEDGIMTKDLA 400

>SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 421

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 96/204 (47%), Gaps = 20/204 (9%)

Query: 103 VEGYSSPIVALRREMGLFANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKAT 162
           V G+  PI+  R   G     +   +V  G  K +++V   EN  +   K+ + Y  K  
Sbjct: 133 VPGWEKPIIIGRHAHG--DQYKATDAVIPGPGK-LELVYKPENGPE---KVMEVYDYKGP 186

Query: 163 GTRVADATKRISEIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICK 222
           G  +A      +E + R  A  +  +AL +     +  L ++ K+ +L + DG F++I +
Sbjct: 187 GVALAMYN---TEESIRGFAHASFKLALTK-----KLNLYLSTKNTILKKYDGRFKDIFQ 238

Query: 223 EVYESNKDKYGQ---IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGS 279
           E+Y++   K  +   I Y  +++D MV ++ +    F ++   N  GD+ SD  A   GS
Sbjct: 239 ELYDAEYKKQFEAAGIYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 297

Query: 280 LGVVPSANVGPE--IVIGEPCHGS 301
           LG++ S  V P+      E  HG+
Sbjct: 298 LGLMTSVLVTPDGKTFESEAAHGT 321

>Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 6/106 (5%)

Query: 201 LTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQ--IKYNEQIVDSMVYRLFREPQCFD 257
           L ++ K+ +L + DG F++I +EVYE+  K K+ +  I Y  +++D MV ++ +    F 
Sbjct: 225 LFLSTKNTILKKYDGRFKDIFQEVYEAEYKSKFEKLGIHYEHRLIDDMVAQMIKSKGGF- 283

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 301
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 284 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON}
           Anc_4.254
          Length = 424

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 62/115 (53%), Gaps = 6/115 (5%)

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQ--IKYNEQIVDSMVYR 248
           +L    +  L ++ K+ +L + DG F++I + +YE++ K K+ Q  I Y  +++D MV +
Sbjct: 215 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQSIYETHYKAKFQQLNINYEHRLIDDMVAQ 274

Query: 249 LFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 301
           + +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.396
           YLR174W
          Length = 424

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 68/126 (53%), Gaps = 11/126 (8%)

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQ--IKY 237
            A  + ++ALKR     +  L    K+ +L + DGLF++I +++Y+ + K K+ +  I +
Sbjct: 195 FAKSSFELALKR-----KLPLFFATKNTILKEYDGLFKDIFEKLYKDHYKTKFEELGITF 249

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 295
             +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V P+  +   
Sbjct: 250 EHRLIDDMVAQMLKSNGGF-ILSLKNYDGDVQSDIVAQGFGSLGLMTSMLVTPDDSVFES 308

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 309 EAAHGT 314

>TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {ON}
           Anc_1.396 YLR174W
          Length = 418

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVY-ESNKDKYG--QIKY 237
            A  + + AL+R     +  L  T K+ +L Q DG F++I +E+Y +  +DK+    I Y
Sbjct: 198 FAKASFEFALER-----KIPLYSTTKNTILKQYDGKFKDIFEEMYAKEYEDKFKVLNIWY 252

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 295
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 253 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDVVAQGFGSLGLMTSVLLTPDGSSFES 311

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 312 EAAHGT 317

>ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174W IDP2 Cytosolic NADP-specific
           isocitrate dehydrogenase catalyzes oxidation of
           isocitrate to alpha- ketoglutarate levels are elevated
           during growth on non- fermentable carbon sources and
           reduced during growth on glucose
          Length = 411

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 65/127 (51%), Gaps = 13/127 (10%)

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYE----SNKDKYGQIK 236
            A  + ++AL+R Q      L  T K+ +L + DG F++I + +YE    S  +K G I 
Sbjct: 193 FAKASFELALERKQP-----LYSTTKNTILKKYDGKFKDIFEAMYEKEYRSQFEKLG-IW 246

Query: 237 YNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVI 294
           Y  +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  V P+     
Sbjct: 247 YEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFE 305

Query: 295 GEPCHGS 301
            E  HG+
Sbjct: 306 SEAAHGT 312

>Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii AAL022W
          Length = 415

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQ--IKY 237
            A  + ++AL+R     +  L  T K+ +L + DG F++I + +YE   K K+    I Y
Sbjct: 194 FAKSSFELALER-----KMPLYSTTKNTILKKYDGQFKDIFEGMYEREYKQKFEAVGIWY 248

