Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_9.842.284ON80880838370.0
YIL095W (PRK1)2.284ON81081031320.0
Skud_9.782.284ON80981029820.0
Suva_9.1042.284ON80580928630.0
KAFR0J013702.284ON78074416410.0
NCAS0B062602.284ON72373915860.0
NDAI0B035602.284ON75673315080.0
KLLA0E08405g2.284ON77776814870.0
KLTH0G10318g2.284ON79057714580.0
TDEL0G021502.284ON66131613930.0
NCAS0G038102.284ON66141913611e-178
KAFR0H033302.284ON36932613231e-177
Kwal_27.115422.284ON79131513531e-175
NDAI0G006402.284ON62131513261e-173
SAKL0E07722g2.284ON79131513411e-173
ZYRO0A01848g2.284ON70451413281e-172
ADL217W2.284ON75056213281e-172
CAGL0G02607g2.284ON68839013211e-172
TPHA0C033802.284ON69732313121e-170
Kpol_1003.352.284ON71331813041e-169
TBLA0B059302.284ON71733413011e-168
Skud_14.3092.284ON63931512741e-165
Suva_14.3272.284ON63230912701e-165
YNL020C (ARK1)2.284ON63832212691e-165
Smik_14.3112.284ON63739612651e-164
Ecym_33232.284ON74848812731e-164
KNAG0H020202.284ON59232012011e-155
TPHA0D015402.284ON70757011711e-149
KNAG0A054302.284ON78832211521e-145
CAGL0J03432g2.284ON62231211271e-144
TBLA0B069402.284ON144332211741e-142
KAFR0A010403.273ON9123248052e-93
CAGL0H10208g3.273ON10273228051e-92
KNAG0H012203.273ON9133307921e-91
Kpol_251.43.273ON8383177872e-91
SAKL0D03234g3.273ON8583157872e-91
KNAG0J008203.273ON10913267809e-89
Smik_2.1913.273ON11083197801e-88
TBLA0E025903.273ON10613187791e-88
Kpol_1052.223.273ON11013117791e-88
KLTH0C07260g3.273ON9013167701e-88
ZYRO0E06864g3.273ON11153187764e-88
Suva_4.2973.273ON11073197746e-88
Skud_2.1793.273ON10903197693e-87
NCAS0A105903.273ON10953177684e-87
KLLA0F18612g3.273ON8143197538e-87
Ecym_26503.273ON8943107561e-86
Kwal_27.109453.273ON9353587581e-86
YBR059C (AKL1)3.273ON11083197607e-86
KAFR0C004303.273ON9493287521e-85
TPHA0A040303.273ON10543217561e-85
NDAI0A057003.273ON11573267555e-85
TDEL0D035203.273ON10493167516e-85
TPHA0M011203.273ON7883167342e-84
TBLA0I019303.273ON13613167501e-83
CAGL0K11990g3.273ON9913287372e-83
AGR027C3.273ON9613167283e-82
KAFR0A050906.31ON6682412342e-19
Suva_16.706.262ON3643452273e-19
KNAG0F001701.24ON5431952315e-19
SAKL0H06754g8.668ON8842922263e-18
Skud_16.426.262ON3643322194e-18
TBLA0A047207.86ON12622332239e-18
KLTH0F16676g5.406ON8782692211e-17
Kwal_56.242746.262ON3463362141e-17
KNAG0D048107.86ON14401802211e-17
TPHA0E038501.24ON4821932172e-17
TDEL0A067506.262ON3723002142e-17
TPHA0F024306.31ON7982142202e-17
ZYRO0D05500g7.86ON12621792183e-17
SAKL0A03344g6.262ON3643512114e-17
Kpol_1072.198.668ON8962852157e-17
Kwal_26.71547.86ON12131802158e-17
YPL236C (ENV7)6.262ON3643282089e-17
CAGL0K08514g2.479ON14892182141e-16
KLTH0H03080g6.262ON3463342052e-16
Kwal_26.87518.668ON8483082112e-16
Smik_1.793.177ON9742682112e-16
Kpol_1023.266.31ON7392702102e-16
Kwal_55.215455.406ON8652692103e-16
ZYRO0F07194g8.668ON9382802103e-16
KLTH0D02486g7.86ON12231802113e-16
NDAI0F045201.24ON4892112073e-16
Kpol_2002.241.24ON4872602064e-16
YAR019C (CDC15)3.177ON9742682084e-16
KAFR0G012001.24ON5072672055e-16
KLLA0E21693g5.406ON10162222076e-16
TPHA0H026307.86ON13671832086e-16
Kpol_431.92.479ON15521992086e-16
Smik_6.4416.262ON3643382017e-16
TDEL0H036407.86ON12372352078e-16
KNAG0D008306.262ON3873362018e-16
CAGL0I07513g3.92ON10763752069e-16
TBLA0E022907.86ON13001922051e-15
Skud_1.723.177ON9742672051e-15
Kpol_1037.206.31ON7042812041e-15
ABL034W2.479ON14251982051e-15
Kpol_1044.37.86ON9321792041e-15
NCAS0C041208.140ON9153312032e-15
KAFR0D012207.86ON10551912032e-15
TDEL0C067801.24ON4682792002e-15
KLTH0D11044g8.668ON8492022022e-15
KLLA0F07623g7.86ON12291912032e-15
NDAI0H024707.86ON14111832032e-15
CAGL0F00913g7.86ON12061882032e-15
CAGL0G04609g3.92ON9653562023e-15
ACL006W6.31ON7083012003e-15
Skud_16.1328.668ON9242892004e-15
TPHA0G016308.668ON8712012004e-15
NCAS0D021006.31ON7262811994e-15
TDEL0A027202.496ON9152762004e-15
Ecym_10301.24ON4402761965e-15
NDAI0C026806.31ON7502851995e-15
CAGL0L03520g1.271ON14472822005e-15
NCAS0A002801.24ON5352821976e-15
Suva_16.1608.668ON9182911986e-15
KAFR0D049505.406ON10082471996e-15
Kpol_1040.207.86ON12971801996e-15
Sklu_YGOB_Anc_2.4962.496ON6192701977e-15
Smik_13.1596.31ON7052751977e-15
ZYRO0F18062g1.24ON4711971958e-15
CAGL0J11638g6.31ON7463411978e-15
Ecym_26407.86ON13251831988e-15
Kwal_33.131121.24ON5051921958e-15
TBLA0H016605.406ON9962411979e-15
KNAG0E008506.31ON7112811969e-15
YDR523C (SPS1)1.24ON4901961941e-14
CAGL0K02167g8.140ON11622801971e-14
Ecym_73922.479ON14342011971e-14
ZYRO0B01166g2.496ON9632851961e-14
NCAS0C016708.668ON8962021961e-14
NDAI0K021002.496ON9092301961e-14
SAKL0C01716g1.52ON12153001961e-14
YDR490C (PKH1)3.92ON7661981951e-14
TPHA0J004206.31ON7073401951e-14
KAFR0K007007.86ON13811821961e-14
Skud_13.1546.31ON7053161952e-14
AFR724C1.24ON4402841922e-14
NCAS0F015807.86ON13821831952e-14
TDEL0A075606.341ON15753091952e-14
CAGL0M02299g8.668ON8931971942e-14
Kpol_463.81.271ON14472781952e-14
Suva_6.1691.271ON14842811952e-14
Kpol_1055.242.496ON9372811942e-14
Kwal_26.78612.496ON9552961942e-14
KLLA0F14190g1.271ON13382581942e-14
KAFR0C014403.92ON10952751942e-14
ACR133C8.668ON8511951932e-14
YPL150W8.668ON9012851933e-14
Ecym_24058.668ON8551971933e-14
Ecym_30356.31ON7403011933e-14
NDAI0A038702.496ON8952851933e-14
Smik_15.1227.86ON11011851933e-14
SAKL0C00946g1.24ON5642101913e-14
Skud_8.392.496ON9232821933e-14
YOL045W (PSK2)7.86ON11011851933e-14
KNAG0B053502.496ON8362291923e-14
KLLA0B13607g2.496ON9892701933e-14
TBLA0B023103.92ON8191971923e-14
Skud_15.1127.86ON11011851933e-14
Suva_1.507.86ON13601771933e-14
SAKL0E01584g6.31ON6952851914e-14
YMR001C (CDC5)6.31ON7052751914e-14
SAKL0H07084g8.654ON9192131924e-14
KLTH0F00946g1.24ON5121921904e-14
KLLA0F13552g2.479ON12672011924e-14
Smik_4.8031.24ON4901961894e-14
TDEL0D053203.92ON10572311924e-14
TBLA0A071501.52ON13912991924e-14
TDEL0A061408.668ON8612851914e-14
Suva_13.1636.31ON7052751914e-14
Ecym_21536.262ON3633451874e-14
SAKL0B09856g7.86ON12741911924e-14
Skud_8.1635.406ON10762281924e-14
YCR073C (SSK22)6.341ON13313051924e-14
ZYRO0E07876g6.262ON3693351874e-14
Kpol_1031.105.406ON11272281915e-14
KLLA0C08525g6.341ON15512841915e-14
NDAI0G042903.92ON11131961915e-14
TDEL0A025502.479ON13691991915e-14
KLTH0C09548g3.92ON9931951915e-14
AFR696C1.52ON11422321916e-14
ACR281C7.86ON12591831916e-14
Skud_4.7971.24ON4851961886e-14
Suva_15.2975.406ON10742311906e-14
NCAS0C041008.141ON9053291907e-14
CAGL0K02673g2.496ON9152241907e-14
YJL095W (BCK1)1.271ON14782811907e-14
TDEL0G043806.31ON7222811897e-14
YHL007C (STE20)2.496ON9392821907e-14
SAKL0G01848g5.406ON8852211907e-14
Smik_8.422.496ON9392821907e-14
NDAI0E023908.668ON8831951907e-14
KNAG0F002901.52ON11253021907e-14
KNAG0I028306.341ON15153101908e-14
TBLA0B082503.92ON13471951908e-14
YAL017W (PSK1)7.86ON13561801908e-14
Skud_10.1191.271ON14812231909e-14
Suva_2.7031.24ON4851961869e-14
KNAG0J016708.668ON10092001899e-14
NCAS0C049403.92ON11161931891e-13
TBLA0I011502.479ON17452041891e-13
NDAI0D027502.479ON15151971891e-13
TBLA0B004906.31ON7872901881e-13
KLTH0D03454g1.271ON14333091891e-13
Kwal_56.226933.92ON9841921881e-13
KAFR0A083603.60ON8292451871e-13
Suva_8.472.496ON9802821881e-13
Smik_6.3478.668ON9172911881e-13
KLLA0C12485g3.92ON9252281881e-13
TBLA0B085203.60ON9342451871e-13
TPHA0G032902.496ON9732351871e-13
TBLA0I002802.496ON13162971881e-13
Kpol_1028.406.341ON15913121881e-13
KLLA0C06138g6.31ON7082761861e-13
TPHA0I009201.271ON14342641881e-13
AER264C6.341ON14832881872e-13
TPHA0G032002.479ON15342001872e-13
CAGL0L11550g5.406ON10721941872e-13
KAFR0H025108.668ON8792421862e-13
Smik_8.1805.406ON10732281872e-13
KLTH0D06006g2.496ON9542961862e-13
NDAI0F013406.262ON4061531822e-13
Smik_4.7673.92ON7582021852e-13
CAGL0H01639g1.24ON5212651842e-13
Smik_1.507.86ON13571771862e-13
KLLA0C01650g1.52ON11122351862e-13
Smik_10.1471.271ON14782811862e-13
Suva_1.863.177ON9742691862e-13
KLTH0C10912g6.31ON6972811852e-13
TBLA0A074601.24ON5161871842e-13
NDAI0G034508.141ON9483221852e-13
ZYRO0C07480g6.31ON7742811852e-13
TBLA0B039708.654ON12082021853e-13
KLTH0D05566g2.479ON11281971853e-13
TBLA0A035705.406ON9751951853e-13
ZYRO0A06446g5.406ON9432281853e-13
Suva_15.1247.86ON11061851843e-13
Suva_2.6663.92ON7641981843e-13
Suva_3.1106.341ON13763091853e-13
KLLA0F11319g8.668ON8431951843e-13
NCAS0D046006.341ON16833061853e-13
CAGL0H06259g7.86ON13361781843e-13
CAGL0K05709g1.52ON11032351843e-13
Ecym_24342.496ON11222701844e-13
YHR102W (KIC1)5.406ON10802291844e-13
NCAS0H019405.406ON10152281834e-13
Kwal_26.77882.479ON12671971844e-13
Ecym_55055.406ON10032281834e-13
Skud_4.7643.92ON7562021834e-13
NOTE: 1 genes in the same pillar as Smik_9.84 were not hit in these BLAST results
LIST: Kpol_1039.33

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_9.84
         (808 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...  1482   0.0  
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...  1211   0.0  
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...  1153   0.0  
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...  1107   0.0  
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   636   0.0  
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   615   0.0  
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   585   0.0  
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   577   0.0  
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   566   0.0  
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   541   0.0  
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   528   e-178
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   514   e-177
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   525   e-175
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    515   e-173
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   521   e-173
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   516   e-172
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   516   e-172
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   513   e-172
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   509   e-170
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   506   e-169
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   505   e-168
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   495   e-165
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   493   e-165
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   493   e-165
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   491   e-164
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   494   e-164
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   467   e-155
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   455   e-149
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   448   e-145
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   438   e-144
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   456   e-142
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   314   2e-93
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   314   1e-92
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   309   1e-91
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   307   2e-91
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   307   2e-91
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   305   9e-89
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   305   1e-88
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   304   1e-88
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   304   1e-88
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   301   1e-88
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   303   4e-88
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   302   6e-88
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   300   3e-87
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   300   4e-87
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   294   8e-87
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   295   1e-86
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   296   1e-86
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   297   7e-86
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   294   1e-85
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   295   1e-85
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   295   5e-85
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   293   6e-85
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   287   2e-84
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   293   1e-83
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   288   2e-83
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   285   3e-82
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             95   2e-19
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    92   3e-19
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    94   5e-19
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    92   3e-18
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    89   4e-18
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    91   9e-18
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    90   1e-17
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    87   1e-17
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    90   1e-17
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    88   2e-17
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    87   2e-17
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    89   2e-17
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    89   3e-17
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    86   4e-17
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    87   7e-17
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    87   8e-17
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    85   9e-17
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    87   1e-16
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    84   2e-16
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    86   2e-16
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    86   2e-16
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    86   2e-16
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    86   3e-16
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    86   3e-16
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    86   3e-16
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    84   3e-16
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    84   4e-16
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    85   4e-16
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    84   5e-16
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    84   6e-16
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    85   6e-16
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    85   6e-16
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    82   7e-16
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    84   8e-16
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    82   8e-16
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    84   9e-16
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    84   1e-15
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    84   1e-15
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    83   1e-15
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    84   1e-15
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    83   1e-15
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    83   2e-15
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    83   2e-15
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    82   2e-15
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    82   2e-15
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    83   2e-15
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    83   2e-15
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    83   2e-15
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    82   3e-15
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    82   3e-15
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    82   4e-15
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    82   4e-15
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      81   4e-15
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    82   4e-15
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    80   5e-15
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    81   5e-15
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    82   5e-15
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        80   6e-15
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    81   6e-15
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    81   6e-15
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    81   6e-15
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    80   7e-15
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    80   7e-15
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    80   8e-15
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    80   8e-15
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    81   8e-15
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    80   8e-15
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    80   9e-15
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    80   9e-15
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    79   1e-14
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    80   1e-14
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    80   1e-14
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    80   1e-14
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    80   1e-14
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    80   1e-14
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    80   1e-14
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    80   1e-14
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    80   1e-14
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    80   1e-14
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    80   2e-14
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    79   2e-14
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    80   2e-14
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    80   2e-14
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    79   2e-14
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    80   2e-14
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    80   2e-14
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    79   2e-14
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    79   2e-14
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    79   2e-14
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    79   2e-14
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    79   2e-14
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    79   3e-14
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    79   3e-14
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    79   3e-14
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     79   3e-14
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    79   3e-14
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    78   3e-14
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    79   3e-14
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    79   3e-14
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    79   3e-14
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    79   3e-14
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    79   3e-14
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    79   3e-14
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    79   3e-14
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    78   4e-14
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    78   4e-14
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    79   4e-14
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    78   4e-14
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    79   4e-14
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    77   4e-14
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    79   4e-14
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    79   4e-14
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    78   4e-14
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    78   4e-14
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    77   4e-14
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    79   4e-14
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    79   4e-14
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    79   4e-14
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    77   4e-14
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    78   5e-14
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    78   5e-14
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    78   5e-14
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    78   5e-14
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    78   5e-14
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    78   6e-14
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    78   6e-14
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    77   6e-14
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    78   6e-14
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     78   7e-14
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    78   7e-14
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    78   7e-14
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    77   7e-14
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    78   7e-14
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    78   7e-14
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    78   7e-14
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    78   7e-14
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    78   7e-14
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    78   8e-14
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    78   8e-14
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    78   8e-14
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    78   9e-14
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    76   9e-14
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    77   9e-14
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    77   1e-13
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    77   1e-13
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    77   1e-13
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    77   1e-13
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    77   1e-13
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    77   1e-13
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    77   1e-13
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    77   1e-13
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    77   1e-13
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    77   1e-13
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    77   1e-13
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    77   1e-13
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    77   1e-13
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    77   1e-13
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    76   1e-13
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    77   1e-13
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    77   2e-13
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    77   2e-13
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    77   2e-13
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    76   2e-13
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    77   2e-13
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    76   2e-13
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    75   2e-13
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    76   2e-13
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    75   2e-13
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    76   2e-13
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    76   2e-13
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    76   2e-13
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    76   2e-13
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    76   2e-13
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    75   2e-13
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     76   2e-13
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    76   2e-13
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    76   3e-13
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    76   3e-13
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    76   3e-13
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    76   3e-13
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    75   3e-13
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    75   3e-13
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    76   3e-13
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    75   3e-13
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    76   3e-13
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    75   3e-13
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    75   3e-13
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    75   4e-13
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    75   4e-13
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    75   4e-13
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    75   4e-13
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    75   4e-13
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    75   4e-13
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    75   4e-13
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    75   5e-13
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    75   5e-13
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    75   5e-13
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    75   6e-13
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    75   6e-13
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    75   6e-13
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    75   6e-13
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    75   6e-13
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    74   7e-13
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    75   7e-13
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    73   7e-13
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    74   7e-13
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    74   7e-13
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    75   7e-13
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    74   8e-13
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    74   9e-13
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    74   1e-12
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    74   1e-12
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    74   1e-12
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    74   1e-12
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     74   1e-12
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    74   1e-12
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    74   1e-12
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    74   1e-12
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    74   1e-12
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    73   1e-12
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    73   1e-12
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    72   1e-12
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    74   1e-12
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    74   1e-12
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    74   1e-12
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    73   1e-12
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    73   1e-12
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    74   1e-12
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    73   2e-12
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    73   2e-12
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    73   2e-12
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    73   2e-12
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    73   2e-12
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    73   2e-12
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    73   2e-12
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    73   2e-12
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    73   2e-12
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    73   2e-12
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    73   2e-12
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               72   2e-12
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    72   2e-12
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    73   2e-12
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    73   2e-12
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    73   2e-12
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    72   3e-12
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    73   3e-12
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    71   3e-12
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    72   3e-12
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    72   3e-12
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    72   3e-12
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    72   3e-12
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    72   3e-12
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    72   3e-12
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    72   4e-12
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    72   4e-12
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    72   4e-12
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    72   4e-12
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    70   4e-12
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    72   4e-12
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    72   4e-12
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     72   4e-12
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    72   4e-12
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    72   4e-12
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    72   4e-12
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    72   5e-12
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    72   5e-12
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    72   5e-12
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    72   5e-12
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    72   5e-12
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    72   5e-12
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    72   5e-12
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    72   6e-12
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     70   6e-12
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    71   6e-12
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    71   6e-12
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    71   7e-12
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    71   7e-12
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    71   7e-12
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    71   7e-12
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    71   7e-12
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    70   8e-12
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    71   8e-12
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    70   8e-12
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    71   8e-12
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    71   8e-12
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    70   9e-12
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    71   9e-12
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    71   9e-12
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       71   9e-12
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    71   9e-12
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    71   9e-12
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    71   1e-11
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    71   1e-11
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    69   1e-11
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    71   1e-11
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    71   1e-11
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    71   1e-11
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    70   1e-11
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    70   1e-11
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    70   1e-11
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    70   1e-11
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    70   1e-11
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    70   1e-11
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    70   1e-11
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    70   1e-11
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    70   1e-11
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    70   2e-11
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    70   2e-11
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    70   2e-11
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    70   2e-11
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    69   2e-11
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    70   2e-11
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    70   2e-11
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    70   2e-11
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    70   2e-11
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    69   2e-11
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    70   2e-11
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    70   2e-11
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    70   2e-11
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    69   3e-11
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    69   3e-11
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               69   3e-11
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    69   3e-11
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    69   3e-11
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    69   3e-11
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    69   3e-11
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    69   3e-11
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    69   3e-11
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    69   3e-11
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    69   3e-11
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    69   3e-11
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    69   4e-11
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    68   4e-11
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    69   4e-11
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    69   4e-11
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    69   4e-11
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    69   4e-11
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    69   4e-11
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               68   5e-11
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    68   5e-11
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    69   5e-11
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    68   5e-11
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    68   5e-11
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    67   5e-11
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    68   5e-11
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    68   5e-11
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    68   5e-11
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    68   6e-11
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    68   6e-11
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    68   6e-11
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    68   6e-11
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    68   6e-11
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    68   7e-11
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    68   7e-11
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    68   7e-11
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    68   8e-11
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     68   8e-11
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    68   8e-11
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    67   8e-11
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    67   8e-11
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    67   8e-11
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    67   8e-11
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    68   8e-11
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    68   8e-11
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    66   9e-11
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              68   9e-11
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    68   9e-11
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      68   9e-11
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    67   9e-11
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    67   9e-11
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    66   1e-10
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    67   1e-10
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    67   1e-10
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    67   1e-10
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    67   1e-10
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    68   1e-10
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    67   1e-10
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    67   1e-10
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    67   1e-10
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    66   1e-10
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    67   1e-10
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    67   1e-10
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    67   1e-10
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    67   1e-10
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    67   2e-10
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    67   2e-10
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    65   2e-10
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    67   2e-10
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    67   2e-10
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    67   2e-10
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    67   2e-10
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    67   2e-10
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    66   2e-10
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    67   2e-10
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    67   2e-10
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    66   2e-10
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    67   2e-10
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    66   2e-10
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    65   2e-10
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    66   2e-10
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    66   2e-10
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    66   2e-10
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    66   2e-10
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    66   2e-10
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    66   2e-10
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    66   2e-10
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    66   2e-10
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    66   2e-10
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    66   2e-10
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    66   2e-10
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    66   2e-10
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    65   2e-10
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    66   2e-10
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    66   2e-10
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    66   2e-10
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    66   3e-10
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    66   3e-10
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              66   3e-10
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    65   3e-10
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    66   3e-10
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    65   3e-10
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    65   3e-10
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    66   3e-10
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    65   3e-10
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    66   3e-10
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    66   3e-10
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    65   3e-10
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    66   3e-10
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    66   3e-10
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    66   3e-10
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    65   3e-10
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    65   3e-10
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    65   3e-10
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    65   4e-10
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    65   4e-10
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    66   4e-10
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    65   4e-10
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    65   4e-10
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    65   4e-10
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    65   4e-10
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    65   4e-10
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    64   4e-10
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    65   5e-10
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     65   5e-10
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    64   5e-10
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    64   5e-10
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    64   5e-10
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    65   5e-10
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    65   5e-10
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    65   5e-10
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    65   5e-10
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    65   6e-10
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    64   6e-10
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    64   6e-10
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    65   6e-10
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    65   6e-10
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    64   6e-10
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    65   6e-10
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    65   7e-10
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               64   7e-10
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    65   8e-10
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    64   8e-10
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    65   8e-10
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    65   8e-10
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    64   8e-10
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    64   8e-10
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               64   8e-10
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    64   9e-10
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    64   9e-10
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    64   9e-10
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    63   9e-10
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    64   9e-10
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    64   1e-09
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    64   1e-09
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    64   1e-09
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    64   1e-09
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    63   1e-09
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    64   1e-09
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    63   1e-09
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    64   1e-09
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    64   1e-09
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    64   1e-09
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    64   1e-09
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    63   1e-09
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    64   1e-09
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    63   1e-09
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    64   1e-09
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    64   1e-09
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    64   1e-09
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    64   1e-09
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    64   1e-09
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    64   1e-09
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    64   1e-09
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    64   1e-09
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    64   1e-09
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    64   1e-09
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    62   1e-09
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    64   1e-09
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    63   1e-09
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    63   2e-09
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    63   2e-09
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    64   2e-09
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    64   2e-09
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    63   2e-09
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    63   2e-09
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    63   2e-09
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    64   2e-09
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    64   2e-09
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    63   2e-09
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    62   2e-09
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    63   2e-09
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    63   2e-09
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    64   2e-09
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    62   2e-09
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    63   2e-09
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    63   2e-09
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    62   2e-09
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    63   2e-09
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    62   2e-09
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    62   2e-09
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    62   2e-09
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    62   2e-09
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    63   2e-09
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    63   2e-09
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    62   2e-09
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    62   2e-09
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    63   2e-09
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    63   3e-09
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    63   3e-09
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    63   3e-09
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    63   3e-09
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    63   3e-09
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    62   3e-09
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    63   3e-09
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    63   3e-09
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    63   3e-09
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    62   3e-09
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    62   3e-09
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    62   3e-09
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    62   3e-09
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    63   3e-09
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    62   3e-09
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    62   3e-09
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    62   3e-09
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    62   3e-09
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    62   4e-09
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    62   4e-09
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    62   4e-09
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    62   4e-09
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    62   4e-09
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    62   4e-09
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    62   4e-09
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    62   4e-09
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    62   4e-09
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    62   4e-09
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    62   4e-09
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    62   4e-09
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    61   4e-09
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    62   5e-09
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    62   5e-09
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     62   5e-09
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    61   5e-09
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    62   5e-09
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    61   5e-09
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    61   5e-09
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    62   6e-09
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    61   6e-09
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    61   6e-09
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    61   6e-09
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    62   6e-09
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    61   6e-09
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    61   6e-09
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    61   6e-09
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    61   6e-09
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    61   7e-09
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    61   7e-09
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    62   7e-09
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    61   7e-09
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    61   7e-09
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    61   7e-09
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    61   8e-09
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    61   8e-09
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    60   8e-09
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    61   8e-09
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    61   8e-09
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    61   8e-09
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    61   8e-09
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    61   8e-09
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    61   9e-09
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    60   9e-09
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    59   9e-09
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    61   9e-09
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    61   9e-09
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    60   9e-09
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    60   9e-09
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    61   9e-09
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    61   1e-08
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    60   1e-08
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    61   1e-08
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    61   1e-08
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    60   1e-08
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    61   1e-08
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    60   1e-08
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    61   1e-08
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    61   1e-08
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    61   1e-08
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    61   1e-08
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    60   1e-08
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    60   1e-08
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    60   1e-08
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    60   1e-08
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    59   1e-08
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    59   1e-08
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    61   1e-08
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               60   1e-08
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    60   1e-08
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    61   1e-08
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    60   1e-08
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    60   1e-08
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    60   1e-08
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    61   1e-08
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    60   1e-08
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    60   1e-08
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    60   1e-08
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    59   1e-08
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    59   1e-08
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    59   1e-08
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    60   1e-08
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    60   1e-08
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    60   1e-08
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    60   1e-08
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    60   2e-08
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    60   2e-08
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    59   2e-08
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    60   2e-08
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    60   2e-08
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    60   2e-08
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    60   2e-08
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    60   2e-08
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    60   2e-08
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    60   2e-08
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    60   2e-08
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    59   2e-08
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    60   2e-08
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    60   2e-08
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    59   2e-08
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    60   2e-08
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    60   2e-08
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    60   2e-08
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    59   2e-08
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    59   2e-08
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    60   2e-08
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    60   2e-08
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    60   2e-08
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    59   2e-08
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    59   2e-08
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    59   2e-08
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    59   2e-08
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    59   2e-08
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    60   2e-08
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    59   3e-08
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    60   3e-08
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    59   3e-08
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     59   3e-08
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    59   3e-08
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    60   3e-08
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    59   3e-08
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    60   3e-08
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    59   3e-08
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    58   3e-08
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              60   3e-08
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     59   3e-08
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    59   3e-08
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    59   3e-08
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    59   3e-08
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    59   3e-08
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              58   3e-08
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    59   3e-08
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    59   3e-08
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    59   3e-08
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    59   3e-08
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    59   3e-08
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    59   3e-08
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    59   3e-08
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    59   3e-08
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    59   3e-08
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    59   3e-08
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    59   3e-08
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    59   3e-08
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    59   3e-08
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    59   3e-08
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    59   3e-08
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    59   3e-08
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    59   3e-08
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    58   3e-08
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    59   3e-08
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    59   4e-08
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    59   4e-08
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    59   4e-08
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    59   4e-08
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    58   4e-08
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    59   4e-08
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    59   4e-08
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    58   4e-08
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    59   4e-08
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    59   4e-08
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               58   4e-08
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             59   4e-08
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    59   4e-08
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    59   4e-08
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    59   4e-08
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    59   4e-08
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    59   4e-08
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    59   4e-08
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    59   4e-08
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    59   4e-08
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    59   4e-08
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    59   4e-08
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    59   4e-08
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    59   5e-08
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    59   5e-08
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              59   5e-08
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    59   5e-08
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    59   5e-08
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    59   5e-08
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    59   5e-08
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     58   5e-08
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    58   5e-08
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              59   5e-08
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    58   5e-08
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    58   5e-08
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              58   5e-08
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    58   5e-08
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    59   5e-08
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    57   6e-08
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    58   6e-08
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    58   6e-08
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    58   6e-08
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     57   6e-08
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    58   6e-08
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    58   6e-08
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    58   6e-08
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    58   6e-08
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              59   6e-08
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    59   6e-08
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    57   6e-08
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       58   6e-08
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    57   6e-08
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    58   6e-08
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    58   6e-08
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    57   6e-08
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    58   6e-08
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     57   6e-08
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    58   6e-08
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    58   7e-08
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    57   7e-08
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    58   7e-08
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    58   7e-08
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    58   7e-08
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    58   7e-08
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    58   7e-08
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    58   7e-08
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    58   7e-08
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    58   7e-08
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    58   7e-08
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    58   7e-08
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    58   7e-08
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    57   7e-08
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    58   7e-08
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    58   8e-08
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    58   8e-08
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    58   8e-08
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    57   8e-08
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    57   8e-08
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    57   8e-08
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    58   8e-08
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    58   8e-08
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               58   8e-08
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    58   9e-08
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    58   9e-08
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    58   9e-08
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    58   9e-08
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    57   1e-07
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    58   1e-07
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    58   1e-07
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    58   1e-07
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    56   1e-07
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    57   1e-07
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    57   1e-07
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    58   1e-07
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    57   1e-07
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    55   1e-07
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    57   1e-07
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    57   1e-07
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    58   1e-07
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              58   1e-07
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    57   1e-07
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    57   1e-07
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    57   1e-07
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    57   1e-07
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    57   1e-07
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    57   1e-07
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    57   1e-07
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    57   1e-07
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    57   1e-07
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    57   1e-07
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     57   1e-07
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    57   1e-07
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    56   1e-07
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    57   1e-07
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    56   1e-07
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    57   1e-07
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    57   1e-07
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    57   1e-07
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    57   1e-07
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    57   1e-07
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    57   1e-07
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    56   1e-07
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    57   1e-07
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    57   1e-07
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    57   1e-07
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     57   1e-07
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    56   1e-07
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    56   1e-07
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    56   2e-07
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    57   2e-07
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    57   2e-07
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    57   2e-07
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    57   2e-07
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    56   2e-07
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    56   2e-07
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    56   2e-07
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              56   2e-07
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    57   2e-07
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    55   2e-07
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    56   2e-07
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    57   2e-07
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    56   2e-07
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    57   2e-07
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    56   2e-07
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    56   2e-07
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    56   2e-07
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    56   2e-07
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    56   2e-07
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     56   2e-07
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    57   2e-07
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    57   2e-07
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    56   2e-07
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    56   2e-07
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    57   2e-07
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    57   2e-07
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    56   2e-07
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    57   2e-07
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    56   2e-07
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    56   2e-07
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    56   3e-07
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    55   3e-07
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    55   3e-07
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    56   3e-07
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    56   3e-07
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    56   3e-07
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    56   3e-07
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    56   3e-07
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    56   3e-07
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    56   3e-07
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    56   3e-07
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    56   3e-07
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    55   3e-07
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    55   3e-07
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    56   3e-07
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    56   3e-07
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    55   3e-07
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    56   3e-07
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    56   3e-07
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    56   3e-07
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    55   3e-07
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    55   3e-07
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    56   3e-07
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    55   3e-07
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    56   3e-07
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    56   4e-07
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    56   4e-07
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    55   4e-07
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    55   4e-07
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    55   4e-07
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    56   4e-07
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    56   4e-07
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    55   4e-07
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    55   4e-07
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    56   4e-07
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    55   4e-07
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    56   4e-07
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    56   4e-07
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    55   4e-07
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    55   4e-07
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    55   4e-07
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    55   4e-07
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    55   5e-07
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    55   5e-07
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    55   5e-07
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    55   5e-07
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              55   5e-07
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    55   5e-07
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    55   5e-07
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    54   5e-07
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     55   5e-07
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    55   5e-07
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    55   5e-07
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    55   5e-07
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    54   5e-07
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    54   5e-07
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               54   5e-07
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    55   6e-07
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    55   6e-07
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    55   6e-07
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    55   6e-07
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    55   6e-07
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    55   6e-07
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    54   6e-07
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    55   6e-07
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    55   6e-07
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    55   6e-07
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    55   6e-07
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    55   6e-07
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    55   6e-07
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    55   6e-07
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    54   6e-07
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    55   6e-07
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    55   6e-07
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    55   6e-07
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    55   7e-07
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    55   7e-07
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    55   7e-07
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    55   7e-07
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    54   7e-07
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    55   7e-07
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    55   7e-07
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    55   7e-07
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    54   7e-07
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    55   7e-07
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    55   7e-07
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     55   7e-07
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    55   7e-07
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    55   7e-07
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    54   8e-07
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    55   8e-07
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    54   8e-07
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    54   8e-07
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    55   8e-07
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    55   8e-07
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    54   9e-07
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    55   9e-07
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    54   9e-07
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    54   9e-07
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    54   9e-07
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    54   9e-07
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    55   9e-07
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               54   9e-07
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    54   1e-06
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    54   1e-06
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    53   1e-06
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    54   1e-06
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    54   1e-06
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    54   1e-06
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    54   1e-06
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    54   1e-06
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    54   1e-06
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    54   1e-06
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    54   1e-06
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    54   1e-06
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    54   1e-06
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    54   1e-06
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    53   1e-06
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               54   1e-06
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    54   1e-06
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    54   1e-06
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    54   1e-06
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    54   1e-06
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    54   1e-06
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    54   1e-06
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    53   1e-06
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    54   1e-06
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    54   1e-06
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    50   1e-06
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    54   1e-06
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    54   1e-06
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    53   1e-06
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    54   1e-06
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    53   1e-06
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    54   1e-06
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    54   1e-06
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    54   1e-06
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    54   1e-06
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     54   1e-06
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    54   1e-06
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    54   1e-06
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    54   1e-06
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    54   1e-06
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    53   1e-06
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     54   1e-06
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    54   1e-06
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    54   1e-06
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    53   2e-06
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    53   2e-06
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    54   2e-06
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    54   2e-06
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    54   2e-06
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    54   2e-06
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    53   2e-06
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    53   2e-06
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    53   2e-06
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    53   2e-06
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    54   2e-06
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    52   2e-06
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    52   2e-06
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    54   2e-06
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    53   2e-06
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    54   2e-06
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    54   2e-06
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    53   2e-06
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    52   2e-06
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    53   2e-06
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    54   2e-06
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    53   2e-06
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    53   2e-06
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    54   2e-06
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    53   2e-06
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    54   2e-06
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    53   2e-06
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    54   2e-06
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    53   2e-06
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    54   2e-06
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    54   2e-06
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    53   2e-06
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    53   2e-06
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    54   2e-06
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    53   2e-06
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    53   2e-06
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    53   2e-06
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    53   2e-06
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    53   2e-06
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    53   2e-06
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    53   2e-06
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    53   2e-06
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    54   2e-06
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    53   2e-06
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    53   2e-06
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    53   2e-06
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    54   2e-06
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    52   2e-06
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    52   2e-06
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    53   2e-06
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    53   2e-06
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    53   3e-06
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    53   3e-06
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    53   3e-06
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    53   3e-06
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    52   3e-06
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    52   3e-06
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    52   3e-06
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    53   3e-06
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    53   3e-06
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    53   3e-06
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    53   3e-06
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    52   3e-06
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    53   3e-06
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       53   3e-06
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    52   3e-06
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    53   3e-06
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    53   3e-06
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    53   3e-06
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    53   3e-06
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    53   3e-06
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    52   3e-06
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    53   3e-06
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    52   3e-06
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    53   3e-06
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    53   3e-06
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    53   3e-06
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    52   3e-06
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    52   3e-06
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    53   3e-06
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     52   3e-06
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    53   3e-06
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    53   3e-06
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    52   3e-06
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    52   3e-06
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    52   3e-06
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    52   3e-06
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    52   4e-06
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    52   4e-06
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    52   4e-06
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    52   4e-06
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    52   4e-06
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    52   4e-06
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    52   4e-06
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    52   4e-06
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    52   4e-06
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    52   4e-06
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    52   4e-06
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    52   4e-06
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    52   4e-06
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    52   4e-06
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    53   4e-06
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    52   4e-06
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    51   4e-06
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      52   4e-06
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    52   5e-06
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    52   5e-06
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    52   5e-06
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    52   5e-06
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    52   5e-06
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    52   5e-06
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    51   5e-06
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    52   5e-06
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    52   5e-06
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    52   6e-06
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    52   6e-06
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    52   6e-06
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    52   6e-06
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    52   6e-06
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    52   6e-06
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    51   6e-06
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    52   6e-06
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    51   6e-06
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    51   6e-06
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    52   6e-06
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    51   6e-06
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    51   6e-06
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    52   6e-06
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    52   6e-06
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    52   6e-06
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    52   6e-06
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    52   6e-06
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    51   6e-06
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    51   6e-06
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    52   6e-06
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    51   6e-06
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    51   6e-06
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    52   7e-06
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    52   7e-06
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    51   7e-06
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    51   7e-06
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    52   7e-06
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    51   7e-06
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    52   7e-06
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    52   7e-06
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    51   7e-06
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    51   7e-06
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    51   7e-06
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    52   8e-06
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    51   8e-06
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    52   8e-06
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    51   8e-06
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    50   8e-06
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    51   8e-06
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    51   8e-06
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    51   8e-06
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    52   8e-06
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    51   8e-06
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    51   8e-06
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    51   9e-06
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    51   9e-06
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    50   9e-06
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    51   9e-06
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    51   9e-06
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    51   9e-06
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     51   9e-06
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    51   9e-06
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    51   9e-06
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     51   1e-05
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    51   1e-05
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    51   1e-05
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    51   1e-05
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    51   1e-05
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    51   1e-05
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    51   1e-05
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    51   1e-05
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    51   1e-05
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    51   1e-05
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    51   1e-05
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    51   1e-05
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    50   1e-05
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               51   1e-05
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    50   1e-05
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    50   1e-05
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    51   1e-05
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    50   1e-05
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    50   1e-05
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    50   1e-05
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    51   1e-05
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    51   1e-05
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    50   1e-05
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    50   1e-05
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    50   1e-05
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    50   1e-05
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    50   1e-05
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    50   1e-05
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    50   1e-05
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    50   2e-05
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    50   2e-05
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    50   2e-05
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    50   2e-05
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    50   2e-05
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    50   2e-05
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    50   2e-05
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    50   2e-05
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    50   2e-05
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    50   2e-05
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    50   2e-05
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    50   2e-05
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    50   2e-05
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    50   2e-05
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    50   2e-05
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    50   2e-05
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    50   2e-05
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    50   2e-05
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    50   2e-05
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    50   2e-05
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    50   2e-05
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    49   2e-05
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    50   2e-05
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    50   2e-05
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    50   2e-05
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    50   2e-05
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    50   2e-05
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    50   2e-05
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    50   2e-05
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    50   2e-05
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    50   2e-05
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    50   2e-05
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    50   2e-05
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    50   2e-05
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    50   2e-05
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    50   2e-05
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    50   2e-05
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    49   2e-05
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    49   2e-05
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    50   2e-05
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    50   2e-05
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    49   2e-05
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    50   2e-05
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    49   3e-05
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    50   3e-05
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    50   3e-05
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    50   3e-05
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    49   3e-05
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    50   3e-05
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    49   3e-05
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     49   3e-05
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    49   3e-05
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    50   3e-05
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    50   3e-05
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    50   3e-05
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    50   3e-05
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    50   3e-05
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    49   3e-05
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    50   3e-05
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    49   3e-05
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    49   3e-05
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    50   3e-05
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    50   3e-05
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    49   3e-05
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    50   3e-05
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    50   3e-05
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    49   3e-05
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    49   3e-05
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    49   3e-05
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    49   3e-05
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    49   4e-05
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    49   4e-05
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    49   4e-05
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    49   4e-05
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    49   4e-05
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    49   4e-05
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    49   4e-05
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    49   4e-05
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    49   4e-05
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    49   4e-05
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    49   4e-05
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    49   4e-05
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    49   4e-05
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    49   4e-05
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    49   4e-05
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    49   4e-05
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    49   4e-05
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    49   4e-05
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    49   4e-05
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    49   4e-05
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    48   4e-05
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    49   4e-05
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    49   4e-05
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    49   4e-05
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    49   4e-05
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    49   4e-05
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    49   5e-05
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    49   5e-05
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    49   5e-05
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    48   5e-05
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    49   5e-05
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    49   5e-05
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    49   5e-05
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    49   5e-05
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    49   5e-05
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    49   5e-05
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    49   5e-05
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    48   5e-05
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    49   5e-05
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    49   5e-05
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    49   5e-05
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    49   5e-05
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    48   5e-05
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    49   5e-05
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    48   6e-05
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    49   6e-05
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    49   6e-05
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    49   6e-05
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    49   6e-05
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    48   6e-05
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    49   6e-05
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    48   6e-05
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    48   7e-05
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    49   7e-05
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    48   7e-05
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    48   7e-05
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    48   7e-05
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    49   7e-05
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     48   7e-05
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    48   7e-05
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    48   7e-05
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    49   7e-05
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    48   7e-05
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    48   7e-05
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    48   8e-05
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    48   8e-05
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    47   8e-05
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    48   8e-05
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    49   8e-05
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    48   8e-05
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    48   8e-05
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    48   8e-05
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    48   9e-05
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    48   9e-05
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    47   9e-05
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    48   9e-05
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    48   1e-04
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    48   1e-04
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    48   1e-04
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    48   1e-04
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    48   1e-04
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    47   1e-04
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    47   1e-04
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     47   1e-04
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    47   1e-04
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    47   1e-04
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    47   1e-04
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    47   1e-04
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    47   1e-04
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    47   1e-04
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    47   1e-04
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    47   1e-04
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    47   2e-04
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    47   2e-04
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    47   2e-04
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    47   2e-04
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    47   2e-04
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    47   2e-04
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    46   2e-04
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    47   2e-04
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    47   2e-04
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    47   2e-04
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    47   2e-04
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    46   2e-04
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    47   2e-04
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    47   2e-04
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    47   2e-04
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    47   2e-04
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    47   2e-04
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    46   2e-04
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    47   2e-04
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    47   2e-04
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    46   2e-04
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    47   2e-04
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    47   2e-04
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    47   2e-04
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    46   2e-04
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    47   2e-04
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    46   2e-04
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    46   2e-04
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    47   2e-04
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    46   2e-04
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    46   3e-04
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    46   3e-04
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    46   3e-04
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    46   3e-04
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    47   3e-04
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     46   3e-04
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    47   3e-04
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    46   3e-04
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    46   3e-04
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    46   3e-04
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    46   3e-04
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    46   3e-04
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    45   3e-04
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    46   3e-04
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    46   3e-04
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    46   3e-04
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    46   3e-04
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    46   3e-04
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    46   3e-04
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    45   4e-04
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    45   4e-04
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    46   4e-04
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    46   4e-04
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    45   4e-04
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    46   4e-04
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    46   4e-04
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    45   4e-04
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    45   4e-04
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    46   4e-04
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    45   4e-04
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    45   4e-04
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    46   5e-04
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    45   5e-04
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    45   5e-04
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    45   5e-04
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    45   6e-04
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    45   6e-04
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    45   6e-04
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    45   6e-04
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    45   6e-04
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    45   6e-04
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    45   6e-04
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    45   6e-04
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    45   6e-04
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    45   6e-04
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      45   6e-04
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               45   6e-04
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    45   7e-04
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    45   7e-04
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    45   7e-04
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    45   7e-04
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    45   7e-04
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    45   7e-04
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    45   8e-04
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    45   8e-04
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    45   8e-04
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      45   8e-04
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    45   8e-04
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    44   8e-04
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    45   8e-04
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    44   9e-04
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    45   9e-04
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    45   9e-04
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    45   0.001
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    44   0.001
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    44   0.001
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    44   0.001
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    44   0.001
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    45   0.001
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    45   0.001
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    45   0.001
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    44   0.001
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    44   0.001
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    44   0.001
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    44   0.001
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    44   0.001
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    45   0.001
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    44   0.001
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    44   0.001
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    44   0.001
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    44   0.001
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    44   0.001
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    44   0.001
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    44   0.001
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    44   0.001
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    44   0.001
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    44   0.001
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    44   0.001
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    44   0.002
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    44   0.002
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    44   0.002
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    44   0.002
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    44   0.002
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    44   0.002
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    44   0.002
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    44   0.002
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    44   0.002
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    43   0.002
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               44   0.002
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    43   0.003
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    43   0.003
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    43   0.003
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    42   0.003
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    43   0.003
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    43   0.003
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    43   0.003
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    42   0.003
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    43   0.003
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    43   0.004
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    43   0.004
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    43   0.004
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    42   0.004
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    43   0.004
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    42   0.004
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    42   0.004
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    42   0.004
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    42   0.004
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    42   0.004
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    42   0.004
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    42   0.004
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    42   0.005
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    42   0.005
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    42   0.005
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    42   0.005
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    42   0.005
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    42   0.005
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    42   0.005
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    42   0.005
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    42   0.005
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    42   0.006
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    42   0.006
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    42   0.006
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    42   0.006
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    42   0.006
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    42   0.006
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    42   0.006
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    42   0.007
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    42   0.007
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    41   0.007
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               42   0.007
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    42   0.007
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    42   0.007
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    41   0.008
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    42   0.008
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    42   0.008
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    42   0.008
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    42   0.008
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    41   0.008
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       42   0.008
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    42   0.008
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    42   0.008
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    42   0.009
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    42   0.009
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    42   0.009
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     41   0.009
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    41   0.009
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    41   0.009
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    41   0.010
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    41   0.012
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    41   0.012
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    41   0.012
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    41   0.013
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    41   0.013
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    41   0.014
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    40   0.014
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    40   0.015
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    40   0.015
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    40   0.016
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    40   0.016
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    40   0.017
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    40   0.017
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    40   0.017
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    40   0.018
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    40   0.018
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    40   0.018
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    40   0.019
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    40   0.019
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    40   0.019
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    40   0.020
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    40   0.020
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    40   0.020
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    40   0.021
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    40   0.021
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    40   0.022
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    40   0.022
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    40   0.022
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    40   0.023
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    40   0.025
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    40   0.025
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    40   0.025
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    40   0.026
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    40   0.027
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    40   0.027
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    40   0.028
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    40   0.029
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    40   0.029
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    40   0.029
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    40   0.030
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    40   0.032
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    40   0.033
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    39   0.034
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    40   0.034
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    39   0.036
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               39   0.036
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    39   0.037
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    39   0.038
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    39   0.040
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    39   0.041
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    39   0.042
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    39   0.045
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    39   0.046
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    39   0.048
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    39   0.050
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    39   0.050
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    39   0.050
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    39   0.051
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    39   0.051
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    39   0.052
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    39   0.055
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    39   0.055
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    39   0.057
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    39   0.058
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    39   0.058
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    39   0.058
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             39   0.060
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    38   0.060
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    39   0.062
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    39   0.062
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    39   0.063
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    38   0.067
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    39   0.068
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    39   0.070
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    39   0.070
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    39   0.077
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    39   0.078
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    38   0.081
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    38   0.091
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    38   0.092
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    38   0.096
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    38   0.096
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    38   0.098
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    38   0.099
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    38   0.11 
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    37   0.13 
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    38   0.14 
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    37   0.14 
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    38   0.14 
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    37   0.15 
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    37   0.16 
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    37   0.16 
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    37   0.16 
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    37   0.16 
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    37   0.17 
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    37   0.17 
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    37   0.17 
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    37   0.18 
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    37   0.20 
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    37   0.20 
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    37   0.20 
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    37   0.21 
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    37   0.21 
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    37   0.22 
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    37   0.22 
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    37   0.22 
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    37   0.23 
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    37   0.24 
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    37   0.26 
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    37   0.26 
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    37   0.27 
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    36   0.28 
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    36   0.29 
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    36   0.30 
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    36   0.30 
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    36   0.31 
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    36   0.31 
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    36   0.31 
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    36   0.32 
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    37   0.33 
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    36   0.38 
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    36   0.42 
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    36   0.46 
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    36   0.50 
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    36   0.50 
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    35   0.51 
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    35   0.66 
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    35   0.70 
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    35   0.71 
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    35   0.72 
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    35   0.73 
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    35   0.74 
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    35   0.82 
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    35   0.83 
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    35   0.89 
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    35   0.94 
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    35   0.94 
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    35   0.98 
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    35   1.0  
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    34   1.1  
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    34   1.2  
KLTH0A02376g Chr1 complement(202248..204713) [2466 bp, 821 aa] {...    35   1.2  
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    35   1.2  
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    34   1.2  
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    35   1.2  
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    35   1.3  
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    34   1.4  
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    34   1.4  
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    34   1.5  
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    34   1.5  
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    34   1.5  
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    34   1.6  
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    34   1.7  
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    34   1.7  
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    34   1.9  
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    34   2.1  
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    33   2.1  
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    34   2.3  
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    33   2.3  
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    33   2.3  
Skud_7.208 Chr7 (371946..374456) [2511 bp, 836 aa] {ON} YGL073W ...    33   2.5  
Smik_13.424 Chr13 complement(682907..685177) [2271 bp, 756 aa] {...    33   2.6  
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    33   2.6  
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    33   2.6  
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               33   3.0  
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    33   3.1  
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    33   3.1  
ZYRO0G01100g Chr7 complement(87284..88486) [1203 bp, 400 aa] {ON...    33   3.1  
KNAG0D02200 Chr4 complement(374609..376075) [1467 bp, 488 aa] {O...    33   3.2  
SAKL0H24508g Chr8 (2123140..2124606) [1467 bp, 488 aa] {ON} unip...    33   3.3  
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    33   3.3  
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    33   3.3  
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    33   3.6  
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    33   3.6  
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    33   3.7  
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    33   4.2  
Kpol_1006.14 s1006 (52420..54042) [1623 bp, 540 aa] {ON} (52420....    33   4.2  
Suva_5.243 Chr5 (380441..382012) [1572 bp, 523 aa] {ON} YER123W ...    33   4.2  
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    33   4.3  
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    32   4.7  
KAFR0B02070 Chr2 (408079..409539) [1461 bp, 486 aa] {ON} Anc_8.1...    32   4.7  
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    33   5.1  
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    32   6.1  
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    32   6.5  
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    32   6.7  
Ecym_8392 Chr8 (803292..804806) [1515 bp, 504 aa] {ON} similar t...    32   7.4  
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    32   8.0  
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    32   8.2  
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    32   9.4  

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score = 1482 bits (3837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 731/808 (90%), Positives = 731/808 (90%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFM 120
           PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFM
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFM 120

Query: 121 NTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSV 180
           NTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSV
Sbjct: 121 NTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSV 180

Query: 181 SGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICY 240
           SGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICY
Sbjct: 181 SGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICY 240

Query: 241 YTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQI 300
           YTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQI
Sbjct: 241 YTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQI 300

Query: 301 KPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQKFLPAQGLQSMKPISNMIPVSHVRTTP 360
           KPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQKFLPAQGLQSMKPISNMIPVSHVRTTP
Sbjct: 301 KPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQKFLPAQGLQSMKPISNMIPVSHVRTTP 360

Query: 361 NLSTLPRSIDDNNMTDVTKQISLQFVGDSNVDTPLKKTKSVPLSDDFASLYYRELHPFQK 420
           NLSTLPRSIDDNNMTDVTKQISLQFVGDSNVDTPLKKTKSVPLSDDFASLYYRELHPFQK
Sbjct: 361 NLSTLPRSIDDNNMTDVTKQISLQFVGDSNVDTPLKKTKSVPLSDDFASLYYRELHPFQK 420

Query: 421 SQTFKSVENFXXXXXXXXXXXXXXXANSIILDKTPTMNRPNNYVDSETQTTDIITMSGSK 480
           SQTFKSVENF               ANSIILDKTPTMNRPNNYVDSETQTTDIITMSGSK
Sbjct: 421 SQTFKSVENFQSPQRRSMPPSSLPPANSIILDKTPTMNRPNNYVDSETQTTDIITMSGSK 480

Query: 481 LSPALTNKPVNSQKEFIAPENVSGGNIVRSLSSKLKKVITGESRGSSPIKSRQNTGDSTR 540
           LSPALTNKPVNSQKEFIAPENVSGGNIVRSLSSKLKKVITGESRGSSPIKSRQNTGDSTR
Sbjct: 481 LSPALTNKPVNSQKEFIAPENVSGGNIVRSLSSKLKKVITGESRGSSPIKSRQNTGDSTR 540

Query: 541 SALGMLRHGFTGSSMNNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFNPDTKRQEEI 600
           SALGMLRHGFTGSSMNNN                              VFNPDTKRQEEI
Sbjct: 541 SALGMLRHGFTGSSMNNNRSASFDSNNGSSNNNSVNRRLGSSSTSSLSVFNPDTKRQEEI 600

Query: 601 DKKQKLENRRSMPSSILSDFDQHERINSRTGSRDYYRSHSPVKKIQTTSKSAPKPITKPV 660
           DKKQKLENRRSMPSSILSDFDQHERINSRTGSRDYYRSHSPVKKIQTTSKSAPKPITKPV
Sbjct: 601 DKKQKLENRRSMPSSILSDFDQHERINSRTGSRDYYRSHSPVKKIQTTSKSAPKPITKPV 660

Query: 661 IGDININQEKKESIQRRVHNLLKSSEDPLTYKSASGYGKYTDTDTETSNRHSSVRITPIT 720
           IGDININQEKKESIQRRVHNLLKSSEDPLTYKSASGYGKYTDTDTETSNRHSSVRITPIT
Sbjct: 661 IGDININQEKKESIQRRVHNLLKSSEDPLTYKSASGYGKYTDTDTETSNRHSSVRITPIT 720

Query: 721 EEKFKSRNKNGLSNNKTKDNDXXXXXXXXXXXXXXXXXAEIQKVXXXXXXXXXXXXXXXI 780
           EEKFKSRNKNGLSNNKTKDND                 AEIQKV               I
Sbjct: 721 EEKFKSRNKNGLSNNKTKDNDRHKSRPPRPPPKPLHLRAEIQKVRSSSRLHSGELSSERI 780

Query: 781 SSDATETIVEVNVDDLEADFRKRFPSKV 808
           SSDATETIVEVNVDDLEADFRKRFPSKV
Sbjct: 781 SSDATETIVEVNVDDLEADFRKRFPSKV 808

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score = 1211 bits (3132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/810 (74%), Positives = 651/810 (80%), Gaps = 2/810 (0%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN PQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPY+NANIACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFM 120
           P KQGLNTLRAEVDAMKLL+NNKHVVSYIDSHAA+SVNG+AYEVFVLMEFCERGGLIDFM
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSVNGIAYEVFVLMEFCERGGLIDFM 120

Query: 121 NTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSV 180
           NTRLQNRL+ESEILEIMSQTVQGI AMHALQPPLIHRDIKIENVLISH+GLYKVCDFGSV
Sbjct: 121 NTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFGSV 180

Query: 181 SGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICY 240
           SGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALG+FLYKICY
Sbjct: 181 SGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKICY 240

Query: 241 YTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQI 300
           YTTPFEKSGEAGILHARYQYP FPQYSDRLKNLIRLMLME PS+RPNICQVLEEVSRLQ 
Sbjct: 241 YTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQN 300

Query: 301 KPCPIRNFYLLRAMSQTA--QLASEPPSMKYVPTQKFLPAQGLQSMKPISNMIPVSHVRT 358
           KPCPIRNFYLLRAM+Q A  QLA EP S  YVPTQKF+P Q LQS+    NM+PV+HV T
Sbjct: 301 KPCPIRNFYLLRAMNQNANTQLAGEPSSTTYVPTQKFIPVQSLQSINQPPNMMPVTHVST 360

Query: 359 TPNLSTLPRSIDDNNMTDVTKQISLQFVGDSNVDTPLKKTKSVPLSDDFASLYYRELHPF 418
           TPNL T P SI+DNN T+VT    LQ    SN+ +PL KTKSVPLSD+FASLYY+ELHPF
Sbjct: 361 TPNLGTFPISINDNNKTEVTAHAGLQVGSHSNLTSPLMKTKSVPLSDEFASLYYKELHPF 420