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 295
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 249 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGKTFES 307

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 308 EAAHGT 313

>KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.396
           YLR174W
          Length = 408

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 201 LTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQ--IKYNEQIVDSMVYRLFREPQCFD 257
           L  T K+ +L Q DG F++I K VYE+  K+ + +  I Y  +++D MV ++ +    F 
Sbjct: 205 LYSTTKNTILKQYDGQFKDIFKTVYENEYKETFEELGIWYEHRLIDDMVAQMLKSKGGF- 263

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 301
           +I   N  GD+ SD  A   GSLG++ S  +  +      E  HG+
Sbjct: 264 IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLIAADGKTFESEAAHGT 309

>NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {ON}
           Anc_1.396
          Length = 418

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 201 LTVTHKSNVLSQSDGLFREICKEVY-ESNKDKYGQ--IKYNEQIVDSMVYRLFREPQCFD 257
           L  T K+ +L + DG F++I  E+Y    KD++ +  I Y  +++D MV ++ +    F 
Sbjct: 211 LYFTTKNTILKKYDGTFKDIFMEMYLNEYKDEFDKLGIFYEHRLIDDMVAQMLKSKGGF- 269

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 301
           +I   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 270 IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFQSEAAHGT 315

>KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {ON}
           Anc_1.396 YLR174W
          Length = 412

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 58/106 (54%), Gaps = 6/106 (5%)

Query: 201 LTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQ--IKYNEQIVDSMVYRLFREPQCFD 257
           L  T K+ +L + DG+F++I + +YE   K+K+ +  I Y  +++D MV ++ +    + 
Sbjct: 210 LYSTTKNTILKKYDGMFKDIFEGMYEREYKEKFEELGIWYEHRLIDDMVAQMLKSSGGY- 268

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 301
           +I   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 269 IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGT 314

>KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 429

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 62/115 (53%), Gaps = 6/115 (5%)

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQ--IKYNEQIVDSMVYR 248
           +L    +  L ++ K+ +L + DG F++I +E+Y+S  K ++ +  I Y  +++D MV +
Sbjct: 216 KLAITKKLNLYLSTKNTILKKYDGRFKDIFQEIYDSEYKSEFEKLGIWYEHRLIDDMVAQ 275

Query: 249 LFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 301
           + +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 276 MIKSKGGF-ILAFKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKAFESEAAHGT 329

>SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 411

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESN-KDKYG--QIKY 237
            A  + ++AL+R     +  L  T K+ +L + DG F++I + +Y S+ +DK+    I Y
Sbjct: 192 FAKASFELALER-----KLPLYSTTKNTILKRYDGKFKDIFESMYASDYQDKFEVIGIWY 246

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 295
             +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMSSVLVTPDGKTFES 305

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 306 EAAHGT 311

>KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 413

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 67/128 (52%), Gaps = 11/128 (8%)

Query: 179 RRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQ--I 235
           R  A  + ++AL+R     +  L  T K+ +L + DG F++  + +YE+  ++++ +  I
Sbjct: 192 RGFARASFELALQR-----KMPLYSTTKNTILKRYDGRFKDEFEAMYEAEYRERFERAGI 246

Query: 236 KYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IV 293
            Y  +++D MV ++ +    F VI   N  GD+ SD  A   GSLG++ S  V P+    
Sbjct: 247 WYEHRLIDDMVAQMLKSAGGF-VIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGRAF 305

Query: 294 IGEPCHGS 301
             E  HG+
Sbjct: 306 ESEAAHGT 313

>Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W
           (REAL)
          Length = 428

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 58/106 (54%), Gaps = 6/106 (5%)

Query: 201 LTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQ--IKYNEQIVDSMVYRLFREPQCFD 257
           L ++ K+ +L + DG F++I ++VYE+  K K+    I Y  +++D MV ++ +    F 
Sbjct: 224 LFLSTKNTILKKYDGRFKDIFQKVYEAQYKSKFEALGIHYEHRLIDDMVAQMIKSKGGF- 282

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 301
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 283 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL066W
           (IDP1)
          Length = 425

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 62/115 (53%), Gaps = 6/115 (5%)

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQ--IKYNEQIVDSMVYR 248
           RL    +  L ++ K+ +L Q DG F+++ +E+Y++  K ++ +  I Y  +++D MV +
Sbjct: 215 RLALAKQLNLFLSTKNTILKQYDGRFKDVFEELYQAQYKAEFERLGIYYEHRLIDDMVAQ 274