Query: 419 QKSQTFKSVENFXXXXXXXXXXXXXXXANSIILDKTPTMNRPNNYVDSETQTTDIITMSG 478
           QKSQTFKSVE+F                N+ I D+   +NRPNNYVDSETQT D + +  
Sbjct: 421 QKSQTFKSVESFQSPQRKSMPPLSLTPVNNDIFDRVSAINRPNNYVDSETQTIDNMAVPN 480

Query: 479 SKLSPALTNKPVNSQKEFIAPENVSGGNIVRSLSSKLKKVITGESRGSSPIKSRQNTGDS 538
            KLSP +T+K ++S KE  AP+N++G  IVRSLSSKLKKVITGESRG+SPIKSRQNTGDS
Sbjct: 481 LKLSPTITSKSLSSTKEIAAPDNINGSKIVRSLSSKLKKVITGESRGNSPIKSRQNTGDS 540

Query: 539 TRSALGMLRHGFTGSSMNNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFNPDTKRQE 598
            RSA G LRHGFTG+S+NN+                               FN DTKR+E
Sbjct: 541 IRSAFGKLRHGFTGNSVNNSRSASFDNNNVNGNGNNTNRRLVSSSTSSFPKFNSDTKRKE 600

Query: 599 EIDKKQKLENRRSMPSSILSDFDQHERINSRTGSRDYYRSHSPVKKIQTTSKSAPKPITK 658
           E DK Q+LE RRSMP SILSDFDQHER NSRTGSRDYYRSHSPVKK Q ++K+  KP   
Sbjct: 601 ESDKNQRLEKRRSMPPSILSDFDQHERNNSRTGSRDYYRSHSPVKKTQASAKTTSKPTLI 660

Query: 659 PVIGDININQEKKESIQRRVHNLLKSSEDPLTYKSASGYGKYTDTDTETSNRHSSVRITP 718
           P  G++NINQEKKESIQRRVHNLLKSS+DP+TYKSASGYGKYTD  TETSNRHSSVRITP
Sbjct: 661 PDNGNVNINQEKKESIQRRVHNLLKSSDDPVTYKSASGYGKYTDIGTETSNRHSSVRITP 720

Query: 719 ITEEKFKSRNKNGLSNNKTKDNDXXXXXXXXXXXXXXXXXAEIQKVXXXXXXXXXXXXXX 778
           ITEEKFK   K+G+ + KTK N                   EIQK+              
Sbjct: 721 ITEEKFKKTLKDGVLDIKTKSNGKDKSRPPRPPPKPLHLRTEIQKIRNFSRLQSKKLPIE 780

Query: 779 XISSDATETIVEVNVDDLEADFRKRFPSKV 808
            ISS+ATETIV+VNVDDLEADFRKRFPSKV
Sbjct: 781 RISSEATETIVDVNVDDLEADFRKRFPSKV 810

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score = 1153 bits (2982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/810 (71%), Positives = 628/810 (77%), Gaps = 3/810 (0%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MNAPQISLY+PGT+LTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPY+NAN ACLKRVIV
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFM 120
           PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNG+AYEVFVLMEFCERGGLIDFM
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFM 120

Query: 121 NTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSV 180
           NTRLQ+RLRESEILEIMSQTVQGIAAMH LQPPLIHRDIKIENVLISH+GLYKVCDFGSV
Sbjct: 121 NTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSV 180

Query: 181 SGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICY 240
           SGVIRPPRN+QEFNYVQHDILTNTTAQYRSPEMIDLYR  PIDEKSDIWALG+FLYKICY
Sbjct: 181 SGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICY 240

Query: 241 YTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQI 300
           YTTPFEKSGEA ILH+RYQYP FPQYSDRLK LI LMLME PS+RPNICQVLEEVSRLQ 
Sbjct: 241 YTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQN 300

Query: 301 KPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQKFLPAQGLQSMKPISNMIPVSHVRTTP 360
           +PCPIRNFYLLRAM Q AQLASEPPS+ YV  Q+ LPAQ LQ +K + +M+PV+HVRTTP
Sbjct: 301 EPCPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQTLQGIKHLQSMVPVTHVRTTP 360

Query: 361 NLSTLPRSIDDNNMTDVTKQISLQFVGDSNVDTPLKKTKSVPLSDDFASLYYRELHPFQK 420
           NL TL ++I +NN T+    +  Q   D N+  PL KTKSVPLSDDFASLYYRELHPFQK
Sbjct: 361 NLGTLTKAITNNNQTESILPVRTQPESDLNLGNPLMKTKSVPLSDDFASLYYRELHPFQK 420

Query: 421 SQTFKSVENFXXXXXXXXXXXXXXXANSIILDK--TPTMNRPNNYVDSETQTTDIITMSG 478
           SQTFKSVE+F                NS   D+  T T++RPNNYVDS TQT D +    
Sbjct: 421 SQTFKSVESFQSPQRKLSTPSSSSPVNSKNNDRASTSTVDRPNNYVDSVTQTIDNMAALN 480

Query: 479 SKLSPALTNKPVNSQKEFIAPENVSGGNIVRSLSSKLKKVITGESRGSSPIKSRQNTGDS 538
              S    NKP    KE I PENV+GG+IVRSLSSKLKKVITGESR SSPIKSRQNTGDS
Sbjct: 481 LNQSSVAINKPSGPPKESIVPENVTGGSIVRSLSSKLKKVITGESRSSSPIKSRQNTGDS 540

Query: 539 TRSALGMLRHGFTGSSMNNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFNPDTKRQE 598
            RSA GMLRHG TGSS++NN                               FN DTKRQ+
Sbjct: 541 IRSAFGMLRHGLTGSSVSNNRTISFDSNNGNGNGNSVNRRLASSSSSSSN-FNFDTKRQD 599

Query: 599 EIDKKQKLENRRSMPSSILSDFDQHERINSRTGSRDYYRSHSPVKKIQTTSKSAPKPITK 658
           ++DKKQKLENRRSMP SILSDFD+HER NSRTGSRDYYRSHSPVKK QTT K+A +   K
Sbjct: 600 DLDKKQKLENRRSMPPSILSDFDKHERNNSRTGSRDYYRSHSPVKKNQTTPKTASRTTLK 659

Query: 659 PVIGDININQEKKESIQRRVHNLLKSSEDPLTYKSASGYGKYTDTDTETSNRHSSVRITP 718
               DI++ Q  KESIQRRVHNLL +SEDPL +KSASGYGKYTD + E SNRHSSVRITP
Sbjct: 660 SDSSDIDVKQVNKESIQRRVHNLLNNSEDPLAHKSASGYGKYTDVNAEASNRHSSVRITP 719

Query: 719 ITEEKFKSRNKNGLSNNKTKDNDXXXXXXXXXXXXXXXXXAEIQKVXXXXXXXXXXXXXX 778
           ITE KF     +G    +T  ND                  EIQ                
Sbjct: 720 ITEGKFNKYYNSGTLKGETSRNDKHKSRPPRPPPKPLHLRTEIQNTRNFSRLQSRQPQME 779

Query: 779 XISSDATETIVEVNVDDLEADFRKRFPSKV 808
            ISS+ATETIV+VNVDDLEADFRKRFPSKV
Sbjct: 780 RISSEATETIVDVNVDDLEADFRKRFPSKV 809

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score = 1107 bits (2863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/809 (68%), Positives = 620/809 (76%), Gaps = 5/809 (0%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN PQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVY+AEISPPDPY++ANIACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFM 120
           PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLME+CERGGLIDFM
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEYCERGGLIDFM 120

Query: 121 NTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSV 180
           NTRL+NRL+ESEIL+IM QTVQGIAAMHALQPPLIHRDIKIENVLISH GLYKVCDFGSV
Sbjct: 121 NTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFGSV 180

Query: 181 SGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICY 240
           SGVIRPP+N QEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALG+FLYKICY
Sbjct: 181 SGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKICY 240

Query: 241 YTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQI 300
           YTTPFEK+GEA ILHARYQYP FPQYSDRLKNLIRLMLME PS+RPNICQVLEEVSRLQ 
Sbjct: 241 YTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQN 300

Query: 301 KPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQKFLPAQGLQSMKPISNMIPVSHVRTTP 360
           +PCPIRNFYLLRAM+Q AQ  SE  SM Y P Q+ +  Q  Q+++ + N++P+S+++TTP
Sbjct: 301 RPCPIRNFYLLRAMNQNAQFGSESTSMTYTPAQQLVSPQSFQNIQAMPNIVPLSNIKTTP 360

Query: 361 NLSTLPRSIDDNNMTDVTKQISLQFVGDS-NVDTPLKKTKSVPLSDDFASLYYRELHPFQ 419
           NL +    +++NN  +   Q+  Q +    N   PL KTKSVPLSDDF SLYY+ELHPFQ
Sbjct: 361 NLDSASNFVNNNNKMEAMLQLRTQKLETGPNFSIPLTKTKSVPLSDDFTSLYYKELHPFQ 420

Query: 420 KSQTFKSVENFXXXXXXXXXXXXXXXANSIILDKTPTMNRPNNYVDSETQTTDIITMSGS 479
           K  TFKSVE                  NS   D+  T+NRPNNYVDSETQT D I     
Sbjct: 421 KPHTFKSVEG-SQSPQRKSIPFSPTPVNSNNYDRVSTINRPNNYVDSETQTLDSIATLKL 479

Query: 480 KLSPALTNKPVNSQKEFIAPENVSGGNIVRSLSSKLKKVITGESRGSSPIKSRQNTGDST 539
           K SP ++NK     KE   PENV+GG IVRSLSSKLK+VITGESR  SPIKSRQNTGDS 
Sbjct: 480 KPSPTISNKTTGFSKESTVPENVTGGKIVRSLSSKLKRVITGESRNGSPIKSRQNTGDSI 539

Query: 540 RSALGMLRHGFTGSSMNNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFNPDTKRQEE 599
           RSA GMLRHGFTGSS+NN+                                  DTKR+EE
Sbjct: 540 RSAFGMLRHGFTGSSINNSRSTSFDNNNANSVNRRLTSSSSNPSSSNLNS---DTKRKEE 596

Query: 600 IDKKQKLENRRSMPSSILSDFDQHERINSRTGSRDYYRSHSPVKKIQTTSKSAPKPITKP 659
           +DKK+KLE+RRSMP SILSDFDQHER NSRTGSRDYYRSHSPVKK QTT  +  +P  K 
Sbjct: 597 LDKKRKLEHRRSMPPSILSDFDQHERNNSRTGSRDYYRSHSPVKKTQTTPTTTTRPSLKS 656

Query: 660 VIGDININQEKKESIQRRVHNLLKSSEDPLTYKSASGYGKYTDTDTETSNRHSSVRITPI 719
              DINI+QEKKESIQRRVHNLL +SED L+YKSASGYGKYTDT+ E++NR SSVRITPI
Sbjct: 657 SNSDINIDQEKKESIQRRVHNLLNNSEDSLSYKSASGYGKYTDTEAESTNRQSSVRITPI 716

Query: 720 TEEKFKSRNKNGLSNNKTKDNDXXXXXXXXXXXXXXXXXAEIQKVXXXXXXXXXXXXXXX 779
           TEE+F + + +   N+ T   D                  +I                  
Sbjct: 717 TEERFNNYHSSNTMNDHTSSKDKPKSRPPRPPPKPLHLRTKIHNTRCSSNLQSRKPPMER 776

Query: 780 ISSDATETIVEVNVDDLEADFRKRFPSKV 808
           ISS+ATETIV+VNVD+LEADFRKRFPSKV
Sbjct: 777 ISSEATETIVDVNVDELEADFRKRFPSKV 805

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/744 (50%), Positives = 459/744 (61%), Gaps = 100/744 (13%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN PQI  +  G ILTVGSHHAK+IKYLTSGG+AQVY  EISP DPY N+NIACLKRVIV
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEFCERGGLID 118
           PDK  LNTLRAEVDAMKLLKNN+HVVSYIDSHA+KS   NG AYEVFVLMEFCERGGLID
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNG-AYEVFVLMEFCERGGLID 119

Query: 119 FMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFG 178
           FMN+RLQ+RL E+EIL IMS T QGIAAMH LQP L+HRDIKIENVLIS N  YKVCDFG
Sbjct: 120 FMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFG 179

Query: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKI 238
           SV G++RPP+N QEFN+V HDI+ NTTAQYRSPEM+DL +GLPI+EKSDIWALG+FLYK+
Sbjct: 180 SVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKL 239

Query: 239 CYYTTPFEKS-GEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSR 297
           CYYTTPFEK+ GEA IL AR+QYP +P YSDRLKNLIR+ML + PS RPN+CQVLEEVSR
Sbjct: 240 CYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSR 299

Query: 298 LQIKPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQKFLPAQGLQSMKPISNMIPVSHVR 357
           LQ  PCPIRNFYLLRAM    +   +P    Y+PT    P+  + ++  +++ +P + ++
Sbjct: 300 LQGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPSTQM-NLASLNDTLPTAALK 358

Query: 358 -----------TTPNL---STLPRSIDDN--NMTDVTKQI-----------SLQFVGDSN 390
                       +P+L    TLP   +D+   ++ V  +I           SL   G SN
Sbjct: 359 FNQTTIPPTNQHSPHLLHTQTLPLPTNDHPVAISHVQDKISPHELLKKSSKSLGSTGTSN 418

Query: 391 ---VDTPLKKTKSVPLSDDFASLYYRELHPFQKSQ-----TFKSVENFXXXXXXXXXXXX 442
              +DT      S P  D F  L +   +     Q     T  S+ N             
Sbjct: 419 KNVIDT------SAP--DHFTKLLHASKNTDLSYQPVTVPTSSSLYNLPRANLSSSPQKS 470

Query: 443 XXXANSIILDKTPTMNRPNNYVDSETQTTDIITMSGSKLSPALTNKPVNSQKEFIAPENV 502
               N    D      RP NYVD ETQT    +    + S   +N+ ++SQ   +  EN 
Sbjct: 471 WKSIN----DNYDVSKRPTNYVDEETQTYTGQSTFLRRTSSNRSNRSISSQYSGVQ-ENT 525

Query: 503 SGGNIVRSLSSKLKKVITGESRGSSPIKSRQNTGDSTRSALGMLRHGFTGSSMNNNXXXX 562
           +G ++VR LS KLK V+TGES     IKSRQNTGDS RSA+  +R GFTG+  NNN    
Sbjct: 526 TGSSLVRKLSVKLKNVLTGES-----IKSRQNTGDSIRSAMNSIRSGFTGN--NNNTRSA 578

Query: 563 XXXXXXXXXXXXXXXXXXXXXXXXXXVFNPDTKRQEEIDKKQKLENRR--SMPSSILSDF 620
                                               E D   + E  R  S+ S+ L D 
Sbjct: 579 SYDNGKRLSSVNLHMHSAIL----------------EQDDSDEFEMPRYNSVSSNTLKDV 622

Query: 621 DQHERINSRTGSRDYYRSHSPVKKIQTTSKSAPKPITKPVIGDININQEKKESIQRRVHN 680
           ++HER    T SR+YYRS SPV+                    +++N+E K SIQ+RV +
Sbjct: 623 EEHERRTVNTSSREYYRSQSPVR--------------------MSVNREMKNSIQKRVQD 662

Query: 681 LLKSSED--PLTYKSASGYGKYTD 702
           LLK++E+    T ++ASGYGKYTD
Sbjct: 663 LLKNAEENTTATVRTASGYGKYTD 686

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 25/29 (86%)

Query: 780 ISSDATETIVEVNVDDLEADFRKRFPSKV 808
           +SS+AT+ +V+++VDD+E D R+RFPS V
Sbjct: 751 VSSNATDMLVDLSVDDIEKDIRRRFPSTV 779

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/739 (48%), Positives = 448/739 (60%), Gaps = 97/739 (13%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN P I  Y PGT+LTVGSH+ KIIKYLTSGGFAQ+YT EISP +PY N+  ACLKRVIV
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEFCERGGLIDF 119
           PDK GLNTLRAEVDAMKLLKNN+HVVSYIDSHAA+S V   AYEVF+LME+C+ GGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179
           MNTRLQNRL E EIL I+SQTVQG++AMHALQP LIHRDIKIENVLIS  G +K+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239
           V   IRPPRN QE  YVQHD+L NTTAQYR+PEM+DLYRGLPI+EKSDIWALG+FLYK+C
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299
           YYTTPFEK GEA ILH+RYQYP FP Y+D+LKNLIR  LME PSKRPNICQ+LEE+SR+Q
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 300 IKPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQK--FLPAQGLQSMKPISNMIPVSHVR 357
             PCPI NFYL R ++  A L +  P +   PTQ+     +Q   ++   S  +P++  R
Sbjct: 301 GIPCPINNFYLSRTINVQASLMN--PII--TPTQQTALKHSQSSATISDQSYAVPLASSR 356

Query: 358 TTPNLSTLPRSIDDNNMTDVTKQISLQFVGDSNVDTPLKKTKSVPLSDDFASLYYRELHP 417
           ++      P  I +  + D+++                        SDD     Y  +HP
Sbjct: 357 SSTTTGNKPILI-ETEIPDMSQG-----------------------SDDV----YSRIHP 388

Query: 418 FQKSQTFKSVENFXXXXXXXXXXXXXXXANSIILDKTPTMNRPNNYVDSETQTTDIITMS 477
           FQKSQT ++                           + T    ++YVDSETQT    +  
Sbjct: 389 FQKSQTLRT-----PSRSSSPIKYTGTLLQKSTSSNSNTSGNKSHYVDSETQTFSTSSRR 443

Query: 478 GSKLSPALTNKPVNSQKEFIAPENVSGGNIVRSLSSKLKKVITGESRGSSPIKSRQNTGD 537
            S+ S   +    +S +     E+ +GG+I +  +S LK+V+TGESR +SPI+SRQNTG 
Sbjct: 444 LSRSSSVRSASSRSSDQ---LKEHRTGGSITQFFTSTLKRVVTGESRNTSPIRSRQNTGG 500

Query: 538 STRSALGMLRHGFTGSSMNNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFNPDTKRQ 597
           S RSA   LR G TG   N N                                       
Sbjct: 501 SIRSAFDALRSGITG---NTNSRVSSLASSVRNVSSSSKHSKHSDAD----------DEP 547

Query: 598 EEIDKKQKLENRRSMPSSILSDFDQHERINSRTGSRDYYRSHSPVKKIQTTSKSAPKPIT 657
            +I  + K  +RRS+P ++ SDF  +E       +   Y S+SPVK    ++        
Sbjct: 548 NKIKIRMKKAHRRSVPPNLYSDFYANE------DTPKLYSSNSPVKLKSLST-------- 593

Query: 658 KPVIGDININQEKKESIQRRVHNLLKS-SEDPLTYKSASGYGKYTDTD------------ 704
                       ++ESIQ RV  LL++  E+P T K+ASGYGKYTD++            
Sbjct: 594 ------------QRESIQNRVKALLETFEEEPSTIKTASGYGKYTDSEFITSPVPERGGR 641

Query: 705 --TETSNRHSSVRITPITE 721
             T T+ R+SSV I P+TE
Sbjct: 642 IPTPTNKRYSSVIINPVTE 660

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/29 (58%), Positives = 24/29 (82%)

Query: 780 ISSDATETIVEVNVDDLEADFRKRFPSKV 808
           ISS ATE IV ++V+ LE DF++RFPS++
Sbjct: 695 ISSTATERIVNLDVESLEKDFKRRFPSRI 723

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/733 (45%), Positives = 431/733 (58%), Gaps = 58/733 (7%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN P I LY  GT+LTVG+H A I KYLTSGGFAQ+Y  EI+P D Y+ +N+ACLKRVIV
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV-NGVAYEVFVLMEFCERGGLIDF 119
           P K GLNTLRAEVDAMKLLKNN+HVVSYIDS+A KS  N  +YEV +LME+CE GGLIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179
           MN+RLQNRL E+EIL I+SQT QG+A MHALQP L+HRDIKIENVL S NG +K+CDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239
           V G IRPPRN QE +YVQHDIL NTTAQYR PEM+DLYRGLPIDEKSDIWALG+FLYK+C
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299
           YYTTPFEK+GE  ILH+++QYP FP YSDRLKNLIR+ML E P+KRPNIC++LEE+S +Q
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 300 IKPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQKFLPAQGLQSMKPISNMIPVSHVRTT 359
             PCPI+NFYL+RA     QLA++    +     K   AQ +Q +   +  +P+      
Sbjct: 301 GVPCPIQNFYLIRAQ----QLANQIQLQRQTTVPKIATAQPIQQLNARTQTMPI------ 350

Query: 360 PNLSTLPRSIDDNNMTDVTKQISLQFVGDSNVDTPLKKTKSVP-LSDDFASLYYRELHPF 418
                    I+    T +   I++  + ++     L+    VP  S       Y +LHPF
Sbjct: 351 ---------INTKANTSLVTPITVPVLSENTRLPALELDIKVPQFSPSLDKDMYMKLHPF 401

Query: 419 QKSQTFKSVENFXXXXXXXXXXXXXXXANSIILDKTPTMNRPNNYVDSETQTTDIITMSG 478
           QKS T  +                    ++   D      R  +  D +   ++ +  S 
Sbjct: 402 QKSGTLLTPSKTASVSPIRRYISRSPSRDNTNYD---IQRRRTSQYDHDQNQSNYMGRSL 458

Query: 479 SKLSPALTNKPVNSQKEFIAPENVSGGNIVRSLSSKLKKVITGESRGSSPIKSRQNTGDS 538
           S+ S   +   ++ +       N +G +  +  ++K+K+V+TGESR +SPI+SRQ+TG S
Sbjct: 459 SRTSSIKSTSALSFEGNLQG--NNTGDSFAQKFTNKIKRVVTGESRNASPIRSRQDTGGS 516

Query: 539 TRSALGMLRHGFTGSSMNNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFNPDTKRQE 598
            RSA G +R  FTGS                                   + NP  +   
Sbjct: 517 VRSAFGAIRGAFTGSM--RAPSLDNNTNNSMHNNSNNNTSRNSSYGRHNIITNPIKEEDS 574

Query: 599 EIDKKQKLENRRSMPSSILSDFDQHERINSRTGSRDYYRSHSPVKKIQTTSKSAPKPITK 658
               K KL  R +MP  +L D +  E  N    + +YYRSHSP               TK
Sbjct: 575 RNMTKAKLAKRHTMPPGMLYDLENLEIENEGYHASEYYRSHSP---------------TK 619

Query: 659 PVIGDININQEKKESIQRRVHNLLKSSEDPLTYK----------SASGYGKYTDTDTETS 708
           P      + +  +++IQ+RV NLL  SE P+             S S   +  ++  + S
Sbjct: 620 PF-----VTKTTRDNIQQRVQNLLSESEQPMERNNIDTHHTNAVSHSMIPRNLNSREKDS 674

Query: 709 NRHSSVRITPITE 721
            R+SSV I P+ +
Sbjct: 675 LRYSSVVINPLED 687

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/29 (65%), Positives = 23/29 (79%)

Query: 780 ISSDATETIVEVNVDDLEADFRKRFPSKV 808
           ISS ATE +V ++VD LE DFRKRFPS +
Sbjct: 725 ISSTATEQLVTLDVDTLERDFRKRFPSTL 753

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/768 (44%), Positives = 449/768 (58%), Gaps = 109/768 (14%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN PQI  Y  GTIL VGSH  K++KYL SGGFA VY+ EISPPDP    N+ACLKRV+V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEFCERGGLIDF 119
           PDK  LNTLRAEVD+MK L+ NK +VSYIDSHA KS VN   YEV++LME+C  GGLIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179
           MNTRLQNRL+E EIL IMSQ  QG+AAMHALQPPLIHRDIKIENVL+S N  +K+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239
           VSGVIR PRNT+EFNYVQ+DI+ NTTAQYR PEMIDLYRGLPIDEKSDIWALG+FLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299
           YYTTPFEK+GE+ IL +++++P +P+YSDR+KNLI +ML   P KRPNICQV+EEVSR+Q
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 300 IKPCPIRNFYLLRAMSQTAQLASEPPSM-------KYVPTQ---KFLPAQGLQSMKPISN 349
             PCPI+NFYLLR M +  Q    PP           VPT    + LP Q + +++  S 
Sbjct: 301 GIPCPIKNFYLLRMMDKQEQPRVSPPPHVPQMTVPATVPTSVSTQHLPPQVVSNVQTPSK 360

Query: 350 MIPVSHV-------------------RTTPNLSTLPRSIDDNNMTDVTKQISLQFVGDSN 390
              + H+                   +  P   T+P+++ +   +D   +I    +  ++
Sbjct: 361 TASIQHLPYLHVSKSQPMVTQQDLLSQKQPAGKTVPQTVSNYTSSDPFSKIDRSALLSTS 420

Query: 391 VDTPLKKTKSVPLSDDFASLYYRELHPFQKSQTFKSVENFXXXXXXXXXXXXXXXANSII 450
                   +S+P +     L Y++ H   +SQ+                       +SI+
Sbjct: 421 A-----TMESLPRAMRIPQLEYQQPHLLTRSQS------VVPRASVSPVRNGRGAISSIL 469

Query: 451 LDKTPTMNRPNNYVDSETQTTDIITMSGSKLSPALTNKPVNSQKEFIAPENV--SGGNIV 508
                +++RP  YVDSETQT+D  +  G  LS +L+ K V S            +GG++ 
Sbjct: 470 ASNRTSLDRP-KYVDSETQTSDHPSELG--LSRSLSRKSVASSLSSAESLEATSTGGSLT 526

Query: 509 RSLSSKLKKVITGESRGSSPIKSRQNTGDSTRSALGMLRHG-----FTGSSMNNNXXXXX 563
           R + SK+KKVITGE RG S I+S QNTG+S +SA   LR G     FTG S         
Sbjct: 527 RKIGSKMKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDS--------- 577

Query: 564 XXXXXXXXXXXXXXXXXXXXXXXXXVFNPDTKRQEEID-KKQKLENRRSMPSSILSDFDQ 622
                                         + R+  ++ +K +  + +S+P +  S+   
Sbjct: 578 ------------------------------SSRKSSLEARKYRSTSGKSIPENTSSNTKS 607

Query: 623 HERINSRTGSRDYYRSHSPVKKIQTTSKSAPKPITKPVIGDININQEKKESIQRRVHNLL 682
           H R    T S  +   ++  + I+   K  PK          + + +   SIQ+RV +L+
Sbjct: 608 HRR---STSSFSFVPENNDYELIEDIQKEKPK-----SSLRRSSSLKTSSSIQKRVKDLI 659

Query: 683 KSSEDPLTYKSASGYGKYTDTDTET---------SNRHSSVRITPITE 721
            + + P    SA+GYGKYTD   +T         +NR SS  ITP+ E
Sbjct: 660 NADDIP-NRSSATGYGKYTDIGRKTDISDHHKSNANRKSSTVITPVHE 706

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  566 bits (1458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/577 (54%), Positives = 367/577 (63%), Gaps = 41/577 (7%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN     +Y+PGT LTVGSH A+IIKYLTSGGFA +YTAEI P D  + A IACLKRV+V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEFCERGGLIDF 119
           PDK  LN LRAEVDAMKLL+ N+HVVSYIDSHAAKS V+  +YEVF+LME+C  GGLIDF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179
           MNTRLQNRL+E E+L+I S   QGIAAMHALQPPLIHRDIKIENVLIS +  +KVCDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239
           V GVIRPP+N QEFNYVQHDIL NTTAQYR+PEMIDLYRG PI+EKSDIWALG+FLYK+C
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299
           YYTTPFEK GEA ILH+R+Q+P +PQYSD LK+LI  ML E P++RPNICQVLEEVSR+Q
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 300 IKPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQKFLPAQGLQSMKPISNMIPV----SH 355
             PCP+RNFY+ RAM Q  Q           P  KF  +     +   +N+I V    SH
Sbjct: 301 GTPCPLRNFYVTRAMQQQQQHQQ--------PKIKFDHSASQPKLDSANNIINVPFKMSH 352

Query: 356 ---VRTTPNLSTLPRSIDDNNMTDVTKQISLQFVGDSNVDTPLK--------KTKSV--- 401
              +R+T   +  P +   N      K + +Q V  S  + P K        ++K     
Sbjct: 353 NQPLRSTQTFAGAPVNAASNGYLPALKPLPIQPVSSSFTNGPFKFIEGNKALQSKQTPHF 412

Query: 402 --PLSDDFASLYYRELHPFQKSQTFKSVENFXXXXXXXXXXXXXXXANSIILDKTPTMNR 459
             P+S DF  L         +SQTF                      + II    PT   
Sbjct: 413 QPPISHDFNRL--------GRSQTFTPTSTLASRSSVSPPLAGRGDISKII-SANPTNVE 463

Query: 460 PNN-YVDSETQTTDIITMSGSKLSPALTNKPVNSQKEFIAPENVSGGNIVRSLSSKLKKV 518
           P+  Y+ S TQT D    S   L    T    +           +GG+  R    KL KV
Sbjct: 464 PSPIYLSSGTQTDDGFA-SSHALKLERTKSIASLSSSESVESQHTGGSATRRFGQKL-KV 521

Query: 519 ITGESRGSSPIKSRQNTGDSTRSALGMLRHGFTGSSM 555
            TGE R  SPIKSRQNTGDS RSA   LR GF+G S 
Sbjct: 522 FTGERRSISPIKSRQNTGDSVRSAFATLRRGFSGGSF 558

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 80/207 (38%), Gaps = 47/207 (22%)

Query: 619 DFDQHERINSRTGSRDYYRSHSPVKKIQTTSKSAPKPITKPVIGDININQEKKESIQRRV 678
           D DQ ++ +  TG+++YY+SHSPVK                    ++  Q  + SIQ+RV
Sbjct: 614 DLDQLQQDD--TGAKNYYKSHSPVK--------------------VSATQGSRSSIQKRV 651

Query: 679 HNLLKSSEDPLTYKSASGYGKYTDTD------------TETSNRHSSVRITPITEEKFKS 726
            +LLK+S+D    K+A GYG  +  D            T   N H S   TP      K 
Sbjct: 652 QDLLKNSQDSPVKKTAHGYGMLSPGDEAAELASQLTNETMLQNVHQSTASTPKVLSPAK- 710

Query: 727 RN-----KNGLSNNKTKDNDXXXXXXXXXXXXXXXXXAEIQKVXXXXXXXXXXXXXXXIS 781
           RN     K G   +K  +                   + ++                   
Sbjct: 711 RNSSVVIKAGQQVSKDAEEVPSSRKPAPPKPKRPKKPSHLKADKIIKEAETSAYEHSVDI 770

Query: 782 SDATETIVEVNVDDLEADFRKRFPSKV 808
           SD       + +D+LE DF++RFPS V
Sbjct: 771 SD-------IEIDELEKDFKRRFPSAV 790

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/316 (79%), Positives = 275/316 (87%), Gaps = 3/316 (0%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN P+I  Y PGT+LTVGSHHAK+I YLTSGGFAQVY+AEI P D + ++N+ACLKRVIV
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEFCERGGLID 118
           PDK  LNTLRAEVDAMKLL+NNKHVVSYIDSHAAKS   NG +YEVF+LME+C  GGLID
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNG-SYEVFLLMEYCAGGGLID 119

Query: 119 FMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFG 178
           FMNTRLQNRL+E EIL IMSQ  QGIAAMHALQPPLIHRDIKIENVLISH G YKVCDFG
Sbjct: 120 FMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFG 179

Query: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKI 238
           SV GVIRPP+N QEF YVQHD+L NTTAQYRSPEMIDLYRG PIDEKSDIWALG+FLYK+
Sbjct: 180 SVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKL 239

Query: 239 CYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRL 298
           CYYTTPFEK GE  ILH+R+Q+P  P YSDRLK LIR MLME P +RPN+CQVLE+VSR+
Sbjct: 240 CYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRM 299

Query: 299 QIKPCPIRNFYLLRAM 314
           Q   CP+RNFYLLRAM
Sbjct: 300 QGIQCPVRNFYLLRAM 315

 Score = 32.3 bits (72), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 21/25 (84%), Gaps = 1/25 (4%)

Query: 667 NQEKKESIQRRVHNLLKSSED-PLT 690
           ++E KESIQRRV +LL SSED PL+
Sbjct: 545 SREAKESIQRRVRDLLNSSEDLPLS 569

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  528 bits (1361), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 261/419 (62%), Positives = 315/419 (75%), Gaps = 28/419 (6%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN PQI LY+PGT+LTVGSH  +++KYLTSGGFAQ+YT +ISPPD +TN N+ACLKRVIV
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAK-SVNGVAYEVFVLMEFCERGGLIDF 119
           PDK  LNTLRAEVD MKLL+NN HVVSYIDSHAAK + N  +YEVF+LME+C+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179
           MNTRLQ RLRE EIL IMSQ  QGIAAMHAL PPL+HRDIKIENVL++  G YKVCDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239
           V G+IRPP N QE +YVQHDI+ NTTAQYR+PEMIDLYRGLPIDEKSDIWALG+FLYK+C
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299
           YYTTPFEK+GEA ILHA +Q+P +PQYSDRLK LI  MLME PS+RPN  QVLEEVS +Q
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 300 IKPCPIRNFYLLRAMSQTAQLA--SEP---------PSMK-YVPTQKFL-PAQGLQSMKP 346
              CPI NFYL+       Q+A  ++P         P+M+ YVP   F+       SM  
Sbjct: 301 NVQCPIPNFYLMNNNVTQGQMAMQTQPQNNGAMMASPNMQPYVPNNNFVYNTPNAVSMND 360

Query: 347 ISNMIPVS-HVRTTPNLSTLPRSIDDNNMTDVTKQISLQFVGDSNVDTPLKKTKSVPLS 404
           I  M  ++  V +T N   +P ++     T++ + I +Q         P++K++++P+S
Sbjct: 361 IQMMNAINLKVNSTHNTGMIPPTM----ATNMARTIPMQ---------PVQKSQTLPVS 406

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  514 bits (1323), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 240/326 (73%), Positives = 274/326 (84%), Gaps = 2/326 (0%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN P+I  Y PGTIL VGSH  +IIKY+TSGGFAQ+YT EISPPD + ++NIACLKRVIV
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEFCERGGLIDF 119
           PDK  LNTLRAEVDAMKLL+NNKHVVSYIDSHA+KS  N  +YEVF+LME+CERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179
           MNTRLQNRL ESE+L I SQ  QGIAAMHALQPPL+HRDIKIENVLIS +  YK+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239
           VSG+IRPP N QE  YVQHD+L NTTAQYRSPEMID YRGLPIDEKSDIWA+G+FLYK+C
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 240 YYTTPFEKS-GEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRL 298
           YYTTPFEK+ GEA IL ARY+YP FP YS+RLK+LI  MLME P +RPNI QV+EE+S++
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 299 QIKPCPIRNFYLLRAMSQTAQLASEP 324
           Q  PCPI NFYL+    +   +  +P
Sbjct: 301 QNVPCPIVNFYLVTQQQKHKMVQLQP 326

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  525 bits (1353), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 239/315 (75%), Positives = 272/315 (86%), Gaps = 1/315 (0%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN P   +Y  GT LTVGSH A+IIKYLTSGGFA +Y+AEISP DP +  N+ACLKRV+V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEFCERGGLIDF 119
           PDKQ LN LRAEVDAMKLL+ NKHVVSYIDSHAAKS     +YEVF+LME+C  GGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179
           MNTRLQNRL E+E+L+IMS   QGIAAMHAL PPLIHRDIKIENVLIS +  +KVCDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239
           V GVIRPP+N QEF+YVQ+DIL NTTAQYRSPEMIDLYRG PI+EKSDIWALG+FLYK+C
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299
           YYTTPFEK G+A ILH+R+Q+P +PQYSDRLKNLI +ML E P++RPNICQVLEEVSR+Q
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 300 IKPCPIRNFYLLRAM 314
             PCP+RNFYLLR+M
Sbjct: 301 NVPCPLRNFYLLRSM 315

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 96/206 (46%), Gaps = 29/206 (14%)

Query: 503 SGGNIVRSLSSKLKKVITGESRGSSPIKSRQNTGDSTRSALGMLRHGFTGSSMNNNXXXX 562
           +GG+  R+   +LKKV TGE R  SPIKSRQNTG+S +SA   LR GF+  S        
Sbjct: 510 TGGSFSRTFGRRLKKVFTGEKRSISPIKSRQNTGESVKSAFATLRRGFSSGSHKGEQLSK 569

Query: 563 XXXXXXXXXXXXXXXXXXXXXXXXXXVFNPDTKRQEEIDKKQKLENRRSMPSSILSDFDQ 622
                                             +EE        +R++  +SI+SD D 
Sbjct: 570 KNTVDVTTNGSSSNGYKFRVTSSDSI--------EEENSGFIYSHSRKASSTSIVSDLDS 621

Query: 623 HERINSRTGSRDYYRSHSPVKKIQTTSKSAPKPITKPVIGDININQEKKESIQRRVHNLL 682
            +  +S T ++ YYRSHSPVK                    ++ + + + SIQ+RV NLL
Sbjct: 622 LQD-DSGTNAKKYYRSHSPVK--------------------LSGSSDARSSIQKRVQNLL 660

Query: 683 KSSEDPLTYKSASGYGKYTDTDTETS 708
           KSS+D    KSA GYG+ ++ + + S
Sbjct: 661 KSSQDSPVKKSAHGYGEVSEKEDKES 686

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  515 bits (1326), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 234/315 (74%), Positives = 274/315 (86%), Gaps = 1/315 (0%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN PQ+++Y PGT+L+VGSH A+IIKYLTSGGFAQVYTAEISP DP+ N++I CLKRVIV
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAK-SVNGVAYEVFVLMEFCERGGLIDF 119
           PDK  LNTLRAEVDAMKLL+NN HVVSYIDSHAAK   N  +YEVF+LME+C+RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179
           MNTRLQNRL E+EIL+IMSQ  QG+AAMHALQPPL+HRDIKIENVL++  G YK+CDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239
           V G+IRPP N QEF YVQHDI+ NTTAQYRSPEMI+L +GLPI+EKSDIWALG+FLYK+C
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299
           YYTTPFEK+GE  ILHA +Q+P FP YSDR+K+LIR+ L   PS+RPNI Q+LEEVS++Q
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 300 IKPCPIRNFYLLRAM 314
             PCPI +FYL R +
Sbjct: 301 NVPCPIPDFYLQRKL 315

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  521 bits (1341), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 236/315 (74%), Positives = 275/315 (87%), Gaps = 2/315 (0%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           M+ P +  Y  GT+LTVGSH A+IIKYLTSGGFA +Y+AEISPPDP  +++IACLKRV+V
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDP-NSSSIACLKRVLV 59

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEFCERGGLIDF 119
           PDK  LN+LRAEVDAMKLLK +K VVSYIDSHAAKS +N  +YEVF+LME+C RGGLIDF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179
           MNTRLQNRL+E E+L+IMSQ  QG+AAMHALQPPLIHRDIKIENVLIS +G +KVCDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239
           V GVIRPP+N QE NYVQHDIL NTTAQYRSPEMIDLYRGLP+DEKSDIWALG+FLYK+C
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299
           YYTTPFEK+GE  ILH+++Q+P +PQYSD+LKNLI  +L E P +RPNICQ+L EVSR+Q
Sbjct: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299

Query: 300 IKPCPIRNFYLLRAM 314
             PCP++NFYL R M
Sbjct: 300 GVPCPVKNFYLERKM 314

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 133/271 (49%), Gaps = 38/271 (14%)

Query: 448 SIILDKTPT-MNRPNNYVDSETQTTDIIT-MSGSKLSPALTNKPVNSQKEFIAPENVSGG 505
           S IL   PT ++R ++YVDSETQT + I  +S S           ++  +    E  +GG
Sbjct: 446 SKILKSNPTSVDRLSSYVDSETQTFETIEPLSRSVSRSVSRGSASSASSQDSVEEQSTGG 505

Query: 506 NIVRSLSSKLKKVITGESRGSSPIKSRQNTGDSTRSALGMLRHGFTGSSMNNNXXXXXXX 565
           +  R +  KLK++I+ E R +SPI+SRQNTG STRSA   LR G T S+ +++       
Sbjct: 506 SFTRRIGDKLKRIISNEPRNTSPIRSRQNTGGSTRSAFSTLRRG-TSSNFSSD------- 557

Query: 566 XXXXXXXXXXXXXXXXXXXXXXXVFNPDTKRQEEIDKKQKLENR---RSMP-SSILSDFD 621
                                  V    +K  EE     K EN+   RS+  SSI SD +
Sbjct: 558 ---RSKRNSVDFSVRRLGSGGNKVRVSSSKSIEEKGNTNKFENKGHNRSVSTSSITSDLN 614

Query: 622 QHERINSRTGSRDYYRSHSPVKKIQTTSKSAPKPITKPVIGDININQEKKESIQRRVHNL 681
           ++E   + + SR Y ++HSP+K                    ++ N+E + SIQ+RVH+L
Sbjct: 615 KYEG-KAGSVSRGYNQAHSPIK--------------------MSANRESRNSIQKRVHDL 653

Query: 682 LKSSEDPLTYKSASGYGKYTDTDTETSNRHS 712
           LK+S+D    K+A  +G+++    + +  H+
Sbjct: 654 LKNSQDSPVRKTAPDFGEFSSFPQDHAADHT 684

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%)

Query: 790 EVNVDDLEADFRKRFPSKV 808
           EV++DDLE DF+KR+PS +
Sbjct: 773 EVDIDDLEEDFKKRYPSAI 791

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  516 bits (1328), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 290/514 (56%), Positives = 345/514 (67%), Gaps = 36/514 (7%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN P+I  Y PGT+L+VG+HHAKI+KY+ SGGFAQVY+AE+ P D  T  N  CLKRVI+
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEFCERGGLID 118
           P+K GLN LRAEV+AMKLLK +KHVV YIDSHAA+S+  NG  YEVF+LMEFC  GGLID
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGT-YEVFLLMEFCTAGGLID 119

Query: 119 FMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFG 178
           FMNTRLQNRL+E EIL IMSQ  QGIAAMHALQPPLIHRDIKIENVLIS +G YKVCDFG
Sbjct: 120 FMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFG 179

Query: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKI 238
           SVSG IRPPRN QEF +VQHDIL NTTAQYRSPEMIDLYR   IDEKSDIWALGIFLYK+
Sbjct: 180 SVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKL 239

Query: 239 CYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRL 298
           CYYTTPFEK G+  ILH+RYQ+   P YSDRLKNLI  ML + P +RPNICQVLEEVSR+
Sbjct: 240 CYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRM 299

Query: 299 QIKPCPIRNFYLLRAMSQTAQLASE-PPSMKYVPTQKFL--PAQGLQSMKPI----SNMI 351
           Q    P+RNFYLLRAM  T    S   P +  V T  F+  PAQ +  + P     +N +
Sbjct: 300 QGVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPAQ-VAPLTPAQSLGANGM 358

Query: 352 PVSHVRTTPNLSTLPRSIDDNNMTDVTKQISLQFVGDSN---VDT---PLKKTKSVPL-S 404
           PV     TP     P  I     + ++   ++ F G +N   V T   P +    VP+ S
Sbjct: 359 PVG---VTPQ----PMPIMAKTRSGISTGGNI-FPGAANPMVVPTQLGPAQVAGPVPMGS 410

Query: 405 DDFASLYYRELHPFQKSQTFKSVENFXXXXXXXXXXXXXXXANSIILDKTPTMNRPNNYV 464
            D +S     L PF ++ T  + + F                +++        +RP NYV
Sbjct: 411 QDMSSGI---LPPFNRASTLPT-DGF----STGPGKDGGVITSAVNTGPETIKDRPFNYV 462

Query: 465 DSETQTTDIITMSGSKLSPALTNKPVNSQKEFIA 498
           DSETQT+D  +++ SK  P L    V+S +   A
Sbjct: 463 DSETQTSDAGSITTSK--PYLHPSAVSSTRSLPA 494

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%)

Query: 655 PITKPVIGDININQEKKESIQRRVHNLLKSSEDPLTYKSAS 695
           P T   +  I  N + KESIQ++V +LLK++ED    KS S
Sbjct: 563 PTTPDSLARIKSNPDTKESIQKKVQSLLKAAEDSPKNKSTS 603

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  516 bits (1328), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 289/562 (51%), Positives = 362/562 (64%), Gaps = 49/562 (8%)

Query: 4   PQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDK 63
           PQ  L +PG ILTVGSH  KII+YLTSGGFAQ+Y+ E+  P P    ++ACLKRV VPDK
Sbjct: 5   PQDCL-QPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGP-IQGSLACLKRVHVPDK 62

Query: 64  QGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV-NGVAYEVFVLMEFCERGGLIDFMNT 122
             LNTLRAEVDAMK+LK ++HVVSYIDSHAAKS  +   YEV++LME+C RGGLIDFMN+
Sbjct: 63  PSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNS 122

Query: 123 RLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSG 182
           RLQ RL E E+L+IMS   QGI AMHAL PPLIHRDIKIENVLIS +G +KVCDFGSVSG
Sbjct: 123 RLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSG 182

Query: 183 VIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYT 242
           VIRPP+N  EFNYVQHDIL NTTAQYR+PEMIDLYR LP+DEKSDIWALG+FLYK+CY+T
Sbjct: 183 VIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFT 242

Query: 243 TPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQIKP 302
           TPFEK GE  IL A++Q+P +PQY+DRLKNLI +ML E P +RPNICQVLEEVSR+Q  P
Sbjct: 243 TPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQGVP 302

Query: 303 CPIRNFYLLR-----------AMSQTA------QLASEPPSMKY--VPTQKFLP-AQGLQ 342
           CP+ NFYL R           + SQ A      Q ++  P + +   P  +  P   G+Q
Sbjct: 303 CPLPNFYLERMKHGACTPVHHSASQPALPLATHQFSTSTPMVTHPQPPANQMSPLPHGIQ 362

Query: 343 SMKPISNMIPVSHVRTTPNLSTLPRSIDDNNMTDVTKQISLQFVGDSNVDTPLKKTKSVP 402
            +   SNM+ + H  TTPN+  +PR   +N    + K       G  ++           
Sbjct: 363 PI--TSNMVYMMH-NTTPNIKDIPR---ENPAATIQKNALYSMSGSEHLSA--------- 407

Query: 403 LSDDFASLYYRELHPFQKSQTFKSVENFXXXXXXXXXXXXXXXANSIILDKTPTMNRPNN 462
           LS D   +++      + S TF  V                      +    PT  +   
Sbjct: 408 LSSD---MHFNRPQ-LENSHTFSGV---GPRSSSNPIKIPRNEIQKFLSGTPPTSAKKPT 460

Query: 463 YVDSETQTTDIITMSGSKLSP-ALTNKPVNSQKEFIAPENVSGGNIVRSLSSKLKKVITG 521
           YVDSETQT DIIT + S   P A++  P++S + F   E  +G +++  LS K  +  T 
Sbjct: 461 YVDSETQTGDIITSNKSGSRPFAMSLSPLSSPELF--SEQSTGNSLLGRLSRKTIRSPTS 518

Query: 522 ESRGSSPIKSRQNTGDSTRSAL 543
           + +GS+P+KS+ + GD   S L
Sbjct: 519 D-KGSNPLKSKSSVGDDLASLL 539

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  513 bits (1321), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 254/390 (65%), Positives = 292/390 (74%), Gaps = 13/390 (3%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN P++     GT LTVG+H  KI+KYLTSGGFAQ+Y  EI     +  +N+ACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEFCERGGLIDF 119
           PDK  LN LRAEVDAMKLL NNKHVVSYIDSHA +S  N   YEVF+LME+CE GGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179
           MNTRLQNRL E EIL+IMSQT QGIA MHAL PPL+HRDIKIENVL+S  G+YKVCDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239
           VSGVIRPPRN QE  YVQHDI+ NTTAQYR PEM+DLYRGLPIDEK+DIWALG+FLYK+C
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299
           YYTTPFEK GE  ILHAR+Q+P FP YSDRLKNLI+ ML E PS RPN+CQVLEEVSR+Q
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 300 IKPCPIRNFYLLRAMSQTAQLASEPPSMKY--VPTQKFLPAQGLQSMKPISNMIPVSHVR 357
             PCPIRNFYLLRAM +  +L++E   + Y  +  QK   AQ      P+   +P++   
Sbjct: 301 NVPCPIRNFYLLRAM-EKVKLSTE---IDYPQLQLQKLRNAQADNLSNPMIKPMPIAQRP 356

Query: 358 T------TPNLSTLPRSIDDNNMTDVTKQI 381
           T        N  TLP  +  NN+     Q+
Sbjct: 357 TFSGNGMVNNNRTLPTVMVSNNVIGNGSQV 386

 Score = 60.8 bits (146), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 65/146 (44%), Gaps = 1/146 (0%)

Query: 664 ININQEKKESIQRRVHNLLKSSEDPLTYKSASGYGKYTDTDTETSNRHSSVR-ITPITEE 722
           +N N EK++SIQ RV +LL +       KSA GYGKYTD  + T      V   +P+  +
Sbjct: 543 LNPNSEKRKSIQLRVQHLLDNMSSNEVKKSAQGYGKYTDELSSTGTNIPKVTPDSPVLAD 602

Query: 723 KFKSRNKNGLSNNKTKDNDXXXXXXXXXXXXXXXXXAEIQKVXXXXXXXXXXXXXXXISS 782
                +   +     K+                      +K+               I+S
Sbjct: 603 LIDFNDVPTIRIPSDKNQLSKSGKIKPAPPPKPKKLRSNKKISTLSALRLEPKQNDRITS 662

Query: 783 DATETIVEVNVDDLEADFRKRFPSKV 808
           DAT+ ++ +NVDDLE DF++RFPS V
Sbjct: 663 DATDVLMHLNVDDLEEDFKRRFPSAV 688

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  509 bits (1312), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 237/323 (73%), Positives = 269/323 (83%), Gaps = 5/323 (1%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN P+I LY PG IL VGSH AKI+KYLTSGGFAQVY  EISP D ++ +NIACLKRVIV
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-----VNGVAYEVFVLMEFCERGG 115
           PDK  LN  RAEV+AMKLL+NNK+VVSYIDSHAAKS     V   +YEVF+LME+C   G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 116 LIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVC 175
           LIDFMNTRLQNRL+E EIL IMS   QG+AAMHALQPPL+HRDIKIENVLIS+   +K+C
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 176 DFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFL 235
           DFGSV GVIRPP N  E ++VQHDIL NTTAQYRSPEM+ L + +PI+EKSDIWALG+FL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 236 YKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEV 295
           YK+CYYTTPFEK GE  ILH+RYQYP +PQYSD LKNLIR+MLM  PSKRPNICQV+EEV
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 296 SRLQIKPCPIRNFYLLRAMSQTA 318
           SRLQ  PCP++NFYL RA+ QTA
Sbjct: 301 SRLQGVPCPLKNFYLERAIRQTA 323

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  506 bits (1304), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 235/318 (73%), Positives = 268/318 (84%), Gaps = 1/318 (0%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN P I  Y  G  L VG HHA I+KYLTSGG+AQVY A+ISPPD  T ++I CLKR+IV
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEFCERGGLIDF 119
           PDK  LNT RAEVDAMKLL+N  HVVSYIDS+AAKS ++  AYEV +LMEFC  GGLIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179
           MNTRLQNRL+E EIL IMSQ  QG+AAMH+L+PPL+HRDIKIENVLIS++G YK+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239
           V GVIRPP + QEFN+VQHDIL NTTAQYR+PEMIDL R LPIDEKSDIWALG+FLYK+C
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299
           YYTTPFEK+GEA ILH+RY+Y  +P YSD LKNLIRLML   PS+RPNICQVLEEVSRLQ
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 300 IKPCPIRNFYLLRAMSQT 317
             PCPI+NFYL RA+ ++
Sbjct: 301 GIPCPIKNFYLERAIHRS 318

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  505 bits (1301), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 231/334 (69%), Positives = 267/334 (79%), Gaps = 1/334 (0%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN P I  Y+PGT L VG H   IIKYLTSGGFAQ+Y  +++PP+P    N+ACLKRVIV
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV-NGVAYEVFVLMEFCERGGLIDF 119
           P+K GLNTLRAEV+AM+LLK   HVV YIDS+AA+S+ N   YEV  LMEFC  GGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179
           MNTRLQNRL+E E+L IM+Q  QGI AMH+L PPLIHRDIKIENVLIS NG YKVCDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239
           VSG+IRPP+NT+EFN+VQ DI+ NTTAQYR PEM+DLYRG PI+EKSDIWALG+FLYKIC
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299
           YYTTPFE  GE  ILHARYQYP +P YS RLKNLIR+MLME P +RPN+CQVLEEVS +Q
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 300 IKPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQ 333
             PCP+ NFYL R  +    + +   S+  +PTQ
Sbjct: 301 GIPCPLPNFYLQRQQATQLMMNNTNGSIYPIPTQ 334

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  495 bits (1274), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 226/315 (71%), Positives = 269/315 (85%), Gaps = 3/315 (0%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN PQI  Y  GT LTVGSH  +I+KYLTSGGFAQVY+A ISPPDP++++NIACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEFCERGGLID 118
           PDK  LNTLRAEVDAM+LL+NN++VVSYIDSHAAK++  NG +YEVFVLME+CERGGLID
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNG-SYEVFVLMEYCERGGLID 119

Query: 119 FMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFG 178
           FMNTRLQNRL E EIL+IMSQ  QG+AAMHALQPPLIHRDIKIENVLIS N  YK+CDFG
Sbjct: 120 FMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFG 179

Query: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKI 238
           SV GVIRPPRN QE +YVQ DI  NTTAQYRSPEM+D++RGLPIDEKSDIWALGIFLYK+
Sbjct: 180 SVCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKL 239

Query: 239 CYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRL 298
           CYYTTPFEK GE  IL   +++PP+P YS++L++LIR +L++ P +RPN+ Q+L+ +S +
Sbjct: 240 CYYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIM 299

Query: 299 QIKPCPIRNFYLLRA 313
           Q  PCPI +  + +A
Sbjct: 300 QNVPCPISDIQVPQA 314

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  493 bits (1270), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 225/309 (72%), Positives = 267/309 (86%), Gaps = 3/309 (0%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN PQI  Y  GT LTVGSH  +IIKYLTSGGFAQVY+A ISPPDP+TN+N+ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEFCERGGLID 118
           PDK  LNTLRAEVDAMKLL+NN++VVSYIDSHAAK+   NG +YEVFVLME+CERGGLID
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNG-SYEVFVLMEYCERGGLID 119

Query: 119 FMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFG 178
           FMNTRLQNRL ESEIL+IM Q  QG+AAMHALQPPLIHRDIKIENVLIS    YK+CDFG
Sbjct: 120 FMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFG 179

Query: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKI 238
           SV GVIRPPRN QE +YV+ D+L NTTAQYRSPEM+D++RGLPIDEKSDIWALGIFLYK+
Sbjct: 180 SVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKL 239

Query: 239 CYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRL 298
           CYYTTPFEK GE  IL+ ++++ P+P YS++L+NLI  +L++ PS+RPN+ Q+L++++ +
Sbjct: 240 CYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNM 299

Query: 299 QIKPCPIRN 307
           Q  P PIR+
Sbjct: 300 QNAPYPIRD 308

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  493 bits (1269), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 228/322 (70%), Positives = 271/322 (84%), Gaps = 3/322 (0%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN PQI  Y  GT LTVGSH  +IIKYLTSGGFAQVY+A I+PPDP++N+++ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEFCERGGLID 118
           PDK  LNTLRAEVDAM+LLKNN++VVSYIDSHAAK++  NG +YEVFVLME+CERGGLID
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNG-SYEVFVLMEYCERGGLID 119

Query: 119 FMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFG 178
           FMNTRLQNRL E EIL+IMSQ  QG+AAMHALQPPLIHRDIKIENVLIS N  YK+CDFG
Sbjct: 120 FMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFG 179

Query: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKI 238
           SV G+IRPPRN+QE +YVQ DIL NTTAQYRSPEMID +RGLPIDEKSDIWALGIFLYK+
Sbjct: 180 SVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKL 239

Query: 239 CYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRL 298
           CYYTTPFEK G+  IL  ++++P +P YS++LK LIR +L++ P  RPN+ Q+L+ +S +
Sbjct: 240 CYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIM 299

Query: 299 QIKPCPIRNFYLLRAMSQTAQL 320
           Q  PCPI +  +++A S    L
Sbjct: 300 QNVPCPINDIQVVQAPSSHLNL 321

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  491 bits (1265), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 249/396 (62%), Positives = 298/396 (75%), Gaps = 17/396 (4%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN PQI  Y  GT LTVGSH  +IIKYLTSGGFAQVY+  ISPPDP+TN N+ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEFCERGGLID 118
           PDK  LNTLRAEVDAM+LLKNN++VVSYIDSHAAK++  NG +YEVFVLME+CERGGLID
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNG-SYEVFVLMEYCERGGLID 119

Query: 119 FMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFG 178
           FMNTRLQNRL E EIL+I+SQ  QG+AAMHALQPPLIHRDIKIENVLIS N  YK+CDFG
Sbjct: 120 FMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFG 179

Query: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKI 238
           SV G+IR PRN+QE +YVQ DIL NTTAQYRSPEMID++RGLPIDEKSDIWALGIFLYK+
Sbjct: 180 SVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKL 239

Query: 239 CYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRL 298
           CYYTTPFEK GE  IL  ++++P +P YS++LK+LIR +L++ P  RP++ Q+L+ +S +
Sbjct: 240 CYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIM 299

Query: 299 QIKPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQKFLPAQGLQSMKPISNMIPVSHVR- 357
           Q  PCPI +   ++A S    L       +   TQ     Q L S   + N IP +  + 
Sbjct: 300 QNVPCPINDIQTVQAPSSHLNLTE---LHQLSATQNI---QSLNSHLVMGNSIPTTAFQF 353