Query: 249 LFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 301
           + +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 275 MVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGT 328

>AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR174W (IDP2) and
           YNL009W (IDP3)
          Length = 415

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESN-KDKY--GQIKY 237
            A  + ++AL+R     +  L  T K+ +L + DG F++I + +Y +  K+K+    I Y
Sbjct: 194 FAKSSFELALQR-----KMPLYSTTKNTILKKYDGKFKDIFEGMYAAEYKEKFEAAGIWY 248

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 295
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 249 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGKTFES 307

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 308 EAAHGT 313

>KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 79/159 (49%), Gaps = 14/159 (8%)

Query: 201 LTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQ--IKYNEQIVDSMVYRLFREPQCFD 257
           L ++ K+ +L + DG F+++ +E++++  K ++ +  I+Y  +++D MV ++ +    F 
Sbjct: 224 LFLSTKNTILKRYDGRFKDLFQEIFDAEYKQQFEESGIQYQHRLIDDMVAQMIKSKGGF- 282

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAPDIAGK------G 309
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+      K       
Sbjct: 283 IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRKYQRGEET 342

Query: 310 IANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGA 348
             NPIA+I +    +   G  +   D+ +   AN+ E A
Sbjct: 343 STNPIASIFAWTRGIAKRGELDGTPDVVRF--ANILESA 379

>Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 58/106 (54%), Gaps = 6/106 (5%)

Query: 201 LTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQ--IKYNEQIVDSMVYRLFREPQCFD 257
           L ++ K+ +L + DG F++I + +YE+  K K+ +  I Y  +++D MV ++ +    F 
Sbjct: 225 LFLSTKNTILKKYDGRFKDIFQNIYEAQYKPKFEELGIHYEHRLIDDMVAQMVKSKGGF- 283

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 301
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 284 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}
           IDP3Peroxisomal NADP-dependent isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to alpha-ketoglutarate
           with the formation of NADP(H+), required for growth on
           unsaturated fatty acids
          Length = 420

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 87/191 (45%), Gaps = 20/191 (10%)

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQIK--Y 237
            A  + ++ALKR     +  L  T K+ +L   D  F++I   +++   K+K+  +K  Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDNLFDKEYKEKFQALKITY 246

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 295
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFES 305

Query: 296 EPCHGSAPDIAGKG------IANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGA- 348
           E  HG+      K         N IA+I +    +   G  +   D+ K    NL E A 
Sbjct: 306 EAAHGTVTRHFRKHQRGEETSTNSIASIFAWTRAIIQRGKLDNTDDVIKF--GNLLEKAT 363

Query: 349 IKTPDLGGKAS 359
           + T  +GGK +
Sbjct: 364 LDTVQVGGKMT 374

>NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa]
           {ON} Anc_1.396
          Length = 413

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 63/129 (48%), Gaps = 17/129 (13%)

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQ------ 234
            A  +  +AL+R     +  L  T K+ +L + DG F+ + +++YE    +Y Q      
Sbjct: 194 FARSSFQLALER-----QLPLYSTTKNTILKKYDGKFKSVFEDMYER---EYKQQFEDLG 245

Query: 235 IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--I 292
           I Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V P+   
Sbjct: 246 IWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVAPDGKT 304

Query: 293 VIGEPCHGS 301
              E  HG+
Sbjct: 305 FESEAAHGT 313

>CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174w IDP2 isocitrate dehydrogenase or
           uniprot|P53982 Saccharomyces cerevisiae YNL009w IDP3 or
           uniprot|P21954 Saccharomyces cerevisiae YDL066w IDP1
          Length = 411

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 66/130 (50%), Gaps = 11/130 (8%)

Query: 177 ATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQ- 234
           + R  A  + ++AL+      E  L  T K+ +L + DG F++  + +YE+  K+++   
Sbjct: 188 SIRGFARASFNMALEH-----EMPLYSTTKNTILKKYDGKFKDTFESMYEAEYKEQFEAK 242

Query: 235 -IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE-- 291
            I Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  + P+  
Sbjct: 243 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLISPDGK 301

Query: 292 IVIGEPCHGS 301
               E  HG+
Sbjct: 302 TFESEAAHGT 311

>Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174W
           (REAL)
          Length = 418

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVY-ESNKDKYGQ--IKY 237
            A  + ++ALKR     +  L  T K+ +L   D  F++I   ++ E  ++K+    IKY
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDGLFNEKYREKFQALGIKY 246

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 295
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFES 305