Query: 358 TTP-NLS---TLPRSIDDNNMTDVTKQISLQFVGDS 389
           +TP N++   TLP   + N   D T   S  F  DS
Sbjct: 354 STPVNMATAQTLPIKEESNIFYDPT---SCNFAKDS 386

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  494 bits (1273), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 267/488 (54%), Positives = 325/488 (66%), Gaps = 38/488 (7%)

Query: 4   PQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDK 63
           PQ S ++PGT+LTVGSH  K++KYLTSGGFAQ+Y  E+  PD     ++ACLKRV VPDK
Sbjct: 5   PQDS-FQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK-DVACLKRVHVPDK 62

Query: 64  QGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV-NGVAYEVFVLMEFCERGGLIDFMNT 122
           Q LNTLRAEVDAMKLL+ NKH+VSYIDSHA+KSV N  +YEV +LME+C RGGLI FMNT
Sbjct: 63  QSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNT 122

Query: 123 RLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSG 182
           RLQ+RL+E E+L IM+Q VQGI AMHALQPPLIHRDIKIENVLI+ NG  KVCDFGSV G
Sbjct: 123 RLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCG 182

Query: 183 VIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYT 242
           VIRPP+NT E +YVQHDIL NTTAQYR+PEMIDLYRG  +DEKSDIWALG+FLYK+CYYT
Sbjct: 183 VIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYT 242

Query: 243 TPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQIKP 302
           TPFEK+GE  IL A +Q+P +PQYS+RLKNLI +ML E P  RPN CQVLEEV R+Q +P
Sbjct: 243 TPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQP 302

Query: 303 CPIRNFYLLRAMSQTAQLASEPPSMKYVPTQ-KFLPAQGLQSMKPISNMIPVSHVRTTPN 361
           CP++NFYL R++ Q             +P+Q +   +Q + +M P    IP+      P 
Sbjct: 303 CPVKNFYLERSLKQQ------------IPSQLRHSVSQPMIAMNPQQAKIPI----VIPQ 346

Query: 362 L--STLPRSIDDNNMTDVTKQISLQFVGDSNV---DTPLKKTKSVPLSDDFASLYYRELH 416
           +  S LP   +  NM  VT   + Q     N    DT L+ +K+  LS        +   
Sbjct: 347 VQNSVLPS--NTMNMGYVTG--AFQPASQPNEVRGDTALRVSKAKLLSTACDWDKTQNFV 402

Query: 417 PFQKSQTFKSVENFXXXXXXXXXXXXXXXA--------NSIILDKTPTMNRPNNYVDSET 468
           P     +  SVE+                         N II      + RP  YVDSE 
Sbjct: 403 PGSNYNSKASVESGHLPTSSLPTPRSSVSPVRSGRGNINKIIAANPINIKRP-VYVDSEM 461

Query: 469 QTTDIITM 476
           QTTD+ ++
Sbjct: 462 QTTDLASL 469

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  467 bits (1201), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 220/320 (68%), Positives = 258/320 (80%), Gaps = 3/320 (0%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN P IS Y  GT LTVGSH  +IIKYLT+GGFAQ+Y   ISP DP++  NIACLKRVIV
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEFCERGGLID 118
           PDK  LN LRAEVDAMKLL+NN+ VVSYIDSHAAKS   NG  YEVF+LME+CE GGLI+
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNG-TYEVFLLMEYCENGGLIN 119

Query: 119 FMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFG 178
           F+N+RLQNRL+ESE++ IM    QG+AAMHALQPPL+HRDIKIENVL+S N  +K+CDFG
Sbjct: 120 FLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFG 179

Query: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKI 238
           SVSG IRPP N QE   VQ+DI+ NTTAQYRSPEMID+ RG PIDEKSDIWALG+FLYKI
Sbjct: 180 SVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKI 239

Query: 239 CYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRL 298
           CYYTTPFEKSGEAGIL +RY++P FP YSDRL++LI  +L   P+ RPNI  V++E+S +
Sbjct: 240 CYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDM 299

Query: 299 QIKPCPIRNFYLLRAMSQTA 318
           +   CPI NFYL   M+  +
Sbjct: 300 KNISCPIINFYLKPNMTDAS 319

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  455 bits (1171), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 258/570 (45%), Positives = 335/570 (58%), Gaps = 56/570 (9%)

Query: 9   YEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNT 68
           Y+ GT L V SH   I  YLTSGGFAQVYTA I+         + CLKRVIVP+KQ LN 
Sbjct: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68

Query: 69  LRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGV-AYEVFVLMEFCERGGLIDFMNTRLQNR 127
           LRAEVDAMK+LKNNK++VSYIDSHA +  N   +Y V +LME+C   GL+DFMN RL+ R
Sbjct: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNLRLKER 128

Query: 128 LRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPP 187
           L+E EIL+IM+   QG+  MH LQPPL+HRDIKIENVL+S +G +K+CDFGSVSGV+R P
Sbjct: 129 LKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188

Query: 188 RNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEK 247
            +++EF Y+Q+DIL NTTAQYRSPEM++L  G PI+EKSDIWALGI LYK+CYYTTPFE+
Sbjct: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248

Query: 248 SGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQIKPCPIRN 307
            G   I+  ++ YP +PQY+D LKN+IR++L   P +RPNICQ+LEE+ R+Q K  P+ N
Sbjct: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308

Query: 308 FYLLRAMSQTAQLASEP---PSMKYVPTQKFLPAQGLQSMKPISNMIPVSHVRT------ 358
           FY+ RAMS      ++P   P +KY  TQ   P    QS        P  H +T      
Sbjct: 309 FYVQRAMSSLQMDTTQPHRIPILKY--TQMSKPVISSQSS-------PSKHCQTFSQKDY 359

Query: 359 ---TPNLSTLPRSID---------DNNMTDVTKQISLQFVGDSNVDTPLKKTKSVPLSDD 406
               PNLS   R+ D         D   + ++KQ+S   V D NV+T            D
Sbjct: 360 PYIQPNLSNSARAKDYYLGGSSSTDTLESSLSKQLSEDRVYDVNVNTM-----------D 408

Query: 407 FASLYYRELHPFQKSQTFKSVENFXXXXXXXXXXXXXXXANSIILDKTPTMNRPNNYVDS 466
               Y R+L P        + ++                 N   L    + N    Y+  
Sbjct: 409 SHCTYRRKLTP--------NYDHALKKGSSPSINDNSTLNNMTSLKHEHSFNSREAYIHP 460

Query: 467 ETQTTDIITMSGSKL-----SPALTNKPVNSQKEFIA-PENVSGGNIVRSLSSKLKKVIT 520
           +   +     S   L     +P   +  +NS     +   N +GG++++SL +K+K   T
Sbjct: 461 DFSGSKHFITSNDALNLNCRTPRSRDSSINSNSSVDSISRNSTGGSLIKSLGTKIKLTTT 520

Query: 521 GESRGSSPIKSRQNTGDSTRSALGMLRHGF 550
           G  R  SPIKSRQNTGDS RSA   +R G 
Sbjct: 521 GGKRSQSPIKSRQNTGDSIRSAFNKVRQGI 550

 Score = 40.0 bits (92), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 24/36 (66%)

Query: 667 NQEKKESIQRRVHNLLKSSEDPLTYKSASGYGKYTD 702
           N E K+SI+ RV  L+KSS D     SA GYGKYTD
Sbjct: 625 NLEAKKSIKDRVQALMKSSSDNHVIISAHGYGKYTD 660

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  448 bits (1152), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 212/322 (65%), Positives = 254/322 (78%), Gaps = 7/322 (2%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN P I  Y PG ++ VGSH AKI+KYLTSGGFAQ+Y+ EISP D YTN+NIACLKRVIV
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNG-VAYEVFVLMEFCERGGLIDF 119
           P+K GLN LR EVDAMKLLKNN+HVVSYIDS+AAKS  G  +YEVF+LME+CERG L+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179
           MNT+L+ RL+E E+L IM+Q  QGIAAMH L PPLIHRDIKIENVLIS +GL+KVCDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEK---SDIWALGIFLY 236
           V G+IRPPRN QE  YVQHD++ NTTAQYRSPEMIDL +G PI+ K      W + + + 
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240

Query: 237 KICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVS 296
            + +YT  F +  E  IL+ RYQYP +P YSDRLKN++R++L   P KRPNICQ+LEE+S
Sbjct: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297

Query: 297 RLQIKPCPIRNFYLLRAMSQTA 318
           ++Q  PCPI NFYL R+  Q A
Sbjct: 298 KIQNIPCPIDNFYLERSRHQGA 319

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 53/94 (56%), Gaps = 10/94 (10%)

Query: 463 YVDSETQTTDIITMSGSKLSPALTNKPVNSQKEFIAPENVSGGNIVRSLSSKLKKVITGE 522
           YVDSETQT +  ++  +++ P ++    ++          +G +IV  L  +L+ VIT +
Sbjct: 457 YVDSETQTLEEPSLQHTRILPHISTDRTDN----------TGNSIVSRLGVQLRNVITND 506

Query: 523 SRGSSPIKSRQNTGDSTRSALGMLRHGFTGSSMN 556
           S  SS I + Q TG+S +SA+  L++  +G + N
Sbjct: 507 SSASSSIDTVQETGNSIKSAIESLKNSVSGMANN 540

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 29/36 (80%)

Query: 666 INQEKKESIQRRVHNLLKSSEDPLTYKSASGYGKYT 701
           ++++ K SI++RV NLLK++ED    K+A+GYGKYT
Sbjct: 630 VDRKMKASIEKRVLNLLKNAEDSPVKKTAAGYGKYT 665

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  438 bits (1127), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 201/312 (64%), Positives = 250/312 (80%), Gaps = 3/312 (0%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60
           MN P I  YEPGT +TVGSH   I+KYLTSGG+AQ+Y+A+I P D +   N+A LKRVIV
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS--VNGVAYEVFVLMEFCERGGLID 118
           PDK  LNTLRAEVDAMK LK++K++VSYIDSHAAKS  ++G  YEVF++ME+C RGGLID
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGT-YEVFLIMEYCSRGGLID 119

Query: 119 FMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFG 178
           FMNTRLQNRL E+EIL I     QG+AAMH LQPPLIHRDIKIENVLIS++  YK+CDFG
Sbjct: 120 FMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFG 179

Query: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKI 238
           SVSG IRPP+  +E  YV+HDI+ +TTAQYR+PEM+DL +G  +++KSDIWALG+FLYK+
Sbjct: 180 SVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKL 239

Query: 239 CYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRL 298
           CYYTTPFE++GEAGIL+   ++PP+P YSD +K LI  ML + P  RPNI Q+++ VS+L
Sbjct: 240 CYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKL 299

Query: 299 QIKPCPIRNFYL 310
               CPI N ++
Sbjct: 300 LNVNCPIPNIHV 311

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  456 bits (1174), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 208/322 (64%), Positives = 249/322 (77%), Gaps = 3/322 (0%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTN--ANIACLKRV 58
           MN P+I  YE G +L +G+H   I KYL  GGFAQVY+  +       N    +ACLKRV
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60

Query: 59  IVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEFCERGGLI 117
           IVPDK GLNTLRAEVDAMKLLK NK++VSYIDSHA +S +    YEVF+LME+C RGG+I
Sbjct: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120

Query: 118 DFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDF 177
           DF+NTRL +RL+E EIL+IMS   QG+AAMH LQPPLIHRDIKIENVLIS NG YK+CDF
Sbjct: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180

Query: 178 GSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYK 237
           GS   V+RPP+  QE  ++ HDI+ NTTAQYRSPEMID Y G PIDEKSDIWALG+FLYK
Sbjct: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240

Query: 238 ICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSR 297
           +CYYTTPFEK GE  IL+ ++Q+P +PQYSD ++N+I +ML + P KRPNICQVLE+VS+
Sbjct: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300

Query: 298 LQIKPCPIRNFYLLRAMSQTAQ 319
           LQ  PCPI NF L R   Q ++
Sbjct: 301 LQGVPCPIENFMLTRIKLQNSR 322

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 1/45 (2%)

Query: 667  NQEKKESIQRRVHNLLKSSE-DPLTYKSASGYGKYTDTDTETSNR 710
            N + K+ I++RV  LLK+SE D    ++A GYGKYTD    + N+
Sbjct: 1203 NPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDKPNTSQNK 1247

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  314 bits (805), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 160/324 (49%), Positives = 210/324 (64%), Gaps = 25/324 (7%)

Query: 9   YEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEI--------SPPDPYTNANI-------- 52
           + PG ++ VG H  +IIKYL  GGFAQ+Y+           + PD   ++NI        
Sbjct: 19  FNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQFKL 78

Query: 53  -----ACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNG-VAYEVFV 106
                ACLKRV+VPD+ GLN LR EV+ M+ LK   ++V Y DS+A++  +G   +EV +
Sbjct: 79  EPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEVLL 138

Query: 107 LMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLI 166
           LME C    L+D+MN RL  +L E EIL+IM     GI+ MH LQ PLIHRDIKIENVL+
Sbjct: 139 LMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENVLV 198

Query: 167 SHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKS 226
             +  +K+CDFGS S       + QE   +  +I  +TT QYRSPEMIDLYR LPIDEKS
Sbjct: 199 DSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDEKS 258

Query: 227 DIWALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRP 286
           DIWALG+FLYK+ +YTTPFE +G+  ILH++Y+ PP   YS RL NLI +ML E P+ RP
Sbjct: 259 DIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPP-NNYSSRLINLIIIMLAENPNLRP 317

Query: 287 NICQVLEEVS-RLQIKPCPIRNFY 309
           NI QV+ +V   + I+P PI++ Y
Sbjct: 318 NIYQVMHQVCITIGIEP-PIKDKY 340

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  314 bits (805), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 154/322 (47%), Positives = 211/322 (65%), Gaps = 12/322 (3%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAE----------ISPPDPYTNA 50
           +N+P    Y  G +++VG+H  +I+ YL  GGFAQ+Y  +          +      T  
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 51  NIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGV-AYEVFVLME 109
           +IACLKRVIV D+ GLN +R EV+ MK LK++ ++V Y DS+A++  +G   +EV +LME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 110 FCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHN 169
            C    L+D+MN RL+ +L ESEIL+IM     GI+ MH L  PLIHRDIKIENVL+  N
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 170 GLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIW 229
             +K+CD GS S    P  + Q+   +  +I  +TT QYR+PEMIDLYR LPI+EKSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 230 ALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNIC 289
           ALGIFLYK+ +YTTPFE +G+  ILH++Y +PP  +YS ++ NLI +ML E P+ RPNI 
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPP-NKYSSKIINLIIIMLAENPNLRPNIF 310

Query: 290 QVLEEVSRLQIKPCPIRNFYLL 311
           QV+  +  +   P PI + Y L
Sbjct: 311 QVVYHICSIMNLPVPIEDRYGL 332

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  309 bits (792), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 211/330 (63%), Gaps = 25/330 (7%)

Query: 6   ISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTA-----------EISP--PDPYTNANI 52
           +  Y+PG ++ VGSH  +I++Y+  GGFAQ+Y+            E SP   D     ++
Sbjct: 15  VEKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDL 74

Query: 53  ACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGV-------AYEVF 105
           ACLKRVIV D+ GLN LR EV+ MK L    ++V Y DS+A++  NG         +EV 
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASRLRNGTDSQPQENKFEVL 134

Query: 106 VLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVL 165
           +LME C    L+D+MN RL  +L E EILE+M      IA MH L+ PLIHRDIKIENVL
Sbjct: 135 LLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIENVL 194

Query: 166 ISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEK 225
           +     +K+CDFGS S         ++  Y+  +I  +TT QYRSPEMIDLYR LPIDEK
Sbjct: 195 VDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK 254

Query: 226 SDIWALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQ--YSDRLKNLIRLMLMETPS 283
           SDIWALGIFLYK+ ++TTPFE++G+  ILH++++   FPQ  YS +L NLI +ML E P+
Sbjct: 255 SDIWALGIFLYKLLFFTTPFERTGQFAILHSKFE---FPQNNYSFKLINLIIVMLSENPN 311

Query: 284 KRPNICQVLEEVSRLQIKPCPIRNFYLLRA 313
            RPNI QVL ++ +L+  P PI + Y L A
Sbjct: 312 LRPNIYQVLHQICQLKQVPIPIADKYGLGA 341

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  307 bits (787), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 152/317 (47%), Positives = 205/317 (64%), Gaps = 11/317 (3%)

Query: 9   YEPGTILTVGSHHAKIIKYLTSGGFAQVYTAE----ISPPDP-----YTNANIACLKRVI 59
           Y PGTI+ VG H  +++KYL  GGFA++Y  +    +S  DP       N +  CLKRV+
Sbjct: 29  YVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLKRVL 88

Query: 60  VPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGV-AYEVFVLMEFCERGGLID 118
           V D  GLN +R EV+ M+ LK    VV Y DS+A++ ++G   YEV +LME C    L+D
Sbjct: 89  VQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNSLLD 148

Query: 119 FMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFG 178
           +MN RL  +L E EIL+IM      +A MH L  PLIHRDIKIENVL+     +K+CDFG
Sbjct: 149 YMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLCDFG 208

Query: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKI 238
           S S  +    + Q+   +  +I  +TT QYRSPEMIDLYR LP++EKSDIWALG+FLYK+
Sbjct: 209 STSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFLYKL 268

Query: 239 CYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRL 298
            +YTTPFE++G+  ILH++Y++ P   YS +L NLI +ML E P+ RPNI QVL ++  +
Sbjct: 269 MFYTTPFERTGQFAILHSKYEF-PLNNYSSKLINLIIVMLAENPNLRPNIYQVLNQICYI 327

Query: 299 QIKPCPIRNFYLLRAMS 315
                P+ + Y L A S
Sbjct: 328 SGIKNPMDDAYGLGAYS 344

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  307 bits (787), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 151/315 (47%), Positives = 201/315 (63%), Gaps = 10/315 (3%)

Query: 4   PQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEI--------SPPDPYTNANIACL 55
           P +    PGT++ VGSH  +I+KYL  GGFA +Y  +         +P       ++ACL
Sbjct: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86

Query: 56  KRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGV-AYEVFVLMEFCERG 114
           KRV+V D+ GLN LR EV+ MK LKN+ ++V Y DS+A++  +G   YEV +LME C   
Sbjct: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146

Query: 115 GLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKV 174
            L+D+MN RL  +L E E+L+IM    + +A MH L  PLIHRDIKIENVL+     +K+
Sbjct: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206

Query: 175 CDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIF 234
           CDFGS S         Q+   + ++I  +TT QYR+PEMIDLYR LPIDEKSDIWALGIF
Sbjct: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266

Query: 235 LYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEE 294
           LYK+ +YTTPFE +G+  ILH++Y  P    YS +L NLI +ML E P+ RPNI QV+ +
Sbjct: 267 LYKLLFYTTPFELTGQFAILHSKYDIPA-NNYSSKLINLIIIMLAENPNLRPNIYQVIYQ 325

Query: 295 VSRLQIKPCPIRNFY 309
           V  +     P  + Y
Sbjct: 326 VCAIMKVDVPFEDKY 340

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  305 bits (780), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 155/326 (47%), Positives = 211/326 (64%), Gaps = 29/326 (8%)

Query: 6   ISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTN---------------- 49
           I  +  G  + VGSH  +I+KYLT GGFAQ+Y  +++    Y N                
Sbjct: 26  IEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTE---YLNEFDAIDIQNQRQQQEL 82

Query: 50  --ANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS--VNGVAYEVF 105
              ++ CLKRV+V D+ GL+ ++ EV+ MK L+   +VV Y DS+A ++   NG  +EVF
Sbjct: 83  KIGDLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANG-GFEVF 141

Query: 106 VLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVL 165
           +LME+C    L+D+MN RL  +L ESEIL IM     G++ +H L  PLIHRDIKIENVL
Sbjct: 142 LLMEYCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVL 201

Query: 166 ISHNGLYKVCDFGSVSGVIRPPRNT--QEFNYVQHDILTNTTAQYRSPEMIDLYRGLPID 223
           + HN  +K+CDFGS +  I PP  T  Q+ + + HDI  +TT QYRSPEMIDL+R LP++
Sbjct: 202 VDHNNRFKLCDFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVN 259

Query: 224 EKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPS 283
           EK+DIWALG+FLYK+ +YTTPFE +G+  ILH++Y+ P    YS+RL NLI +ML E P+
Sbjct: 260 EKADIWALGVFLYKLLFYTTPFELTGQFAILHSKYEIPQ-SHYSERLLNLIVVMLAENPN 318

Query: 284 KRPNICQVLEEVSRLQIKPCPIRNFY 309
            RPNI QVL E+  +     PI + Y
Sbjct: 319 LRPNIYQVLSEICSILNVEVPIPDIY 344

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  305 bits (780), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 152/319 (47%), Positives = 204/319 (63%), Gaps = 11/319 (3%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEI---------SPPDPYTNAN 51
           M  P +  + PG I+ VG+H  ++I YL  GGFAQ+Y  +          +   P    +
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 52  IACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGV-AYEVFVLMEF 110
           +ACLKRV+V D+ GLN +R EV+ MK LK   +VV Y DS+A++  +GV  +EV +LME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 111 CERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNG 170
           C    L+D+MN RL  +L ESEI++IM   V  I+ MH L  PLIHRDIKIENVL+  N 
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 171 LYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWA 230
            +K+ DFGS S         Q+   +  +I  +TT QYRSPEMIDLYR LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 231 LGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQ 290
           LGIFLYK+ ++TTPFE +G+  ILH++Y++ P  +YS +L NLI +ML E P+ RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEF-PVNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 291 VLEEVSRLQIKPCPIRNFY 309
           VL  +  +     PI + Y
Sbjct: 313 VLYHLCEILNIEVPIEDKY 331

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  304 bits (779), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 156/318 (49%), Positives = 203/318 (63%), Gaps = 16/318 (5%)

Query: 9   YEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEI--------SPPD------PYTNANIAC 54
           Y  GT + VGSH  ++IKY+  GGFAQ+YT +         S P       P    +IAC
Sbjct: 99  YPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDIAC 158

Query: 55  LKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAA-KSVNGVAYEVFVLMEFCER 113
           LKRV+V D  GLN +R EV+ M+ L+    VV Y DS+A+ +S +   YEV +LMEFC  
Sbjct: 159 LKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFCPN 218

Query: 114 GGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYK 173
             L+D+MN RL  RL E EI++IM  T  GIA +H L+ PLIHRDIKIENVL+     +K
Sbjct: 219 NSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENNFK 278

Query: 174 VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGI 233
           +CDFGS S       N ++      +I  NTT QYRSPEMIDLYR  PIDEKSDIWALG+
Sbjct: 279 LCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWALGV 338

Query: 234 FLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLE 293
           FLYK+ ++TTPFE++G+  ILH++Y++P    YS +L NLI +ML E PS RPNI QVL+
Sbjct: 339 FLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQVLQ 397

Query: 294 EVSRLQIKPCPIRNFYLL 311
            +  +     P+ + Y L
Sbjct: 398 YLCSINGWKVPLNDKYGL 415

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  304 bits (779), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 155/311 (49%), Positives = 198/311 (63%), Gaps = 17/311 (5%)

Query: 6   ISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTA---EISPPDPYTNANI-------ACL 55
           +  +  G+ + VG+   +I+KYLT GGFAQ+Y     E S      N+NI       ACL
Sbjct: 22  VEKFANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIGDLACL 81

Query: 56  KRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGV-AYEVFVLMEFCERG 114
           KRV+V D+ GLN +R EV+ MKLLK   ++V Y DS+A++  +G   +EV +LME C   
Sbjct: 82  KRVLVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLMELCPNK 141

Query: 115 GLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKV 174
            L+DFMN RL  +L E EIL IM      +A MH L PPLIHRDIKIENVL+     +K+
Sbjct: 142 SLLDFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQNGFKL 201

Query: 175 CDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIF 234
            DFGS S         Q+   +  DI  +TT QYRSPEMIDLY+ LPIDEKSDIWALGIF
Sbjct: 202 ADFGSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIWALGIF 261

Query: 235 LYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEE 294
           LYK+ +Y TPFE +G+  ILH++Y +P    YS RL NLI +ML E P+ RPNI QVL E
Sbjct: 262 LYKLLFYITPFEMTGQFAILHSKYDFPQ-TNYSSRLINLIIIMLSENPNLRPNIYQVLHE 320

Query: 295 V-----SRLQI 300
           +     +RL+I
Sbjct: 321 ICSISGTRLEI 331

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  301 bits (770), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 201/316 (63%), Gaps = 11/316 (3%)

Query: 4   PQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTA---------EISPPDPYTNANIAC 54
           P +   + G+ + VG+H  +I+KYL  GGFA +Y           E +P         AC
Sbjct: 24  PVLERLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETAC 83

Query: 55  LKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGV-AYEVFVLMEFCER 113
           LKRV+V D+ GLN +R EV  MK L    ++V Y DSHA++S +GV  +EV +LME C  
Sbjct: 84  LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPN 143

Query: 114 GGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYK 173
             L+D+MN RL  +L E EIL+IM    + +A MH L  PLIHRD+KIENVL+  +  +K
Sbjct: 144 NSLLDYMNQRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFK 203

Query: 174 VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGI 233
           +CDFGS S  +      QE   + ++I  +TT QYRSPEMIDLYR LPIDEKSDIWALGI
Sbjct: 204 LCDFGSTSTCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGI 263

Query: 234 FLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLE 293
           FLYK+ +YTTPFE +G+  ILH++Y++ P   YS +L NLI +ML E P+ RPNI Q+++
Sbjct: 264 FLYKLLFYTTPFELTGQFAILHSKYEF-PINNYSSKLINLIIIMLAENPNLRPNIYQIMD 322

Query: 294 EVSRLQIKPCPIRNFY 309
            +  +     PI + Y
Sbjct: 323 NLCSIMKVENPIEDKY 338

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  303 bits (776), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 150/318 (47%), Positives = 202/318 (63%), Gaps = 11/318 (3%)

Query: 4   PQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEI---------SPPDPYTNANIAC 54
           P +  Y PGT++ VG+   +II ++  GGFAQ+Y+ +              P    +IAC
Sbjct: 17  PVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGDIAC 76

Query: 55  LKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNG-VAYEVFVLMEFCER 113
           LKRV+VPD+ GL+ +R EV+ MK L+  K ++ Y DS+A++  +G V YEV +LME C  
Sbjct: 77  LKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMELCPN 136

Query: 114 GGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYK 173
             L+D+MN RL  RL E EIL++M  T   I+ MH L  PLIHRDIKIENVL+     +K
Sbjct: 137 NSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQNNFK 196

Query: 174 VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGI 233
           +CDFGS S         Q+   +  +I  NTT QYRSPEMIDLYR LPI+EKSDIWALGI
Sbjct: 197 LCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWALGI 256

Query: 234 FLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLE 293
           FLYK+ ++ TPFE +G+  ILH++Y++P   +YS +L NLI +ML E P  RPNI QV+ 
Sbjct: 257 FLYKLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNIYQVMH 315

Query: 294 EVSRLQIKPCPIRNFYLL 311
            +  +     PI + Y L
Sbjct: 316 HICSVIGCEVPIEDKYGL 333

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  302 bits (774), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 151/319 (47%), Positives = 202/319 (63%), Gaps = 11/319 (3%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEI---------SPPDPYTNAN 51
           M  P +  Y PG I+ VG+H  +I+ YL  GGFAQ+Y  +          +   P    +
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 52  IACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGV-AYEVFVLMEF 110
           +ACLKRV+V D+ GLN +R EV+ MK LK   +VV Y DS+A++  +GV  +EV +LME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 111 CERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNG 170
           C    L+D+MN RL  +L ESEI++IM      I+ MH L  PLIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 171 LYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWA 230
            +K+ DFGS S         Q+   +  +I  +TT QYRSPEMIDLYR LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 231 LGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQ 290
           LGIFLYK+ ++TTPFE +G+  ILH++Y++ P  +YS +L NLI +ML E P+ RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEF-PVNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 291 VLEEVSRLQIKPCPIRNFY 309
           VL  +  +     PI + Y
Sbjct: 313 VLYHICDILNAEVPIEDKY 331

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  300 bits (769), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 202/319 (63%), Gaps = 11/319 (3%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEI---------SPPDPYTNAN 51
           M  P +  Y PG I+ VG+H  +I+ YL  GGFAQ+Y  +          +   P    +
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 52  IACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGV-AYEVFVLMEF 110
           +ACLKRV+V D+ GLN +R EV+ MK LK   +VV Y DS+A++  +GV  +EV +LME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 111 CERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNG 170
           C    L+D+MN RL  +L E+EI++IM      I+ MH L  PLIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 171 LYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWA 230
            +K+ DFGS S         Q+   +  +I  +TT QYRSPEMIDLYR LPI+EKSDIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 231 LGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQ 290
           LGIFLYK+ ++TTPFE +G+  ILH++Y++ P  +YS +L NLI +ML E P+ RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEF-PVNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 291 VLEEVSRLQIKPCPIRNFY 309
           VL  +  +     PI + Y
Sbjct: 313 VLCHLCDILNVEVPIEDKY 331

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  300 bits (768), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 150/317 (47%), Positives = 201/317 (63%), Gaps = 12/317 (3%)

Query: 4   PQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAE-ISPPDPYTN---------ANIA 53
           P    Y PGT + VG+H  +IIKY+  GGFAQ+Y  + I   + + N          ++A
Sbjct: 17  PNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVA 76

Query: 54  CLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGV-AYEVFVLMEFCE 112
           CLKRV+V D+ GLN +R EV+ MK L+   ++V Y DS+A++  NG   +EV +LME C 
Sbjct: 77  CLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCP 136

Query: 113 RGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLY 172
              L+D+MN RL  +L E EIL+IM      ++ MH L  PL+HRDIKIENVL+     +
Sbjct: 137 NKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNF 196

Query: 173 KVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALG 232
           K+CDFGS S         Q+   +  +I  +TT QYRSPEMIDLYR LPIDEKSDIWALG
Sbjct: 197 KLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALG 256

Query: 233 IFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVL 292
           IFLYK+ ++TTPFE +G+  ILH++Y++P    YS +L NLI +ML E P+ RPNI QVL
Sbjct: 257 IFLYKLLFFTTPFELTGQFAILHSKYEFPK-NNYSSKLINLIIIMLAENPNLRPNIYQVL 315

Query: 293 EEVSRLQIKPCPIRNFY 309
             +  +     PI + Y
Sbjct: 316 HNICSISGMKVPIEDQY 332

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  294 bits (753), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 202/319 (63%), Gaps = 12/319 (3%)

Query: 4   PQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNA----------NIA 53
           P   L  P T + VG+H  +I+++L  GGFA +Y  +        +A          +IA
Sbjct: 24  PNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIA 83

Query: 54  CLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGV-AYEVFVLMEFCE 112
           CLKRVIVPD+ GLN LR EV+ MK L+ + ++V Y DS+A++  +G   +E+ +LME C 
Sbjct: 84  CLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCP 143

Query: 113 RGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLY 172
           +  L+D+MN +L  +L E+EIL+IM      IA MH L  PLIHRDIKIENVL+  +  +
Sbjct: 144 KKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNF 203

Query: 173 KVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALG 232
           K+CDFGS S         Q+   + ++I  +TT QYRSPEMIDLYR LPI+EKSDIWALG
Sbjct: 204 KLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 263

Query: 233 IFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVL 292
           IFLYK+ +YTTPFE +G+  ILH++Y+ P    YS +L NLI +ML E PS RPNI QV+
Sbjct: 264 IFLYKLLFYTTPFELTGQFAILHSKYEIPQ-NGYSSKLINLIIIMLAENPSLRPNIYQVM 322

Query: 293 EEVSRLQIKPCPIRNFYLL 311
             V  +     P  + Y L
Sbjct: 323 HHVCSILKCDVPFTDKYEL 341

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  295 bits (756), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 196/310 (63%), Gaps = 16/310 (5%)

Query: 12  GTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTN-----------ANIACLKRVIV 60
           G+IL VG H  +II+YL  GGFA +Y         YTN            +IACLKRV V
Sbjct: 31  GSILLVGVHRVEIIEYLAEGGFAHIYKVSFIE---YTNELDRHHSVLQRGDIACLKRVQV 87

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGV-AYEVFVLMEFCERGGLIDF 119
            D+ GLN LR EV+ MK LK   +VV Y DS+A++  +G   +EV +LME C  G L+D+
Sbjct: 88  NDENGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLLDY 147

Query: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179
           MN RL  +L E E+L+IM    +GI+ MH L+ PLIHRDIKIENVL+     +K+CDFGS
Sbjct: 148 MNQRLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDFGS 207

Query: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239
            S  +      QE   + ++I  +TT QYRSPEMIDLYR L I+EKSDIWALGIFLYK+ 
Sbjct: 208 TSTCLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLYKLL 267

Query: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299
           +YTTPFE +G+  ILH++Y  P    +S +L NLI +ML E P  RPNI Q+L  +  + 
Sbjct: 268 FYTTPFELTGQFAILHSKYDIPQN-NFSSKLINLIIVMLAENPYIRPNIYQILYHICSIM 326

Query: 300 IKPCPIRNFY 309
               PI + Y
Sbjct: 327 ECDVPIEDHY 336

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  296 bits (758), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 154/358 (43%), Positives = 219/358 (61%), Gaps = 12/358 (3%)

Query: 4   PQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTA---------EISPPDPYTNANIAC 54
           P +   + G+ + VG+H  +I+KYL  GGFA +Y           E  P       ++AC
Sbjct: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125

Query: 55  LKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVA-YEVFVLMEFCER 113
           LKRV+V D+ GLN +R EV  MK L    ++V Y DSHA+++ +G + +EV +LME C  
Sbjct: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185

Query: 114 GGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYK 173
             L+D+MN RL  +L E EIL+IM    + +A MH L  PLIHRD+KIENVL+  N  +K
Sbjct: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245

Query: 174 VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGI 233
           +CDFGS S         QE   + ++I  +TT QYRSPEMIDLYR LPI+EKSDIWALGI
Sbjct: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305

Query: 234 FLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLE 293
           FLYK+ +YTTPFE +G+  ILH++Y++ P   YS +L NLI +ML E P+ RPNI QV++
Sbjct: 306 FLYKLLFYTTPFELTGQFAILHSKYEF-PVNNYSSKLINLIIIMLAENPNLRPNIYQVMD 364

Query: 294 EVSRLQIKPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQKFLPAQGLQSMKPISNMI 351
            +  +     P+ + Y L + S   + +     ++ V  Q +L  +  Q +  +++M 
Sbjct: 365 NLCSILKVKNPLEDKYQLGSYS-FEKYSQYQAKLQKVQYQMYLAYENKQQIDTLNDMF 421

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  297 bits (760), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 146/319 (45%), Positives = 201/319 (63%), Gaps = 11/319 (3%)

Query: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEI---------SPPDPYTNAN 51
           M  P +  Y PG I+ VG+H  +++ YL  GGFAQ+Y  +          +   P    +
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 52  IACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGV-AYEVFVLMEF 110
           +ACLKRV+V D+ GLN +R EV+ MK LK   ++V Y DS+A++  +GV  +EV +LME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 111 CERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNG 170
           C    L+D+MN RL  +L E+EI++IM      I+ MH L   LIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 171 LYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWA 230
            +K+ DFGS S         Q+   +  +I  +TT QYRSPEMIDLYR LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 231 LGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQ 290
           LG+FLYK+ ++TTPFE +G+  ILH++Y++ P  +YS +L NLI +ML E P+ RPNI Q
Sbjct: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEF-PVNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 291 VLEEVSRLQIKPCPIRNFY 309
           VL  +  +     PI + Y
Sbjct: 313 VLYHLCEILNVEVPIEDKY 331

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  294 bits (752), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 150/328 (45%), Positives = 205/328 (62%), Gaps = 23/328 (7%)

Query: 2   NAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTA-------EISPPDPYTN----- 49
           N   I  +E G  L VG+H  +I+ YLT GGFAQ+Y         E    D  +N     
Sbjct: 24  NVGTIEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISN 83

Query: 50  -----ANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGV-AYE 103
                 ++ACLKRV+V D+ GLN +R EV+ MK L+   ++V Y DS+A +S NG   YE
Sbjct: 84  YSLKLGDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYE 143

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           V +LME C    L+++MN RL  +L E E+L+IM     G+A MH L+ PLIHRDIKIEN
Sbjct: 144 VLLLMELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIEN 203

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNT--QEFNYVQHDILTNTTAQYRSPEMIDLYRGLP 221
           VL+  N  +K+CDFGS +    PP  T  Q+   +  ++  +TT QYRSPEMIDLYR LP
Sbjct: 204 VLVDSNNNFKLCDFGSATTC--PPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLP 261

Query: 222 IDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMET 281
           I+EKSDIWALG+FLYK+ +YTTPFE +G+  +LH+++  P   +YS ++ NL+ +ML E 
Sbjct: 262 INEKSDIWALGVFLYKLLFYTTPFETTGQFAMLHSKFDIPA-NKYSSKIINLVIIMLSEN 320

Query: 282 PSKRPNICQVLEEVSRLQIKPCPIRNFY 309
            + RPNI QV+  + +L     PI + Y
Sbjct: 321 LNLRPNIYQVMHYICQLIQVDTPILDIY 348

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  295 bits (756), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 150/321 (46%), Positives = 195/321 (60%), Gaps = 38/321 (11%)

Query: 6   ISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTN---------------- 49
           I  Y+ GTILTVG    +I+KYLT GGFAQ+YT        Y N                
Sbjct: 37  IEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIE---YLNEFDNDDAENDNNSRNL 93

Query: 50  --ANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAK------------ 95
              ++ACLKRV+VPD+ GL+ +R EVD MK L N  ++V Y DS+A+K            
Sbjct: 94  KIGDVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTTNN 153

Query: 96  ----SVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQ 151
                   + +E+ +LME+C    L+DFMN RL  +L E+EIL+ M+     +  MH L 
Sbjct: 154 NDNNKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHYLA 213

Query: 152 PPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSP 211
            PLIHRDIKIENVL+  N  +K+ DFGS + +  P    Q+   +  DI  NTT QYRSP
Sbjct: 214 QPLIHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYRSP 273

Query: 212 EMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLK 271
           EMIDLY+ LPIDEKSDIWALG+ LYK+ +YTTPFE +G+  ILH++Y++P    YS +  
Sbjct: 274 EMIDLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPA-NNYSSKFI 332

Query: 272 NLIRLMLMETPSKRPNICQVL 292
           NLI +ML E P+ RPNI QVL
Sbjct: 333 NLIIIMLAENPNLRPNIFQVL 353

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  295 bits (755), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 150/326 (46%), Positives = 202/326 (61%), Gaps = 26/326 (7%)

Query: 9   YEPGTILTVGSHHAKIIKYLTSGGFAQVY----------------------TAEISPPDP 46
           +  GT + VGSH  +IIKY+  GGFAQ+Y                      + +   P+P
Sbjct: 24  FPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAPNP 83

Query: 47  YTN--ANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVA-YE 103
                 +IACLKRV+V D+ GLN +R EV+ MK LK   +VV Y DS+A++  NG + +E
Sbjct: 84  MILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASGFE 143

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           V +LME C    L+D+MN RL  +L E EIL+IM      ++ MH L+ PL+HRDIKIEN
Sbjct: 144 VLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKIEN 203

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPID 223
           VL+     +K+CDFGS S  +      Q+   +  +I  +TT QYRSPEMIDLYR LPID
Sbjct: 204 VLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPID 263

Query: 224 EKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPS 283
           EKSDIWALGIFLYK+ ++ TPFE +G+  ILH++Y++P    YS +L NLI +ML E P+
Sbjct: 264 EKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPK-NNYSSKLINLIIIMLAENPN 322

Query: 284 KRPNICQVLEEVSRLQIKPCPIRNFY 309
            RPNI QVL+ +  +     PI + Y
Sbjct: 323 LRPNIYQVLDNICSMMNVEVPIEDIY 348

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  293 bits (751), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 197/316 (62%), Gaps = 11/316 (3%)

Query: 4   PQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTA---------EISPPDPYTNANIAC 54
           P +  + PG ++ VG+H  +++ YL  GGFAQ+Y           E     P    ++AC
Sbjct: 17  PTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVAC 76

Query: 55  LKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVA-YEVFVLMEFCER 113
           LKRV+V D+ GL+ +R EV+ MK L   +++V Y DS+A +  NG A +EV +LME C  
Sbjct: 77  LKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPN 136

Query: 114 GGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYK 173
             L+D+MN RL  +L E EIL+IM      ++ MH L+ PLIHRDIKIENVL+     +K
Sbjct: 137 KSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFK 196

Query: 174 VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGI 233
           +CDFGS S         QE   +  +I  +TT QYR PEMIDLYR LPI+EKSDIWALGI
Sbjct: 197 LCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGI 256

Query: 234 FLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLE 293
           FLYK+ ++ TPFE +G+  ILH++Y++PP   YS +L NLI +ML E P  RPNI QVL 
Sbjct: 257 FLYKLLFFITPFEMTGQFAILHSKYEFPPN-HYSSQLINLIIIMLAENPFVRPNIYQVLN 315

Query: 294 EVSRLQIKPCPIRNFY 309
            +  +     PI + Y
Sbjct: 316 HICTMIGVEVPIEDKY 331

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  287 bits (734), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 198/316 (62%), Gaps = 11/316 (3%)

Query: 6   ISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTA---------EISPPDPYTNANIACLK 56
           I  Y PG I+ VG H  +IIKYL  GGFA++Y A         +I+        ++ CLK
Sbjct: 96  IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLK 155

Query: 57  RVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVA-YEVFVLMEFCERGG 115
           RV+V D  GLN +R EV  MK L    ++V   DS+A++  +G+A YEV +LME C    
Sbjct: 156 RVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKS 215

Query: 116 LIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVC 175
           L+D+MN RL  +L E EIL+IM      +A MH L  PLIHRDIKIENVL+     +K+C
Sbjct: 216 LLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLC 275

Query: 176 DFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFL 235
           DFGS S  +      ++   +  ++  +TT QYRSPEMID+YR + I+EKSDIWALGIFL
Sbjct: 276 DFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFL 335

Query: 236 YKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEV 295
           YK+ +Y TPFE++G+  ILH++Y++P    YS +L NLI +ML E P+ RPNI QVL  +
Sbjct: 336 YKLLFYITPFERTGQFAILHSKYEFPQH-SYSMKLINLIIIMLAENPNLRPNIYQVLAYI 394

Query: 296 SRLQIKPCPIRNFYLL 311
            ++     PI + Y L
Sbjct: 395 CKIINIKTPIDDIYGL 410

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  293 bits (750), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 143/316 (45%), Positives = 203/316 (64%), Gaps = 13/316 (4%)

Query: 6   ISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAE-ISPPDPYTN----------ANIAC 54
           I  Y+PG +++VG+H  KI  YL  GGFAQ+Y  + I   + + N           +IAC
Sbjct: 32  IEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIAC 91

Query: 55  LKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGV-AYEVFVLMEFCER 113
           LKRV+V D+ GLN +R EV+ MKLL+   ++V Y DS+A +  +G+  YE+ +LME C  
Sbjct: 92  LKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPN 151

Query: 114 GGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYK 173
             L+D+MN RL+ +L E+EI++IM  T   ++ MH L  PLIH+DIK+EN+L+  N  +K
Sbjct: 152 NSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFK 211

Query: 174 VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGI 233
           +CDFGS S       +  +   +  +I  +TT QYRSPEMIDLYR LPI+E SDIWALG+
Sbjct: 212 LCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGV 271

Query: 234 FLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLE 293
           FLYK+ ++ TPFE++G+  ILHA++   P   Y  +L NLI +ML E  + RPNI QV+ 
Sbjct: 272 FLYKLLFFITPFERTGQFSILHAKFDI-PVNNYHPKLINLIIIMLSENLNLRPNIYQVMY 330

Query: 294 EVSRLQIKPCPIRNFY 309
           E+  +   P PI + Y
Sbjct: 331 EICSITNTPLPIEDKY 346

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  288 bits (737), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 147/328 (44%), Positives = 206/328 (62%), Gaps = 23/328 (7%)

Query: 4   PQISLYEP-GTILTVGSHHAKIIKYLTSGGFAQVYTAEI-------------SPPDPYTN 49
           PQI    P G ++TVGSH  +++ YL  GGFAQ+Y  +              S   P   
Sbjct: 90  PQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKP 149

Query: 50  ANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAK--SVNG---VAYEV 104
            + ACLKRV+V D+ GLN +R+EV+ MK L+   ++V Y DS+A++    +G     +EV
Sbjct: 150 GSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEV 209

Query: 105 FVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENV 164
            +LME C    L+D+MN RL  +L E EI +IM      +A MH L  PLIHRDIKIENV
Sbjct: 210 LLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENV 269

Query: 165 LISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDE 224
           L+  N  +K+CDFGS S       + Q+   +  D+  +TT QYRSPEMIDL++ +PI+E
Sbjct: 270 LVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINE 329

Query: 225 KSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSK 284
           KSDIWALG+FLYK+ ++TTPFE++G+  +LH+++++PP   YS +L NLI +ML E PS 
Sbjct: 330 KSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPP-NSYSSKLINLIIVMLAENPSL 388

Query: 285 RPNICQV---LEEVSRLQIKPCPIRNFY 309
           RPNI QV   L EV+  ++ P  + + Y
Sbjct: 389 RPNIYQVLYYLSEVTNREVPPTVLSDKY 416

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  285 bits (728), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 143/316 (45%), Positives = 199/316 (62%), Gaps = 16/316 (5%)

Query: 6   ISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTN-----------ANIAC 54
           + + + G+ + VG H  ++I+YL  GGFA +Y         YTN            +  C
Sbjct: 26  LEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVG---YTNELDRQDRILQPGDTVC 82

Query: 55  LKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGV-AYEVFVLMEFCER 113
           LKRV V D+ GLN LR EV+ MK L+N  ++V Y DS+A++  +G   YEV +LME C  
Sbjct: 83  LKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPN 142

Query: 114 GGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYK 173
           G L+D+MN RL  +L E+E+L+IM     G++ MH  + PLIHRDIKIENVL+  +  +K
Sbjct: 143 GSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFK 202

Query: 174 VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGI 233
           +CDFGS S  +    + QE   + ++I  +TT QYRSPEMIDLYR LPI+EKSDIWALGI
Sbjct: 203 LCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 262

Query: 234 FLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLE 293
           FLYK+ +YTTPFE +G+  ILH++Y+  P   +S +L NL+ +ML E P  RPN+ QV+ 
Sbjct: 263 FLYKLLFYTTPFELTGQFAILHSKYEI-PRNSFSSKLINLVIIMLAENPYLRPNVYQVMY 321

Query: 294 EVSRLQIKPCPIRNFY 309
            +  +      I + Y
Sbjct: 322 HICSMMECEVKIDDLY 337

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 120/241 (49%), Gaps = 37/241 (15%)

Query: 68  TLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNR 127
           T+  E++  KL+  +K+++S ID     +       +++++E C  G L D +  R +  
Sbjct: 95  TILKEIEIHKLVNGHKNIISMIDHFEIDAT------MYMVLELCGAGSLYDII-CRSKRS 147

Query: 128 LRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPP 187
           LRE E   +M Q    +  +H  +  ++H D+K+ N+LI  +   ++CDFG         
Sbjct: 148 LREWEAKRLMIQLCGAVDWIH--EKNIVHADLKLSNILIDSSNNLQLCDFGH-------- 197

Query: 188 RNTQEFNYVQHDILTNT-----TAQYRSPEMIDLY-----RGLPIDEKSDIWALGIFLYK 237
                 ++V  DI  N+     T  Y SPE+I  +     + L   ++SDIW++GI LY 
Sbjct: 198 ------SFVSTDIDNNSINKFGTPNYLSPEIISNFILSDKKDLYFPKESDIWSIGIVLYA 251

Query: 238 ICYYTTPFE----KSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLE 293
           + +  TPFE    +S    I+  +Y +    + S+++K LI+ +L   P +R  I +++ 
Sbjct: 252 MIFDKTPFEATTLRSTYENIVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVEIVS 311

Query: 294 E 294
           +
Sbjct: 312 D 312

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 92.0 bits (227), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 81/345 (23%), Positives = 148/345 (42%), Gaps = 60/345 (17%)

Query: 13  TILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIAC-----LKRVIVPDKQGLN 67
           T + V     KI + L  GG + VY  ++          +A      LK++I P+ + ++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESIS 80

Query: 68  TLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRL--Q 125
               E++  K  ++  +V+  IDS   +  +G +  +++++ F   G L D +N RL   
Sbjct: 81  NGMREIENYKRFQS-PYVIQSIDSQVMQEKDG-SKSIYIILPFYTLGSLQDSINRRLLEG 138

Query: 126 NRLRESEILEIMSQTVQGIAAMHA---------------------------------LQP 152
             + E+E + IM   ++G+  +H                                  L+ 
Sbjct: 139 TFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLEM 198

Query: 153 PLI-----------HRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDIL 201
            ++           HRDI   N+L S +GL  + D GS S       N  +   +Q  + 
Sbjct: 199 DMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWVN 258

Query: 202 TNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGE---AGILHA-- 256
            N T  Y +PE++ L     +D K DIW+LG   Y + +  +PFE+  +   A I +A  
Sbjct: 259 DNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAIN 318

Query: 257 --RYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299
             +Y +P   ++S+ L ++I+  +   P +RP   Q+L  +  L+
Sbjct: 319 TGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLLNILQDLE 363

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 93.6 bits (231), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 103/195 (52%), Gaps = 16/195 (8%)

Query: 102 YEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKI 161
           Y ++++ME+C  G   D + T  +  L E+++  ++   + G+  +HA     IHRDIK 
Sbjct: 85  YLMWIVMEYCGGGSARDLIKTCYREGLAENKVAFVVKSVLLGLQYLHAQHK--IHRDIKA 142

Query: 162 ENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLP 221
            N+L++ +GL KV DFG VS  +R     + F           T  + +PE++ +  G+ 
Sbjct: 143 ANILLTDSGLVKVADFG-VSAEMRSTMKAKTF---------VGTPYWMAPEVV-MNEGMG 191

Query: 222 IDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL-HARYQYPP--FPQYSDRLKNLIRLML 278
            +EKSDIW+LGI  Y++     P  K     ++ +   + PP     Y++ +K+ I   L
Sbjct: 192 YNEKSDIWSLGITTYELLKGVPPLAKYDAIRVMRNIPKRKPPKLHGAYTNLVKHFIATCL 251

Query: 279 METPSKRPNICQVLE 293
           ++ P KRP+  ++LE
Sbjct: 252 IKDPEKRPSASELLE 266

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 136/292 (46%), Gaps = 47/292 (16%)

Query: 9   YEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVI-VPDKQGLN 67
           +    ++ +G++  KI+K +  G F +VY A         N  +   K V+   +K   N
Sbjct: 26  FSSNELVDIGNY--KIVKLIGEGSFGKVYLA---------NHRLTHQKVVLKTGNKNDPN 74

Query: 68  TLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNR 127
            +R EV   +   +  H+    +    +S      +V++ +E+C    L +++   +Q+R
Sbjct: 75  VVR-EVFYHRQF-DFPHITKLYEVIVTES------KVWMALEYCPGKELYEYL--LMQHR 124

Query: 128 LRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPP 187
           +   E  ++ +Q V  +   H+LQ   +HRD+K+EN+L+   G  K+ DFG         
Sbjct: 125 ISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLENILLDKKGRAKITDFGFTRECATK- 181

Query: 188 RNTQEFNYVQHDILTNTTAQYRSPEMIDL--YRGLPIDEKSDIWALGIFLYKICYYTTPF 245
                      + +  TT  Y +PE+I+   Y G  I    DIW+LG+ LY + + T PF
Sbjct: 182 --------TMLETVCGTTV-YMAPELIERKSYDGFKI----DIWSLGVILYTMIHGTMPF 228

Query: 246 EKSGEAGILHARYQYPPFPQYSDRL-----KNLIRLMLMETPSKRPNICQVL 292
           ++  E           PF  Y+D +     K+LI  +L + PS+RP + QVL
Sbjct: 229 DEEDETKTKWKIINEEPF--YNDDVVSKDAKDLISQLLCKDPSQRPQLSQVL 278

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 89.0 bits (219), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 76/332 (22%), Positives = 144/332 (43%), Gaps = 60/332 (18%)

Query: 13  TILTVGSHHAKIIKYLTSGGFAQVYTAEI-----SPPDPYTNANIACLKRVIVPDKQGLN 67
           T + V     KI + L  GG + VY  ++     S  +    A +  LK++I P  + ++
Sbjct: 21  TTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENIS 80

Query: 68  TLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRL--Q 125
               E++  K  ++  +V+  IDS   +  +G +  +++++ +   G L D +N RL   
Sbjct: 81  NGMREIENYKRFQS-PYVIQSIDSQVMQEKDG-SKTIYIILPYYSLGSLQDSINRRLLEG 138

Query: 126 NRLRESEILEIMSQTVQGIAAMHA---------------------------------LQP 152
             + E+E + IM    +G+  +H                                  L+ 
Sbjct: 139 TFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLEM 198

Query: 153 PLI-----------HRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDIL 201
            ++           HRDI   N+L S +GL  + D GS S       N  + + +Q  + 
Sbjct: 199 DMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWVN 258

Query: 202 TNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGE---AGILHA-- 256
            N T  Y +PE+++L     +  K DIW++G   Y + +  +PFE+  +   A + +A  
Sbjct: 259 DNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAIN 318

Query: 257 --RYQYPPFPQYSDRLKNLIRLMLMETPSKRP 286
             +Y +P   ++S+RL ++I+  +   P +RP
Sbjct: 319 TGKYSFPRNSRFSERLLDVIKRCIQVDPIQRP 350

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 90.5 bits (223), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 107/233 (45%), Gaps = 30/233 (12%)

Query: 66   LNTLRAEVDAMKLLK--NNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMN-T 122
            L T+ +E+  M  L   +NK+++S +D         V   V        + G ID  +  
Sbjct: 1049 LGTIPSEIQIMSTLNKTSNKNILSILDFFEDDDYYYVEQPVH------GKTGCIDLFDLI 1102

Query: 123  RLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSG 182
              +  + E E   I  Q + GI+ +H  +  ++HRDIK ENV++   G  K+ DFGS + 
Sbjct: 1103 EFKTNMTEFEAKLIFKQIISGISHLH--ESGIVHRDIKDENVIVDAKGFVKLIDFGSAAY 1160

Query: 183  VIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIWALGIFLYKICY 240
            V   P           D+   T   Y SPE++  + Y G P     DIWALGI LY I +
Sbjct: 1161 VKNGP----------FDVFVGTI-DYASPEVLRGEKYEGKP----QDIWALGILLYTIVF 1205

Query: 241  YTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLE 293
               PF    E  IL    ++P     S    +LI+L+L  +  +RP+I  + E
Sbjct: 1206 KENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSITDISE 1256

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 78/269 (28%), Positives = 123/269 (45%), Gaps = 34/269 (12%)

Query: 31  GGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQG--LNTLRAEVDAMKLLKNNKHVVSY 88
           G F  VY         Y   N  C  +V+  D     +  ++ EV  +  LK   ++  Y
Sbjct: 28  GKFGIVYKGY------YIKTNRVCAIKVLNLDSADDEVEDVQKEVQFLSSLKQVPNITHY 81

Query: 89  IDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMH 148
             S+   +      E++V+ME+C  G L   +      ++ E  I  IM + +  IA MH
Sbjct: 82  YGSYLNNT------ELWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRELL--IALMH 130

Query: 149 ALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQY 208
             +  +IHRDIK  NVLI+++G  K+CDFG  + + +     Q             T  +
Sbjct: 131 IHKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTM---------AGTPYW 181

Query: 209 RSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF--EKSGEAGILHARYQYPPFP-- 264
            +PE+I    G+  D K DIW+LGI  Y+I     P+   ++  A  L  + + P     
Sbjct: 182 MAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGR 239

Query: 265 QYSDRLKNLIRLMLMETPSKRPNICQVLE 293
           Q+S  LK  I L L E P +RP+  ++L+
Sbjct: 240 QHSSALKEFIALCLDEDPKERPSAEELLK 268

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/336 (23%), Positives = 137/336 (40%), Gaps = 60/336 (17%)

Query: 13  TILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAE 72
           + +++     +I K L  GG + VY  E    + +       LK+   P      ++ + 
Sbjct: 17  SFVSINGRKYRIQKLLGEGGLSFVYLVESKEGELFA------LKKTRCP----FGSIGSI 66

Query: 73  VDAMKLLKNNK-----HVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQN- 126
             AMK + N +     ++   +DS   +  +G +  V+VL+ +  +G L D +N  L + 
Sbjct: 67  SPAMKEVANYQRFSSPYIAQIVDSQVVQEKDG-SKTVYVLLPYFAKGSLQDLINRHLLDC 125

Query: 127 -RLRESEILEIMSQTVQGIAAMHALQP--------------------------------- 152
            ++ E +IL +     +G+  +H   P                                 
Sbjct: 126 TQMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGES 185

Query: 153 --PLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRS 210
                HRD+K  N++IS   L  + D GS S       + Q     Q     N T  Y +
Sbjct: 186 QQSYAHRDVKPSNIMISPEDLPVISDLGSCSRARIDINSRQALLRFQEWSSDNCTLSYAA 245

Query: 211 PEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEK----SGEA---GILHARYQYPPF 263
           PE++D+     I EK DIW+ G  +Y +C+  +PFE+    SG +    I   +Y  P  
Sbjct: 246 PEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPRG 305

Query: 264 PQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299
             YS  L  LI   L   P +RP++ +++  +  LQ
Sbjct: 306 TSYSSSLIELIGKCLSVNPEQRPSVNELIALLMELQ 341

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 82/180 (45%), Gaps = 22/180 (12%)

Query: 115  GLIDFMN-TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYK 173
            G ID  +   L+N + E E+  I  Q V GI  +H     +IHRDIK ENV++   G  K
Sbjct: 1272 GCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATGFVK 1329