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 306 EAAHGT 311

>KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {ON}
           Anc_4.254 YDL066W
          Length = 421

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 201 LTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQ--IKYNEQIVDSMVYRLFREPQCFD 257
           L +  K+ +L + DG F++I +++Y    K K+ Q  I Y  +++D MV ++ +    F 
Sbjct: 219 LFLATKNTILKKYDGRFKDIFQQIYNGQYKAKFEQLGITYEHRLIDDMVAQMIKSKGGF- 277

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 301
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 278 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVSPDGKTFESEAAHGT 323

>Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa]
           {ON} complement(198298..199557) [1260 nt, 420 aa]
          Length = 419

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 201 LTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQ--IKYNEQIVDSMVYRLFREPQCFD 257
           L  T K+ +L + DG +++I  ++YE + KDK+    I Y  +++D MV ++ +    F 
Sbjct: 212 LYSTTKNTILKKYDGQYKDIFNDMYEKDYKDKFEAKGIWYEHRLIDDMVAQMLKSKGGF- 270

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 301
           VI   N  GD+ SD  A   GSLG++ S  +  +      E  HG+
Sbjct: 271 VIAMKNYDGDVQSDVVAQGFGSLGLMSSILISDDGKTFESEAAHGT 316

>NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {ON}
           Anc_4.254
          Length = 426

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 76/159 (47%), Gaps = 14/159 (8%)

Query: 201 LTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQ--IKYNEQIVDSMVYRLFREPQCFD 257
           L ++ K+ +L + DG F++I +E+++   K K+    I Y  +++D MV ++ +    F 
Sbjct: 222 LFLSTKNTILKKYDGRFKDIFQEIFDMEYKTKFANLGISYEHRLIDDMVAQMIKSKGGF- 280

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAPDIAGK------G 309
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+      K       
Sbjct: 281 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHYRKFQKGEET 340

Query: 310 IANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGA 348
             N IA+I + +  L   G  +   D+ +   ANL E A
Sbjct: 341 STNSIASIFAWSRGLAKRGELDGTPDVVRF--ANLLEAA 377

>KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 420

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 91/210 (43%), Gaps = 33/210 (15%)

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQ---IKYNEQIVDSMVYR 248
           RL    +  L +  K+ +L Q DG F+++ +++Y++   +  +   I Y  +++D MV +
Sbjct: 207 RLALSKQLNLFLATKNTILKQYDGRFKDLFQQLYDAEYREAFERAGISYEHRLIDDMVAQ 266

Query: 249 LFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS----- 301
           + +    F V+   N  GD+ SD  A   GSLG++ S  + P+      E  HG+     
Sbjct: 267 MIKSRGGF-VLALKNYDGDVQSDIVAQGFGSLGLMSSVLITPDGNAFESEAAHGTVTRHF 325

Query: 302 -----APDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVD-ANLR---EGAIKTP 352
                  + +   IA+  A  R  A   +  G   A  D   A++ A LR   + AI T 
Sbjct: 326 RLHQQGKETSTNSIASIFAWTRGLARRADLDG-TPAVADFAHALEGATLRTVQDDAIMTK 384

Query: 353 DLG---GKASTQ---------QVVEDVLSR 370
           DL    GK             Q VED L R
Sbjct: 385 DLALACGKTDRTAYVTTDEFLQAVEDRLQR 414

>TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa]
           {ON} Anc_1.396 YLR174W
          Length = 414

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (51%), Gaps = 13/127 (10%)

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVY----ESNKDKYGQIK 236
            A  + ++AL+R     +  L  T K+ +L + DG F+++ +++Y    +S  ++ G I 
Sbjct: 191 FAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEQMYADQYQSRFEELG-IW 244

Query: 237 YNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVI 294
           Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V P+     
Sbjct: 245 YEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLVTPDGKTFE 303

Query: 295 GEPCHGS 301
            E  HG+
Sbjct: 304 SEAAHGT 310

>TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.254
           YDL066W
          Length = 423

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 61/115 (53%), Gaps = 6/115 (5%)

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESN-KDKY--GQIKYNEQIVDSMVYR 248
           +L    +  L ++ K+ +L + DG F++I +E++++  K ++    I Y  +++D MV +
Sbjct: 210 KLALNKKLNLFLSTKNTILKKYDGRFKDIFQEIFDAEYKTQFEAANISYEHRLIDDMVAQ 269

Query: 249 LFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 301
           + +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 270 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGT 323

>Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009W
           (REAL)
          Length = 420

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQ--IKY 237
            A  + ++ALKR        L  T K+ +L   D  F+EI  +++++  K+K+    I Y
Sbjct: 192 FAKASFELALKR-----RLPLFFTTKNTILKSYDNQFKEIFDKLFDAEYKEKFQALGITY 246

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 295
             +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSRGGF-IVAMKNYDGDVQSDIVAQGFGSLGLMTSLLITPDAKTFES 305

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 306 EAAHGT 311

>Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVY-ESNKDKYGQ--IKY 237
            A  + ++A++R     +  L  T K+ +L + DG F+++ + +Y ES K+K+    I Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEGMYAESYKEKFESLGIWY 246

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 295
             +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 306 EAAHGT 311

>NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396
          Length = 419

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 63/119 (52%), Gaps = 11/119 (9%)

Query: 188 IALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQI--KYNEQIVDS 244
           +ALKR     +  L +  K+ +L + DG F+ I  ++Y++  K+K+ ++   Y  +++D 
Sbjct: 202 MALKR-----KLPLFLATKNTILKKYDGRFKSIFDDMYQNEFKEKFEKLGLTYEHRLIDD 256

Query: 245 MVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 301
           MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 257 MVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSQLITPDGKTFQSEAAHGT 314

>Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009W
           (REAL)
          Length = 417

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 62/126 (49%), Gaps = 11/126 (8%)

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQ---IKY 237
            A  + ++ALKR     +  L  T K+ +L   D  F++I  +++++   +  Q   I Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDKLFDAEYKEQFQALGITY 246

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 295
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFES 305

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 306 EAAHGT 311

>KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 415

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 89/198 (44%), Gaps = 28/198 (14%)

Query: 201 LTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQ---IKYNEQIVDSMVYRLFREPQCFD 257
           L  T K+ +L + DG F+++ + +YES      +   I Y  +++D MV ++ +    + 
Sbjct: 210 LYSTTKNTILKKYDGKFKDVFESLYESQYKSAFEAKGIWYEHRLIDDMVAQMLKSKGGY- 268

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAP-----DIAGKGI 310
           +I   N  GD+ SD  A   GSLG++ S  + P+      E  HG+          GK  
Sbjct: 269 IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKAFESEAAHGTVTRHYRQHQQGKET 328

Query: 311 A-NPIATIRSTALMLEFLGHNNAAQDIYK-------AVDANLREGAIKTPDLG---GKA- 358
           + N IA+I +    L   G  ++  D+ K       A    ++E  I T DL    GK  
Sbjct: 329 STNSIASIFAWTRGLIQRGKLDSTPDVVKFAELVESATVNTVQEDEIMTKDLALILGKTD 388

Query: 359 -----STQQVVEDVLSRL 371
                +T++ +E V  RL
Sbjct: 389 RSSYVTTEEFIEAVHKRL 406

>Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESN-KDKYGQ--IKY 237
            A  + ++A++R     +  L  T K+ +L + DG F+++ + +Y  N K+K+    I Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAENYKEKFESLGIWY 246

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 295
             +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSMLITPDGKTFES 305

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 306 EAAHGT 311

>TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 55/106 (51%), Gaps = 6/106 (5%)

Query: 201 LTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQ---IKYNEQIVDSMVYRLFREPQCFD 257
           L +  K+ +L + DG F++I +E+YE+   K  +   I Y  +++D MV ++ +    + 
Sbjct: 222 LFLATKNTILKKYDGRFKDIFQEIYENEYKKEFERLNITYEHRLIDDMVAQMIKSKGGY- 280

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 301
           ++   N  GD+ SD  A   GSLG++ S    P+      E  HG+
Sbjct: 281 IMALKNYDGDVQSDIVAQGFGSLGLMTSILASPDGKTFESEAAHGT 326

>Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP2)
           - Cytosolic form of NADP-dependent isocitrate
           dehydrogenase [contig 82] FULL
          Length = 411

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 64/127 (50%), Gaps = 13/127 (10%)

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVY----ESNKDKYGQIK 236
            A  + ++AL+R        L  T K+ +L + DG F+++ + +Y    +S  ++ G I 
Sbjct: 192 FARASFELALQR-----RMPLYSTTKNTILKKYDGKFKDVFEAMYAAEYQSRFEELG-IW 245

Query: 237 YNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVI 294
           Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V P+     
Sbjct: 246 YEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFE 304

Query: 295 GEPCHGS 301
            E  HG+
Sbjct: 305 SEAAHGT 311

>ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 422

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 58/107 (54%), Gaps = 8/107 (7%)