Query: 174  VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIWAL 231
            + DFGS + V   P           D+   T   Y +PE++  D Y G P     DIWA+
Sbjct: 1330 LIDFGSAAHVKSGP----------FDVFVGTI-DYAAPEVLSGDPYEGKP----QDIWAI 1374

Query: 232  GIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQV 291
            GI LY I +   PF    E  IL     +      S   K LI ++L     KRP I  +
Sbjct: 1375 GILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTIDDI 1432

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/193 (31%), Positives = 100/193 (51%), Gaps = 16/193 (8%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           ++++ME+C  G   D +       + ES++  I+  TV+G+  +H  +   IHRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHDQKK--IHRDIKAAN 143

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPID 223
           +L++  G  K+ DFG VSG IR       F           T  + +PE+I+  +    +
Sbjct: 144 ILLTDCGKVKLGDFG-VSGQIRATMKRGTF---------VGTPYWMAPEVIN-KQCKGYN 192

Query: 224 EKSDIWALGIFLYKICYYTTPFEKSGEAGI-LHARYQYPP--FPQYSDRLKNLIRLMLME 280
           EK+DIW+LGI  Y++     P  K     + L+   + PP    QYS++ K  + L L++
Sbjct: 193 EKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPKRKPPKLHGQYSEKAKYFVSLCLIK 252

Query: 281 TPSKRPNICQVLE 293
            P +RP+I  +LE
Sbjct: 253 DPKQRPSIEALLE 265

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 87.0 bits (214), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 133/300 (44%), Gaps = 57/300 (19%)

Query: 55  LKRVIVP--DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCE 112
           LKR+  P  + + ++    EVD  K  ++  ++++ +DS   +  +G +  + +L+ +  
Sbjct: 73  LKRIRCPFGNIESISAAMKEVDNYKRFQS-PYIITLVDSQVVQEKDG-SKTLCILLPYFP 130

Query: 113 RGGLIDFMNTRL--QNRLRESEILEIMSQTVQGIAAMH-----------------ALQ-- 151
            G L D +N  L     + E+E + IM    +G+  +H                 +L   
Sbjct: 131 LGSLQDMVNRNLLKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSYS 190

Query: 152 ---------PPL----------------IHRDIKIENVLISHNGLYKVCDFGSVSGVIRP 186
                     PL                +HRDI++ N+L S  GL  V D GS       
Sbjct: 191 DEAAFLLDDTPLELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADIT 250

Query: 187 PRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFE 246
                + N +Q  +  N +  Y +PE++++     ID K+DIW++G   Y + +  +PFE
Sbjct: 251 VSTKHQLNELQDWVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPFE 310

Query: 247 K----SGEA---GILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299
           +    SG +    I   +Y +P   +YS+ L  +I+  L   P+ RP+I ++L+ +  LQ
Sbjct: 311 RELQVSGASLTYAIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDLQ 370

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 62/214 (28%), Positives = 104/214 (48%), Gaps = 24/214 (11%)

Query: 84  HVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQG 143
           H+V ++D    +        V++L+E C  G L+D +  R    L E+E+  + +Q    
Sbjct: 151 HIVKFMDCFEDE------LNVYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVCGA 202

Query: 144 IAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTN 203
           I  MH+    +IHRD+K+ NV    N   K+ DFG  + +     N  E  Y        
Sbjct: 203 INYMHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLAATL----SNVSEKKYTMCG---- 252

Query: 204 TTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILH----ARYQ 259
            T  Y +PE+I L + +    ++DIW+LGI +Y +     PF+      I       +Y+
Sbjct: 253 -TPNYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLCQYE 310

Query: 260 YPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLE 293
           +PP    ++ +K LI+ +L+  PS+RP I  +L+
Sbjct: 311 FPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 60/179 (33%), Positives = 87/179 (48%), Gaps = 20/179 (11%)

Query: 115  GLIDFMN-TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYK 173
            G ID  +   L+  + E E   I  Q V  I  +H+    ++HRDIK ENV++   G  K
Sbjct: 1094 GCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLHS--QGIVHRDIKDENVVVDSKGFVK 1151

Query: 174  VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEK-SDIWALG 232
            + DFGS + V   P           D+   T   Y +PE++    G P D K  DIWA+G
Sbjct: 1152 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVL---SGEPFDGKPQDIWAIG 1197

Query: 233  IFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQV 291
            + LY I +   PF    E  IL    ++      S+   NLI+++L + PS+RP I +V
Sbjct: 1198 VLLYTIVFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTIDEV 1254

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 85.9 bits (211), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 84/351 (23%), Positives = 151/351 (43%), Gaps = 72/351 (20%)

Query: 13  TILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVP--DKQGLNTLR 70
           ++L  G H+A I + L  GGF+ VY  +        N ++  LK++  P  + + ++   
Sbjct: 20  SVLINGQHYA-IQRLLGEGGFSFVYLVQ-----SRENNDLFALKKIHCPFGNIESVSEAM 73

Query: 71  AEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLID------------ 118
            EV++ K  ++  ++   + S   +  +G +  VF+L+ +   G L+D            
Sbjct: 74  REVNSYKKFRS-PYITHCVSSQVLQEQDG-SKTVFILLPYFPTGSLLDKINTHLLDGTTI 131

Query: 119 ---------------------------------FMNTRLQNR----LRESEILEIMSQTV 141
                                             +NT LQ R    +  +E L +++ ++
Sbjct: 132 SEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLNDSL 191

Query: 142 Q------GIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNY 195
           +        ++  A      H+DIK  N++ S +GL  +CD GS S       +  +   
Sbjct: 192 ELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQLVE 251

Query: 196 VQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEK----SGEA 251
            Q     + T  +RSPE++++     IDEK DIW+LG  LY +C+  +PFE+    SG +
Sbjct: 252 FQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSGAS 311

Query: 252 ---GILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299
               I   ++  PP   YS  L  +I+  +     KRP+I ++L  +  LQ
Sbjct: 312 MTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQ 362

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 83/285 (29%), Positives = 135/285 (47%), Gaps = 49/285 (17%)

Query: 17  VGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV--PDKQGLNTLRAEVD 74
           VG++  KI+K +  G F +VY A   P            K+V++   DK   N +R    
Sbjct: 36  VGNY--KILKQIGEGSFGKVYLALHKP----------THKKVVLKSSDKTDPNVVR---- 79

Query: 75  AMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEIL 134
             ++  + +    YI       V     +V++++E+C    L D++ ++ +  L ES   
Sbjct: 80  --EIFYHRQFDFPYIT--KLYEVIITETKVWMVIEYCPNKELYDYLLSKKRISLDES--A 133

Query: 135 EIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFN 194
            I +Q V  +   H+L    +HRD+K+EN+L+  +   K+ DFG           T++F+
Sbjct: 134 RIFAQIVGAVYYAHSLS--CVHRDLKLENILLDKDNNAKLTDFGF----------TRDFS 181

Query: 195 Y-VQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIWALGIFLYKICYYTTPFE----K 247
              Q + +  TT  Y +PE++  + Y G  I    DIWALGI LY I   T PF+    K
Sbjct: 182 KNTQLETICGTTV-YMAPELLRREKYDGYKI----DIWALGILLYTIINGTMPFDEDDPK 236

Query: 248 SGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVL 292
             E  I+ A   Y     ++D   +L+  +L + PS RP I Q+L
Sbjct: 237 KTELKIISASPDYDN-KYFNDDSIDLVNRLLSKDPSMRPTIEQIL 280

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 61/180 (33%), Positives = 87/180 (48%), Gaps = 22/180 (12%)

Query: 115  GLIDFMN-TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYK 173
            G ID  +   ++  + E E + I  Q   GI  +H     ++HRDIK ENV++  NG  K
Sbjct: 1045 GSIDLFDLIEMKTDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVK 1102

Query: 174  VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIWAL 231
            + DFGS + V   P           D+   T   Y +PE++  + Y G P     DIWA+
Sbjct: 1103 IVDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAI 1147

Query: 232  GIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQV 291
            G+ LY I Y   PF    E  IL A  +     + SD    LIR +L  + SKRP+I ++
Sbjct: 1148 GVLLYTIIYKENPFYNIDE--ILDADLRVNSSERISDDCIALIRKILNRSVSKRPSIDEI 1205

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 84.7 bits (208), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 75/328 (22%), Positives = 137/328 (41%), Gaps = 60/328 (18%)

Query: 17  VGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIA-----CLKRVIVPDKQGLNTLRA 71
           V     +I + L  GG + VY  ++S      +  IA      LK++I P  + ++    
Sbjct: 25  VNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISNGMR 84

Query: 72  EVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRL--QNRLR 129
           E++  K  ++  +V+  IDS   +  +G +  +++++ +   G L D +N RL     + 
Sbjct: 85  EIENYKRFQS-PYVIKSIDSQVMQEKDG-SKTIYIVLPYYSLGSLQDSINRRLLEGTFVS 142

Query: 130 ESEILEIMSQTVQGIAAMH----------------------------------------- 148
           E+E + IM    +G+  +H                                         
Sbjct: 143 EAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMDMLS 202

Query: 149 ---ALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTT 205
              A      HRDI   N+L S +GL  + D GS S       N  + + +Q  +  N T
Sbjct: 203 SNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVNDNCT 262

Query: 206 AQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGE---AGILHA----RY 258
             Y  PE+++L     +  K DIW+LG   Y + +  +PFE+  +   A + +A    +Y
Sbjct: 263 LPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINTGKY 322

Query: 259 QYPPFPQYSDRLKNLIRLMLMETPSKRP 286
            +P   ++S+ L ++I+  +   P +RP
Sbjct: 323 SFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 106/218 (48%), Gaps = 29/218 (13%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIE 162
           E+++++E+ + G L D++ ++   +L E E +   +Q +QG++  H+    + HRD+K E
Sbjct: 200 ELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFN--ICHRDLKPE 255

Query: 163 NVLIS-HNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRG 219
           N+L+   N + K+ DFG     +  P    E         +  +  Y SPE++    Y G
Sbjct: 256 NLLLDKKNKVIKIADFG--MAALELPNKLLE--------TSCGSPHYASPEIVMGKPYHG 305

Query: 220 LPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL----HARYQYPPFPQYSDRLKNLIR 275
            P    SD+W+ GI L+ +     PF       +L      R+Q PP+   ++  K+LI 
Sbjct: 306 GP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPPY--LTNDAKDLIT 359

Query: 276 LMLMETPSKRPNICQVLEE--VSRLQIKPCPIRNFYLL 311
            +L+  P KR  I ++L    + + +  P  IR   LL
Sbjct: 360 RILVTNPEKRLTINEILNHPLIKKYRNPPAHIRKLNLL 397

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 77/334 (23%), Positives = 140/334 (41%), Gaps = 60/334 (17%)

Query: 15  LTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVD 74
           ++V  H   I + L  GGF+ VY  E        N  +A LK++  P      ++ +   
Sbjct: 19  VSVNGHRYHIKRLLGEGGFSFVYLVE-----SRENGLMA-LKKIRCP----FGSIGSISP 68

Query: 75  AMKLLKNNK-----HVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQN--R 127
           AMK + N +     ++   IDS   +  +G +  V++L+ +  +G L D +N  L +  +
Sbjct: 69  AMKEVDNYQKFKSPYIAQIIDSQVVQERDG-SKTVYILLPYFSKGSLQDEINRHLLDCTQ 127

Query: 128 LRESEILEIMSQTVQGIAAMHALQPP---------------------------------- 153
           + E E++ +     +G+  +H   P                                   
Sbjct: 128 VPELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQ 187

Query: 154 -LIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPE 212
              H DIK  N++IS  G+  + D GS S       + Q     Q     + T  + +PE
Sbjct: 188 AYAHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPE 247

Query: 213 MIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEK----SGEA---GILHARYQYPPFPQ 265
           ++D+     I EK D+W+ G  +Y +C+  +PFE+    SG +    +   +Y  P    
Sbjct: 248 ILDVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTN 307

Query: 266 YSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299
           YS  L ++++  L   P  RP++ +++  +  LQ
Sbjct: 308 YSSGLIDVVKKCLNVDPDGRPSVDELISLLMDLQ 341

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 86/308 (27%), Positives = 134/308 (43%), Gaps = 72/308 (23%)

Query: 5   QISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQ 64
           Q SL E   +  VG++  KI+K +  G F +VY A              CL    V  K 
Sbjct: 25  QFSLNE---LQEVGNY--KILKIVGEGSFGKVYLAS------------HCLTHQKVVLKM 67

Query: 65  GLNTLRAEVDAMKLLKNNKHVV-------SYIDSHAAKSVNGVAYEVFVLM--EFCERGG 115
           G              KN+ +VV        +  SH  K    +  E +V M  E+C    
Sbjct: 68  GS-------------KNDPNVVREVFYHRQFDYSHITKLYEVIVTENYVWMALEYCPGKE 114

Query: 116 LIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVC 175
           L +++  +    L E    E+ SQ V  +   H+++   +HRD+K+EN+L+   G  K+ 
Sbjct: 115 LYEYLLAKKHIPLEECS--ELFSQIVGAVYYAHSMK--CVHRDLKLENILLDKKGHAKLT 170

Query: 176 DFG-----SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDL--YRGLPIDEKSDI 228
           DFG     +  G++              + +  TT  Y +PE+I+   Y G  I    D 
Sbjct: 171 DFGFTRECATKGIL--------------ETICGTTV-YMAPELIERKPYEGYKI----DT 211

Query: 229 WALGIFLYKICYYTTPFEKSGEAGILHARYQYPPF--PQYSD-RLKNLIRLMLMETPSKR 285
           W+LGI LY + + T PF++  E    +    Y P     Y D   K LI  +L + P++R
Sbjct: 212 WSLGIILYTMIHGTMPFDEVDEVKTKYKIVHYNPTYDNDYIDSNGKELISQLLEKDPNQR 271

Query: 286 PNICQVLE 293
           P++ QVL+
Sbjct: 272 PSLTQVLQ 279

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/268 (27%), Positives = 127/268 (47%), Gaps = 34/268 (12%)

Query: 31  GGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYID 90
           G +  VY A     D      +  +K ++  + + LN + AE+  +K L N+ ++V Y  
Sbjct: 34  GSYGVVYKAINKHTD-----QVVAIKEIVYENDEELNDIMAEISLLKNL-NHHNIVKY-H 86

Query: 91  SHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHAL 150
               KS     YE+++L+E+C  G L   + +R    L E+E    ++QT+ G+  +H  
Sbjct: 87  GFIRKS-----YELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG- 139

Query: 151 QPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRS 210
              +IHRDIK  N+L+S +   K+ DFG VS ++     T              T  + +
Sbjct: 140 -EGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSALTLA-----------GTLNWMA 186

Query: 211 PEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHA---RYQYPPFPQYS 267
           PE++   RG      SDIW+LG  + ++     P+    +A I +A      YPP   +S
Sbjct: 187 PEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPP-SSFS 242

Query: 268 DRLKNLIRLMLMETPSKRPNICQVLEEV 295
           + LK+ +    ++   KRP   Q+L+ V
Sbjct: 243 ESLKDFLSKCFVKNMYKRPTADQLLKHV 270

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 126/270 (46%), Gaps = 27/270 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +      +    +A   ++ +  ++  N L +E+   K +++ +++V
Sbjct: 103 FLGEGGFARCFQMKDDDGKVFAAKTVA---KISIKSEKARNKLLSEIQIHKNMRH-QNIV 158

Query: 87  SYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAA 146
            +ID      +N     V++L+E C  G L+D +  R    L E E+    +Q    +  
Sbjct: 159 HFIDCFE-DDIN-----VYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGALDH 210

Query: 147 MHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTA 206
           MH+    +IHRD+K+ N+    +   K+ DFG ++ +I    N  E  Y         T 
Sbjct: 211 MHSRN--IIHRDLKLGNIFFDKDFNLKIGDFG-LAAII---NNENERKYT-----ICGTP 259

Query: 207 QYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL----HARYQYPP 262
            Y +PE+I   + +    + DIW+LG+ ++ +     PF+    + I     H  Y +P 
Sbjct: 260 NYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKEVSTIYDRIKHCNYSFPT 319

Query: 263 FPQYSDRLKNLIRLMLMETPSKRPNICQVL 292
               S  +K LI+ +L   P +RP I ++L
Sbjct: 320 DKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 75/269 (27%), Positives = 119/269 (44%), Gaps = 34/269 (12%)

Query: 31  GGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQG--LNTLRAEVDAMKLLKNNKHVVSY 88
           G F  VY         YT     C  +V+  D     +  ++ E+  +  LK   ++  Y
Sbjct: 28  GKFGVVYKGY------YTKTKQVCAIKVLNLDSADDEVEDVQKEIQFLSSLKQVPNITHY 81

Query: 89  IDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMH 148
             S+   +      +++V+ME+C  G L   +      ++ E  I  IM + +   A MH
Sbjct: 82  YGSYLNDT------KLWVIMEYCAGGSLRTLLR---PGKIGEQYIGVIMRELL--TALMH 130

Query: 149 ALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQY 208
             +  +IHRDIK  NVLI+++G  K+CDFG  + + +     Q             T  +
Sbjct: 131 IHKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTM---------AGTPYW 181

Query: 209 RSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF-EKSGEAGILHARYQYPP---FP 264
            +PE+I    G+  D K DIW+LGI  Y+I     P+ E      +       PP     
Sbjct: 182 MAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGR 239

Query: 265 QYSDRLKNLIRLMLMETPSKRPNICQVLE 293
           Q+S  LK +I L L E P +RP+   +L+
Sbjct: 240 QHSSALKEIIALCLDEDPKERPSAEDLLK 268

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 129/280 (46%), Gaps = 49/280 (17%)

Query: 23  KIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV--PDKQGLNTLRAEVDAMKLLK 80
           KI+K +  G F +VY A   P            ++V++   DK   N +R      ++  
Sbjct: 38  KILKQIGEGSFGKVYLASHKPTH----------RKVVLKTSDKSDPNLVR------EVFY 81

Query: 81  NNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQT 140
           + +    YI       V     +V++ +E+C    L + +   + +R+   E  ++ +Q 
Sbjct: 82  HRQFDFPYIT--KLYEVIVTETKVWMALEYCPGRELYEHL--LMLHRIPLDECAKLFAQI 137

Query: 141 VQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDI 200
           V  +   H+L    +HRD+K+EN+L+  NG  K+ DFG     +         +    + 
Sbjct: 138 VSAVHYAHSLN--CVHRDLKLENILLDKNGNAKLTDFGFTRECV---------SKSSLET 186

Query: 201 LTNTTAQYRSPEMI--DLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHARY 258
           +  TT  Y +PE+I    Y G  I    DIW+LG+ LY +   T PF++  E      ++
Sbjct: 187 ICGTTV-YMAPELIQRQAYDGFKI----DIWSLGVILYTMINGTMPFDEDDET---KTKW 238

Query: 259 Q-YPPFPQYSDRL-----KNLIRLMLMETPSKRPNICQVL 292
           +    FP ++D       K+LI+ +L + PS+RP + Q+L
Sbjct: 239 KIVNDFPNFNDNFVSHEAKDLIKRLLAKCPSERPTMEQIL 278

>KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1223

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 61/180 (33%), Positives = 86/180 (47%), Gaps = 22/180 (12%)

Query: 115  GLIDFMN-TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYK 173
            G +D  +   L+  + E E   I  Q V GI  +H     ++HRDIK ENV++  NG  K
Sbjct: 1055 GSVDLFDLIELKTDMTEHEAKLIFKQIVSGIKHLH--DNGIVHRDIKDENVIVDSNGFVK 1112

Query: 174  VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIWAL 231
            + DFGS + V   P           D+   T   Y +PE++  + Y G P     DIWA+
Sbjct: 1113 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAI 1157

Query: 232  GIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQV 291
            G+ LY I +   PF    E  IL A  +     + SD    LIR +L    SKRP+I ++
Sbjct: 1158 GVLLYTIIFKENPFYNIDE--ILDADLRVDSNHRVSDECIALIRKILNRPISKRPSISKI 1215

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 101/211 (47%), Gaps = 24/211 (11%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           ++++ME+C  G   D +       L E ++  I    ++G+  +H  +   IHRD+K  N
Sbjct: 92  MWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHEQRK--IHRDVKAAN 149

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQEF----NYVQHDILTNTTAQYRSPEMIDLYRG 219
           VL++ +GL K+ DFG VSG +R       F     ++  +I++N++  Y           
Sbjct: 150 VLLTDDGLVKLADFG-VSGQLRSTAKRNTFVGTPYWMAPEIISNSSHGY----------- 197

Query: 220 LPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILH---ARYQYPPFPQYSDRLKNLIRL 276
              +EK+DIW+LGI +Y++     P+ K     ++     +        +SD  K  I  
Sbjct: 198 ---NEKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNLQDCMVSFSDAAKLFISA 254

Query: 277 MLMETPSKRPNICQVLEEVSRLQIKPCPIRN 307
            L++ P +RP   ++L++     IK   +RN
Sbjct: 255 CLIKDPDERPTATELLQQPFVKNIKITDLRN 285

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 123/260 (47%), Gaps = 29/260 (11%)

Query: 31  GGFAQVYTAEISPPDPYTNANIACLKRV-IVPDKQGLNTLRAEVDAMKLLKNNKHVVSYI 89
           G F  VY A        TN  I  +K V +   ++ ++ L  E+  +  L++      YI
Sbjct: 24  GNFGDVYKAFDK-----TNGAIVAVKVVNLEHTEEDIDLLAQEIFFLAELRS-----PYI 73

Query: 90  DSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHA 149
            ++    +  V+  ++++ME+C  G   D + T   N L E+++  I  + ++G+  +H 
Sbjct: 74  TNYITTMIEDVS--MWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLKYLHD 131

Query: 150 LQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYR 209
            +   IHRDIK  N+L++  G  K+ DFG VSG IR       F           T  + 
Sbjct: 132 QKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRATMKRGTF---------VGTPYWM 179

Query: 210 SPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQYPP---FPQY 266
           +PE+++       +EK+DIW+LGI +Y++     P  K     ++ +  +  P     QY
Sbjct: 180 APEVVN-KESNGYNEKADIWSLGITVYELLKGLPPLSKCDPMKVMVSLPRRKPPKLHGQY 238

Query: 267 SDRLKNLIRLMLMETPSKRP 286
           SD  K  +   L++ P+ RP
Sbjct: 239 SDVAKGFVAACLVKDPNLRP 258

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 127/268 (47%), Gaps = 34/268 (12%)

Query: 31  GGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYID 90
           G +  VY A     D      +  +K V+  + + LN + AE+  +K L +N ++V Y  
Sbjct: 34  GSYGVVYKAINKHTD-----QVVAIKEVVYENDEELNDIMAEISLLKNLNHN-NIVKY-H 86

Query: 91  SHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHAL 150
               KS     YE+++L+E+C  G L   + +R    L E+E    ++QT+ G+  +H  
Sbjct: 87  GFIRKS-----YELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG- 139

Query: 151 QPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRS 210
              +IHRDIK  N+L+S +   K+ DFG VS ++     T              T  + +
Sbjct: 140 -EGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSALTLA-----------GTLNWMA 186

Query: 211 PEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHA---RYQYPPFPQYS 267
           PE++   RG      SDIW+LG  + ++     P+    +A I +A      YPP   +S
Sbjct: 187 PEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPP-SSFS 242

Query: 268 DRLKNLIRLMLMETPSKRPNICQVLEEV 295
           + LK+ +    ++   KRP   Q+L+ V
Sbjct: 243 EPLKDFLSKCFVKNMYKRPTADQLLKHV 270

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 83.6 bits (205), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 68/267 (25%), Positives = 125/267 (46%), Gaps = 28/267 (10%)

Query: 31  GGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYID 90
           G F  VY A  +    Y    +  L+       + ++ L  E+  +  LK++ ++++YI 
Sbjct: 25  GNFGDVYKAIDNITKKYVAIKVINLEY----SDEDIDLLAQEIFFLAELKSD-YIINYIT 79

Query: 91  SHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHAL 150
           +            ++++M++C  G   D +     N + E ++  I+   + G+  +H  
Sbjct: 80  TIMED------VSMWIVMDYCGGGSCSDLIKIVYPNGIVEEKVSFIVKNVLLGLQYLHEQ 133

Query: 151 QPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRS 210
           +   IHRDIK  N+L++ +G  K+ DFG VSG I+          ++ D    T   + +
Sbjct: 134 KK--IHRDIKAANILLTDDGQVKLGDFG-VSGQIKAT--------LKRDTFVGT-PYWMA 181

Query: 211 PEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQ----Y 266
           PE+I+       DEK DIW+LGI  Y++     P  K     ++ +  +  P P+    Y
Sbjct: 182 PEVINKEINNGYDEKVDIWSLGITTYELLKGVPPLSKYDPVKVMTSLVKRKP-PKLHGPY 240

Query: 267 SDRLKNLIRLMLMETPSKRPNICQVLE 293
           +D  K+ I   L++ P  RPN+  +L+
Sbjct: 241 NDFTKSFISFCLIKDPKLRPNVQNLLK 267

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 106/222 (47%), Gaps = 26/222 (11%)

Query: 69  LRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRL 128
           +R E+  +  LK   ++  Y  S+       +  +++V+ME+C  G L   +   +   +
Sbjct: 59  IRKEIQFLSSLKQTPNITHYYGSYL------IDTKLWVIMEYCAGGSLRTLLRPGI---I 109

Query: 129 RESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPR 188
            E  I  IM + +  + ++H  +  +IHRDIK  N+LI++NG  K+CDFG  + + +   
Sbjct: 110 EEKYIGVIMREILVALISIH--RDNVIHRDIKAANILIANNGSVKLCDFGVAAQLSQSML 167

Query: 189 NTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF--E 246
             Q             T  + +PE+I    G+  D K DIW+LGI  Y+I     P+   
Sbjct: 168 KRQTM---------AGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCHM 216

Query: 247 KSGEAGILHARYQYPPFP--QYSDRLKNLIRLMLMETPSKRP 286
           ++  A  +  + + P     +YS  LK  I L L E P +RP
Sbjct: 217 EAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERP 258

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 84.7 bits (208), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 88/183 (48%), Gaps = 22/183 (12%)

Query: 115  GLIDFMN-TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYK 173
            G ID  +    ++ + ESE   I  Q V GI  +H     ++HRD+K ENV++   G  K
Sbjct: 1199 GCIDLFDLIEFKSNMTESEARLIFIQVVLGIKHLH--DSNIVHRDVKDENVIVDAKGFVK 1256

Query: 174  VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIWAL 231
            + DFGS + V   P           D+   T   Y +PE++  + Y G P     DIWA+
Sbjct: 1257 LIDFGSAAYVNSGP----------FDVFVGTI-DYAAPEVLSGEPYLGKP----QDIWAI 1301

Query: 232  GIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQV 291
            GI LY I +   PF    E  IL A  +       S    +LI+ +L + P+KRP I ++
Sbjct: 1302 GILLYTIMFKENPFYNIDE--ILEAELKINNTSDASQDCIDLIKRILTKNPNKRPTIDEI 1359

Query: 292  LEE 294
            + +
Sbjct: 1360 VND 1362

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 84.7 bits (208), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 97/199 (48%), Gaps = 31/199 (15%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIE 162
           E+++++E+ + G L D++ ++   +L ESE +    Q + GI+  H+    + HRD+K E
Sbjct: 209 ELYLVLEYVDGGELFDYLVSK--GKLTESEAVHYFKQIINGISYCHSFN--ICHRDLKPE 264

Query: 163 NVLISHNG-LYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTA--QYRSPEMI--DLY 217
           N+L+     + K+ DFG  +              V + +L  +     Y SPE++    Y
Sbjct: 265 NLLLDKKRRIIKIADFGMAAL------------QVSNRLLQTSCGSPHYASPEIVMGKCY 312

Query: 218 RGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL----HARYQYPPFPQYSDRLKNL 273
            G P    SDIW+ GI L+ +     PF       +L    + RYQ P +   S   KNL
Sbjct: 313 NGAP----SDIWSCGIILFALLTGHLPFNDDNIKKLLIKVQNGRYQMPSY--ISQEAKNL 366

Query: 274 IRLMLMETPSKRPNICQVL 292
           I  +L+  PSKR +  Q+L
Sbjct: 367 ISRILVVDPSKRISTEQIL 385

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 82.0 bits (201), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 78/338 (23%), Positives = 138/338 (40%), Gaps = 72/338 (21%)

Query: 13  TILTVGSHHAKIIKYLTSGGFAQVYTAE-----------ISPPDPYTNANIACLKRVIVP 61
           T + V     KI + L  GG + VY  +           I  P+ Y       LK++I P
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYA------LKKIICP 74

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMN 121
             + ++    E++  K  ++  +V+  IDS   +  NG +  +++++ +   G L D +N
Sbjct: 75  SVESISNGMREIENYKRFQS-PYVIQSIDSQVTQEKNG-SKIIYIILPYYSLGSLQDSIN 132