Query: 201 LTVTHKSNVLSQSDGLFREICKEVYESNK----DKYGQIKYNEQIVDSMVYRLFREPQCF 256
           L ++ K+ +L + DG F++I +E+Y++      +K G I Y  +++D MV ++ +    F
Sbjct: 218 LYLSTKNTILKKYDGRFKDIFQELYDTQYKAEFEKAG-IFYEHRLIDDMVAQMVKSKGGF 276

Query: 257 DVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 301
            ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 277 -IMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGT 322

>Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVY-ESNKDKYGQ--IKY 237
            A  + ++AL+R     +  L  T K+ +L + DG F+++ + +Y E  K+K+    I Y
Sbjct: 192 FAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAEVYKEKFEALGIWY 246

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 295
             +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSLLITPDGKTFES 305

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 306 EAAHGT 311

>YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}
           IDP2Cytosolic NADP-specific isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to
           alpha-ketoglutarate; levels are elevated during growth
           on non-fermentable carbon sources and reduced during
           growth on glucose
          Length = 412

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVY-ESNKDKYGQ--IKY 237
            A  + ++A++R     +  L  T K+ +L + DG F+++ + +Y  S K+K+    I Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYARSYKEKFESLGIWY 246

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 295
             +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 306 EAAHGT 311

>TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.396
           YLR174W
          Length = 422

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVY-ESNKDKYG--QIKY 237
            A  + + AL+R     +  L  T K+ +L + DG F++I + +Y E  ++K+    I Y
Sbjct: 203 FARSSFEFALER-----KLPLYSTTKNTILKKYDGQFKDIFESMYKEEYEEKFKALNIWY 257

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 295
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +  +      
Sbjct: 258 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISDDGKTFES 316

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 317 EAAHGT 322

>Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar to
           Ashbya gossypii AER061C
          Length = 424

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%), Gaps = 8/107 (7%)

Query: 201 LTVTHKSNVLSQSDGLFREICKEVYESNK----DKYGQIKYNEQIVDSMVYRLFREPQCF 256
           L ++ K+ +L   DG F++I +E+Y++      + +G I Y  +++D MV ++ +    F
Sbjct: 220 LFLSTKNTILKTYDGRFKDIFQELYDTQYKTEFENHG-IYYEHRLIDDMVAQMIKSKGGF 278

Query: 257 DVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 301
            ++   N  GD+ SD  A   GSLG++ S    P+      E  HG+
Sbjct: 279 -IMALKNYDGDVQSDIVAQGFGSLGLMTSILATPDGKTFESEAAHGT 324

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 38.5 bits (88), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 29/50 (58%)

Query: 322 LMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQQVVEDVLSRL 371
           LML  LG N +A  I KAV   + EG   T D+GG +ST     +++++L
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 50

>NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa]
           {ON} Anc_1.396
          Length = 420

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 61/127 (48%), Gaps = 11/127 (8%)

Query: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQ---IKY 237
            A  +  +AL+R     +  L  T K+ +L + DG F++I + +YE    +  +   I Y
Sbjct: 200 FALSSFKLALER-----KMPLYSTTKNTILKRYDGKFKDIFENMYEEQFREQFEELGIWY 254

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 295
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +  +      
Sbjct: 255 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISSDGKSFES 313

Query: 296 EPCHGSA 302
           E  HG+ 
Sbjct: 314 EAAHGTV 320

>KNAG0A03750 Chr1 (487451..489943) [2493 bp, 830 aa] {ON} Anc_8.531
           YBR202W
          Length = 830

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 120 FANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATR 179
            A +R V  VE  +D    + +VR + E LY    KT  D+   TR+ +  KR+S+    
Sbjct: 702 LAKLRLVNRVEV-EDVEEALRLVRVSKESLYQDNTKTREDQNPTTRIYNLIKRMSQDTLE 760

Query: 180 RIATIAMDIALKRLQTRGEATLTVTH 205
              T++ D  +K +++RG   L + +
Sbjct: 761 NRGTLSYDTIVKTVRSRGFTMLQLNN 786

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,870,485
Number of extensions: 1444182
Number of successful extensions: 4277
Number of sequences better than 10.0: 141
Number of HSP's gapped: 4044
Number of HSP's successfully gapped: 141
Length of query: 371
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 260
Effective length of database: 40,753,473
Effective search space: 10595902980
Effective search space used: 10595902980
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)