Query: 122 TRL--QNRLRESEILEIMSQTVQGIAAMH------------------------------- 148
            RL     + E+E + IM    +G+  +H                               
Sbjct: 133 RRLLEGTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLE 192

Query: 149 -------------ALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNY 195
                        A      HRDI   N+L S  GL  + D GS S       +  + + 
Sbjct: 193 DTPLEMDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSE 252

Query: 196 VQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGE---AG 252
           +Q  +  N T  Y +PE+++L     +  K DIW++G   Y + +  +PFE+  +   A 
Sbjct: 253 LQEWVNDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGAS 312

Query: 253 ILHA----RYQYPPFPQYSDRLKNLIRLMLMETPSKRP 286
           I +A    +Y +P   ++S+ L N+I+  +   P +RP
Sbjct: 313 ITYAINTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 84.3 bits (207), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 110/235 (46%), Gaps = 30/235 (12%)

Query: 66   LNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERG--GLIDFMN-T 122
            L T+ +E+  M +L  NKH     D +  + ++    + +  +E    G  G ID  +  
Sbjct: 1024 LGTIPSEIQIMAVL--NKHP----DENILRLLDFFEDDDYYYIETPVHGETGSIDLFDLI 1077

Query: 123  RLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSG 182
             L+  + E E   I  Q + GI  +H  +  ++HRDIK ENV++   G  K+ DFGS + 
Sbjct: 1078 ELKTNMTEFEAKLIFKQVISGIKHLH--EQGIVHRDIKDENVIVDSKGFVKLIDFGSAAY 1135

Query: 183  VIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIWALGIFLYKICY 240
            V   P           D+   T   Y +PE++  + Y G P     DIWA+GI LY I +
Sbjct: 1136 VKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAVGILLYTIVF 1180

Query: 241  YTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEV 295
               PF    E  I+    ++    + S+   NLI+ +L +   KRP I  + ++V
Sbjct: 1181 KENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTIQDIYDDV 1233

>KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {ON}
           Anc_6.262 YPL236C
          Length = 387

 Score = 82.0 bits (201), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 73/336 (21%), Positives = 144/336 (42%), Gaps = 67/336 (19%)

Query: 25  IKYLTSGGF-------AQVYTAEISPPDPYTNANIACLKRVIVP--DKQGLNTLRAEVDA 75
           +K LTSG         + + T+ ++  D Y       +++++ P  D + ++    E+D 
Sbjct: 51  VKSLTSGSIFGGMRRQSSMSTSNLNDIDGYDEPTDMVVRQIMCPFGDIESVSNALKEIDN 110

Query: 76  MKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQN--RLRESEI 133
            +  K+  +++  +DS   +  +G +  V +L+ +   G L D ++  L +  R+ ESE+
Sbjct: 111 YRYFKS-PYIMQCLDSQVIQRRDG-SKTVLILLPYLPLGSLRDAIDRNLLDGIRMSESEV 168

Query: 134 LEIMSQTVQGIAAMH----------ALQP------------------------------- 152
           + +M  T +G+  +H          ++ P                               
Sbjct: 169 IRVMIGTCRGLLYLHDPTSRGNLGSSMGPQNGMDAVSMTLSDDAAMLLDGTPFEMDMLSS 228

Query: 153 ------PLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTA 206
                    H +IK  N+L S +GL  + + GS+  +     N +    ++     + T 
Sbjct: 229 HSMKMDSYAHMNIKPSNILFSSDGLPVITELGSLQKLDLKIENVKMLKSIKEWTEEHCTV 288

Query: 207 QYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEA-------GILHARYQ 259
            Y  PE+++L  G  +D   DIW+LG  LY + +  +PF++  +        GI  ARY 
Sbjct: 289 YYMPPELLNLKVGTVLDCSVDIWSLGCTLYTLLFGISPFKREEQVNEVPLKYGISKARYS 348

Query: 260 YPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEV 295
           +P    YS +L ++I   L   P+ RP + ++L ++
Sbjct: 349 FPEGHVYSKKLVSVIETCLQVNPTMRPTVNELLGQL 384

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 89/375 (23%), Positives = 166/375 (44%), Gaps = 54/375 (14%)

Query: 14  ILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEV 73
           I+  G    K  + +  G ++ V  A  +  D      +  L +  +  ++ +  +  E 
Sbjct: 174 IIRKGIKDFKFGEMVGDGAYSTVMLA--TAKDSGKKYAVKVLNKEYLIKQKKVKYVNIEK 231

Query: 74  DAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEI 133
           +A++ L N++ +V    +   +S       ++ L+E+   G  +  M  +    L E   
Sbjct: 232 NALQRLNNSRGIVKLFFTFQDES------SLYFLLEYAPNGDFLSVM--KKYGSLSEDCT 283

Query: 134 LEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEF 193
               +Q + GI  +H+    +IHRDIK EN+L+  +   K+ DFG+    I  P+N  E 
Sbjct: 284 RYYSAQIIDGIKYLHS--KGIIHRDIKPENILLDKDMKVKITDFGTAK--ILEPKNEDED 339

Query: 194 NYVQHDILTNT-----TAQYRSPEMI-DLYRGLPIDEKSDIWALGIFLYKICYYTTPFEK 247
           N  + ++LT +     TA+Y SPE++ D Y    +D + DIWA G  ++++     PF+ 
Sbjct: 340 N-PEFNLLTRSKSFVGTAEYVSPELLNDSY----VDARCDIWAFGCMVFQMIAGKPPFKA 394

Query: 248 SGEAGILHA--RYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLE---------EVS 296
           + E        + QY     +   +++L++ +L++ P +R  I Q+ +         E  
Sbjct: 395 TNEYLTFQKVMKVQYAFTAGFPVVVRDLVKRILLKVPEQRLTIPQIEKHHFYKDISFEDG 454

Query: 297 RLQIKPCPIRNFYLLRAMSQTAQLASEP-PSMKYVPTQKF---LPAQGLQSMKPISNMIP 352
            +   P P    Y + A S       +P P +K  P ++    +P + LQ     S+   
Sbjct: 455 SVWTAPAPEIQPYKINAKSM------QPVPELKDAPNKRTIINIPKRQLQKAHTNSS--- 505

Query: 353 VSHVRTTPNLSTLPR 367
                +TPNL T+ R
Sbjct: 506 -----STPNLPTIER 515

>TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1300

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 89/192 (46%), Gaps = 23/192 (11%)

Query: 113  RGGLIDFMN-TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGL 171
              G ID  +    +  + E E   I  Q   G+  +H+L   ++HRDIK ENV+I   G 
Sbjct: 1129 ESGCIDLFDLIEFRTDMTEDEAKLIFKQVASGLQHLHSLG--IVHRDIKDENVIIDSKGY 1186

Query: 172  YKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIW 229
             K+ DFGS + V   P           D+   T   Y +PE++  + Y G P     DIW
Sbjct: 1187 VKIIDFGSAAYVKNGP----------FDVFVGTI-DYAAPEVLAGNPYEGKP----QDIW 1231

Query: 230  ALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNIC 289
            ALGI LY I +   PF    E  I+     +      +     LI+ ML++T  KRP+I 
Sbjct: 1232 ALGILLYTIIFKENPFYNIDE--IIEGNVNFDNEASVNPVCVQLIKKMLIKTVPKRPDIN 1289

Query: 290  QVLEEVSRLQIK 301
            +V  +   LQI+
Sbjct: 1290 EVFSD-PWLQIE 1300

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 74/267 (27%), Positives = 125/267 (46%), Gaps = 34/267 (12%)

Query: 31  GGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYID 90
           G +  VY A     D      +  +K ++    + LN + AE+  +K L N+ ++V Y  
Sbjct: 34  GSYGVVYKAINKHTD-----QVVAIKEIVYESDEELNDIMAEISLLKNL-NHDNIVKY-H 86

Query: 91  SHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHAL 150
               KS     YE+++L+E+C  G L   + +R    L E+E    ++QT+ G+  +H  
Sbjct: 87  GFIRKS-----YELYILLEYCANGSLRRLI-SRSSTGLSENESKSYVTQTLLGLKYLHG- 139

Query: 151 QPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRS 210
              +IHRDIK  N+L+S +   K+ DFG VS ++     T              T  + +
Sbjct: 140 -EGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSALTLA-----------GTLNWMA 186

Query: 211 PEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHA---RYQYPPFPQYS 267
           PE++   RG      SDIW+LG  + ++     P+    +A I +A      YPP   +S
Sbjct: 187 PEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPP-SSFS 242

Query: 268 DRLKNLIRLMLMETPSKRPNICQVLEE 294
           + LK+ +    ++   KRP   Q+L+ 
Sbjct: 243 ESLKDFLSKCFVKNMYKRPTADQLLKH 269

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/281 (25%), Positives = 132/281 (46%), Gaps = 30/281 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +      +    +A L    +  ++    L +E+   K +K+ ++VV
Sbjct: 87  FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKSEKTRKKLLSEIQIHKSMKH-QNVV 142

Query: 87  SYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAA 146
            +ID     +       V++L+E C  G L+D +  R    L E E+    +Q    I  
Sbjct: 143 QFIDCFEDDT------NVYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGAIKY 194

Query: 147 MHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTA 206
           MH+ +  +IHRD+K+ N+    N   K+ DFG ++ V+    N +E  Y         T 
Sbjct: 195 MHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG-LAAVL---ANDRERKYT-----VCGTP 243

Query: 207 QYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHAR-----YQYP 261
            Y +PE++ + +      + DIW++G+ LY +     PF+ S +   ++ R     + +P
Sbjct: 244 NYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQ-SKDVNTIYERIKCCDFSFP 301

Query: 262 PFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQIKP 302
                S+  K LI+ +L   P +RP+I ++++ V    I P
Sbjct: 302 KEKHISNEAKVLIQDLLSLDPLERPSISEIMDYVWFRGIFP 342

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 94/198 (47%), Gaps = 27/198 (13%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIE 162
           E+++++E+ E G L D++  R   +L E E +    Q VQG++  H     + HRD+K E
Sbjct: 138 ELYLVLEYVEGGELFDYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN--ICHRDLKPE 193

Query: 163 NVLISH-NGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRG 219
           N+L+   N   K+ DFG  +         +  N +     +  +  Y SPE++    Y G
Sbjct: 194 NLLLDKKNKTVKIADFGMAA--------LETTNRLLE--TSCGSPHYASPEIVMGQKYHG 243

Query: 220 LPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL----HARYQYPPFPQYSDRLKNLIR 275
            P    SD+W+ GI L+ +     PF       +L    H RYQ P     S   K+LI 
Sbjct: 244 SP----SDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMP--SNVSKEAKDLIS 297

Query: 276 LMLMETPSKRPNICQVLE 293
            +L+  P KR  + ++LE
Sbjct: 298 KILVVDPEKRITVDKILE 315

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/179 (34%), Positives = 87/179 (48%), Gaps = 23/179 (12%)

Query: 116 LIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVC 175
           L DF+  +  +++ E E   I  Q V GI  +H L   +IHRDIK EN++I   G  +V 
Sbjct: 766 LFDFIEKK--DKIDEVEQKLIFKQIVAGIKHIHGL--GIIHRDIKTENIIIDSEGCVQVI 821

Query: 176 DFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEK-SDIWALGIF 234
           DFGS +     P   Q F         + T  Y SPE++   +G P + K  D+WALGI 
Sbjct: 822 DFGSAAYATNGP--FQVF---------HGTIDYASPEVL---KGEPYEGKPQDVWALGIL 867

Query: 235 LYKICYYTTPFEKSGEAGILHARYQYPPF--PQYSDRLKNLIRLMLMETPSKRPNICQV 291
           LY I +  TPF    E  I+    +  P      SD+ + LI  ML +    RP I ++
Sbjct: 868 LYIITFKQTPFNSVAE--IIENELEIDPAHSENVSDQCRVLIHKMLDKKAWARPKISEI 924

>NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {ON}
           Anc_8.140
          Length = 915

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 88/331 (26%), Positives = 150/331 (45%), Gaps = 65/331 (19%)

Query: 6   ISL-YEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRV------ 58
           ISL Y+P +   + +H+ +I+K L +G   +V  A+    D   N  +A +K V      
Sbjct: 77  ISLSYDPVSKTQILNHY-EIVKELGNGQHGKVKLAK----DIRANQLVA-IKMVNRYEKK 130

Query: 59  ---IVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGG 115
                P +   N ++ E+  MK   NNKHVV  I+     S    + ++++++E+CE+G 
Sbjct: 131 TYFAGPKRNDPNKIKKEIAIMKKC-NNKHVVKLIEILDDLS----SRKIYLVLEYCEKGP 185

Query: 116 LIDF------MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHN 169
           ++        +++R   +L      EI    + G+  +H+    +IHRDIK  N+L+  N
Sbjct: 186 ILWCPRDQLEIDSRGPPQLSFQRAREIFRDVILGLEYLHS--QGIIHRDIKPANLLMDKN 243

Query: 170 GLYKVCDFG-SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI-------------- 214
           G+ K+ DFG S++       N  E    +    T  T  + +PE+               
Sbjct: 244 GVVKISDFGVSLAANGNIDTNDDELELTK----TVGTPVFYAPEICLGAAAMERFNLDKD 299

Query: 215 DLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGE----AGILHARYQYPPFPQYSD-- 268
           +L+ G  I  K DIWALGI LY + +   PF    E      I++ + ++P F    D  
Sbjct: 300 ELFNGSCISFKIDIWALGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFPTFETLQDNH 359

Query: 269 -----------RLKNLIRLMLMETPSKRPNI 288
                        K+L+  +L + P+KR +I
Sbjct: 360 ISEISHIREFVHAKDLLNKLLEKNPAKRISI 390

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 92/191 (48%), Gaps = 22/191 (11%)

Query: 105  FVLMEFCERGGLIDFMN-TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
            ++ +E     G ID  +   L+  + E E   I  Q V GI  +H     ++HRDIK EN
Sbjct: 877  YIELESHGETGSIDLFDLIELKTNMTEFEAKLIFKQIVSGIKYLH--DQGIVHRDIKDEN 934

Query: 164  VLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLP 221
            V++  NG  K+ DFGS +     P       +V        T  Y +PE++  + Y+G P
Sbjct: 935  VIVDSNGFVKLIDFGSAAYTKTGPFEV----FVG-------TIDYAAPEILGGNPYKGKP 983

Query: 222  IDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMET 281
                 DIWALG+ LY + Y   PF    E  IL  + ++      +    +LIR +L ++
Sbjct: 984  ----QDIWALGVLLYTLIYKENPFYNVDE--ILEGQLRFDGTCNVTQDCIDLIRWILTKS 1037

Query: 282  PSKRPNICQVL 292
             + RP+I +++
Sbjct: 1038 VNDRPSIDEIV 1048

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/279 (27%), Positives = 125/279 (44%), Gaps = 37/279 (13%)

Query: 31  GGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYID 90
           G F  VY A            +  L+       + +N L  E+  +  LK+      YI 
Sbjct: 26  GNFGDVYKACEKVSGKVVAVKVVNLEHT----DEDINLLAQEIFFLAELKS-----PYIT 76

Query: 91  SHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHAL 150
           ++       V+  ++++ME+C  G   D +       L ES+   I  + ++G+  +H  
Sbjct: 77  NYITTMTEDVS--MWIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLKGLEYLHEQ 134

Query: 151 QPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRS 210
           +   IHRDIK  N+L++  G  K+ DFG VSG IR       F           T  + +
Sbjct: 135 KK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRATLKRGTF---------VGTPFWMA 182

Query: 211 PEMI----DLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL-HARYQYPPF-- 263
           PE++    D Y     DEK+DIW+LGI +Y++   + P  K     ++ +   + PP   
Sbjct: 183 PEVVSKDSDGY-----DEKADIWSLGITVYELLKGSPPLYKCDPMKVMVNLPKRKPPVLH 237

Query: 264 PQYSDRLKNLIRLMLMETPSKRPNICQVL--EEVSRLQI 300
             YS   K+ +   L++ P  RP+  ++L  E V+ LQI
Sbjct: 238 GHYSSAAKHFVASCLVKNPKNRPSAVELLNSEFVTNLQI 276

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 99/202 (49%), Gaps = 37/202 (18%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           V++ +E+C    L +++   ++ R+   E   + SQ V  +   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSMK--CVHRDLKLEN 158

Query: 164 VLISHNGLYKVCDFG-----SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDL-- 216
           +L+   G  K+ DFG     +  G++              + +  TT  Y +PE+I+   
Sbjct: 159 ILLDKKGQAKLTDFGFTRECATKGIL--------------ETVCGTTV-YMAPELIERKP 203

Query: 217 YRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRL-----K 271
           Y G  I    D W+LGI LY + +   PF++  +    +      PF  Y D       K
Sbjct: 204 YEGYKI----DTWSLGIILYTMIHGAMPFDEEDDIKTKYRIVNNEPF--YDDNFIDANGK 257

Query: 272 NLIRLMLMETPSKRPNICQVLE 293
           +LI  +L + PS+RP++ QVL+
Sbjct: 258 DLIMQLLQKDPSQRPSLTQVLQ 279

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 89/191 (46%), Gaps = 22/191 (11%)

Query: 112  ERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGL 171
            E G +  F    L+  + E E   +  Q   GI  +H     ++HRDIK ENV++ + G 
Sbjct: 1059 ETGSIDLFDLIELKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDENVIVDNKGF 1116

Query: 172  YKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIW 229
             K+ DFGS + V   P           D+   T   Y +PE++  + Y G P     DIW
Sbjct: 1117 VKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIW 1161

Query: 230  ALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNIC 289
            A+G+ LY I Y   PF    E  IL    +     + S     LIR +L  + SKRP I 
Sbjct: 1162 AIGVLLYTIIYKENPFYNIDE--ILDGDLRIQSTHEVSAECVALIRKILNRSVSKRPTID 1219

Query: 290  QVLEEVSRLQI 300
             ++E+ S LQ+
Sbjct: 1220 DIMED-SWLQL 1229

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 85/183 (46%), Gaps = 22/183 (12%)

Query: 115  GLIDFMN-TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYK 173
            G ID  +    +  + E E   I  Q V GI  +H     ++HRDIK ENV++   GL K
Sbjct: 1243 GCIDLFDLIEFKTNMTEFEAKLIFKQVVSGIKHLH--HQGIVHRDIKDENVIVDSKGLVK 1300

Query: 174  VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIWAL 231
            + DFGS + V   P           D+   T   Y +PE++  + Y G P     DIWAL
Sbjct: 1301 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLSGEPYEGKP----QDIWAL 1345

Query: 232  GIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQV 291
            GI LY I +   PF    E  IL    ++    + ++    LI+ +L+     RP I ++
Sbjct: 1346 GILLYTIVFKENPFYNIDE--ILEGDLKFDSNTEVTEDCMELIKKVLIRQVRNRPAIDEI 1403

Query: 292  LEE 294
             ++
Sbjct: 1404 FDD 1406

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/188 (32%), Positives = 88/188 (46%), Gaps = 21/188 (11%)

Query: 115  GLIDFMNT-RLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYK 173
            G +D  +    ++ + E E   I  Q V GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1038 GSVDLFDIIEFKSNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1095

Query: 174  VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKS-DIWALG 232
            + DFGS + V   P           D+   T   Y +PE++    G P + KS DIWA+G
Sbjct: 1096 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLG---GNPYEGKSQDIWAIG 1141

Query: 233  IFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVL 292
            I LY + Y   PF    E  IL    ++      S   K LI  +L     KRP I ++ 
Sbjct: 1142 ILLYTLIYKENPFYNIDE--ILEGELRFNDSADVSQECKALITKILNRCVRKRPTIDEIC 1199

Query: 293  EEVSRLQI 300
            ++V  LQI
Sbjct: 1200 QDV-WLQI 1206

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 86/356 (24%), Positives = 156/356 (43%), Gaps = 47/356 (13%)

Query: 8   LYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLN 67
           ++   TI+  G    K    L  G ++QV+ A  S  D      +  L +  +  ++ + 
Sbjct: 104 IFRRQTIIRKGIKDFKFGDMLGDGSYSQVFLA-TSKTDSSKTYAVKVLNKEYLIKQKKVK 162

Query: 68  TLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNR 127
            +  E  A++ LK+   V++   +   ++       ++ L+E+   G  +  +  +    
Sbjct: 163 YVNIEKTALQNLKSVTGVINLSFTFQDEA------NLYFLLEYAPNGDFLSLI--KKFGT 214

Query: 128 LRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPP 187
           L E   +   +Q +  I +MH+    +IHRDIK EN+L+  N   K+ DFG+   + +  
Sbjct: 215 LNEECTIYYSAQIIDAIGSMHSHG--IIHRDIKPENILLDGNMKIKLTDFGTAKLLQKKS 272

Query: 188 RNTQEFNYVQHDILTNT-----TAQYRSPEMI-DLYRGLPIDEKSDIWALGIFLYKICYY 241
               + +Y   ++LT +     TA+Y SPE++ D Y     D K DIWA G  +Y++   
Sbjct: 273 DKNGKPHY---NLLTRSSSFVGTAEYVSPELLSDNY----TDYKCDIWAFGCLVYQMIAG 325

Query: 242 TTPFEKSGEAGILH--ARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299
             PF+ + E        + Q+     +   +++L++ +L++ P KR  I Q+ E      
Sbjct: 326 KPPFKATNEYLTFQKVMKVQFAFTAGFPTIIRDLVKNILVKQPEKRLTIPQIKEH----- 380

Query: 300 IKPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQKFLPAQ-GLQSMKPISNMIPVS 354
              C   N       S  +    +PP        K LP +   +SM+P S  IP S
Sbjct: 381 ---CLFENI----NFSDNSVWNRDPP--------KILPYRINAKSMQPFSPPIPQS 421

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 140/301 (46%), Gaps = 33/301 (10%)

Query: 11  PGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLR 70
           P  I T G  + + + +L  GGFA+ +  +      +    +A   ++ +  ++    L 
Sbjct: 63  PSLIKTKGRDYHRGM-FLGEGGFARCFQMKDDSGKVFAAKTVA---KISIKSEKTRKKLL 118

Query: 71  AEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRE 130
           +E+   K +K+  ++V + D     +       V++L+E C  G L+D +  R Q  L E
Sbjct: 119 SEIQIHKSMKH-PNIVQFTDCFEDDT------NVYILLEICPNGSLMDLLKQRKQ--LTE 169

Query: 131 SEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNT 190
            E+    +Q V  I  MH+ +  +IHRD+K+ N+    +   K+ DFG ++ V+    N 
Sbjct: 170 PEVRFFTTQIVGAIKYMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG-LAAVL---AND 223

Query: 191 QEFNYVQHDILTNTTAQYRSPEMI-DLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSG 249
           +E  Y         T  Y +PE++   + G   +   DIW++G+ +Y +     PF+ + 
Sbjct: 224 RERKYT-----ICGTPNYIAPEVLTGKHTGHSFE--VDIWSIGVMIYALLIGKPPFQ-AK 275

Query: 250 EAGILHAR-----YQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQIKPCP 304
           E   ++ R     + +P     S   K LI+ +L   P +RP++ +++E V    + P  
Sbjct: 276 EVNTIYERIKVCDFSFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYVWFRNVFPAR 335

Query: 305 I 305
           I
Sbjct: 336 I 336

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 79/289 (27%), Positives = 130/289 (44%), Gaps = 57/289 (19%)

Query: 17  VGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAM 76
           VG++  KI+K +  G F +VY A   P    T+  + CLK     DK   N +R      
Sbjct: 38  VGNY--KILKQIGEGSFGKVYLALHRP----THRKV-CLK---TSDKNDPNIVR------ 81

Query: 77  KLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEI 136
           ++  + +    YI       V     +V++ +E+C    L D + +   +R+   E  E+
Sbjct: 82  EVFYHRQFDFPYITKLYEVIV--TESKVWMALEYCPGKELYDHLLS--LHRISLLECGEL 137

Query: 137 MSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYV 196
            +Q    +   H++    +HRD+K+EN+L+  NG  K+ DFG                  
Sbjct: 138 FAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG-----------------F 178

Query: 197 QHDILTNTTAQ-------YRSPEMID--LYRGLPIDEKSDIWALGIFLYKICYYTTPFEK 247
             + +T TT +       Y +PE+I    Y G  I    D W+LG+ LY +   + PF+ 
Sbjct: 179 TRECMTKTTLETVCGTTVYMAPELIGRKTYDGFKI----DTWSLGVILYTLITGSLPFDD 234

Query: 248 SGEA----GILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVL 292
             EA     I++   +Y P     D  K+LI  +L + P +RP++ QVL
Sbjct: 235 DDEAKTKWKIVNEEPKYDP-KLIPDDAKDLISRLLAKNPGERPSLPQVL 282

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 102/201 (50%), Gaps = 33/201 (16%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIE 162
           +V++ +E+C    L D++   +  R+   E   + +Q V  +   H+L    +HRD+K+E
Sbjct: 102 KVWMSLEYCPGKELYDYL--LVMRRIPLDECSRLFAQIVGAVYYAHSLN--CVHRDLKLE 157

Query: 163 NVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGL 220
           N+L+   G  K+ DFG         +N       Q + +  TT  Y +PE++  D Y G 
Sbjct: 158 NILLDMQGNAKLADFGFTREC--ATKN-------QLETICGTTV-YMAPELLRRDTYDGF 207

Query: 221 PIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQYPPF---PQYSDRLKN----- 272
            I    DIW+LG+ LY +   + PF++  E      R ++      P Y++++ N     
Sbjct: 208 KI----DIWSLGVILYTLINGSMPFDEEDE-----TRTEWKIINEEPDYNEKIFNANSIE 258

Query: 273 LIRLMLMETPSKRPNICQVLE 293
           LI+ +L++ P KRP++ ++L+
Sbjct: 259 LIKSLLIKDPKKRPSMTEILK 279

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 132/281 (46%), Gaps = 30/281 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +      +    +A   ++ +  ++    L +E+   K +K+  ++V
Sbjct: 97  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTKKKLLSEIQIHKSMKH-PNIV 152

Query: 87  SYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAA 146
            ++D     +       V++L+E C  G L+D M  R    L E E+    +Q    +  
Sbjct: 153 HFVDCFEDDT------NVYILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQICGAVKY 204

Query: 147 MHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTA 206
           MH+ +  +IHRD+K+ N+    +   KV DFG ++ V+    N +E  Y         T 
Sbjct: 205 MHSRR--VIHRDLKLGNIFFDKDYNLKVGDFG-LAAVLA---NNRERKYT-----VCGTP 253

Query: 207 QYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHAR-----YQYP 261
            Y +PE++ + +      + DIW++G+ +Y +     PF+ + +  +++ R     Y YP
Sbjct: 254 NYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQ-AKDVNVIYDRIKACQYGYP 311

Query: 262 PFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQIKP 302
                S   K LI  +L   P +RP+I +++++V    I P
Sbjct: 312 KDKYVSSEAKTLIADILCVDPVERPSIREIIDDVWFRGIFP 352

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 135/276 (48%), Gaps = 40/276 (14%)

Query: 28  LTSGGFAQVYTA-EISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKH-- 84
           +  G    VYTA E+      TNA++A  +  +  +KQ    L   ++ + ++K +KH  
Sbjct: 629 IGQGASGGVYTAYEVG-----TNASVAIKQMNL--EKQPKKELI--INEILVMKGSKHQN 679

Query: 85  VVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGI 144
           +V++IDS+  K       +++V+ME+ E G L D +   +   L E++I  +  +T++G+
Sbjct: 680 IVNFIDSYVLKG------DLWVVMEYMEGGSLTDVVTHCI---LTEAQIGAVCRETLRGL 730

Query: 145 AAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNT 204
             +H+    +IHRDIK +N+L+S NG  K+ DFG  + +        E N  +  ++   
Sbjct: 731 QFLHSKG--VIHRDIKSDNILLSMNGEIKLTDFGFCAQI-------NEINLKRTTMV--G 779

Query: 205 TAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF--EKSGEAGILHARYQYPP 262
           T  + +PE++      P   K DIW+LGI + ++     P+  E    A  L A    P 
Sbjct: 780 TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPK 836

Query: 263 FPQ---YSDRLKNLIRLMLMETPSKRPNICQVLEEV 295
             +    S  LK+ +   L   P  R +  ++L +V
Sbjct: 837 LKEPEVLSPELKSFLAWCLNVNPDTRASATELLRDV 872

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 80.1 bits (196), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 134/276 (48%), Gaps = 31/276 (11%)

Query: 23  KIIKYLTSGGFAQVYTAEISPPDPYTNAN-IACLKRVIVPD-KQGLNTLRAEVDAMKLLK 80
           +I++ +  G F  VY A       Y   N I  +K V + D  + ++ L  E+  +  L+
Sbjct: 21  EILQCIGRGNFGDVYKAR------YLATNEIVAIKVVNLEDTDEPIDLLAQEIFFLSELR 74

Query: 81  NNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQT 140
           +      YI ++  K+   V   ++++ME+C  G   + +    +++L E +   I+S+ 
Sbjct: 75  S-----PYITNY--KTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSEV 127

Query: 141 VQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDI 200
           + G+  +H+ +   IHRDIK  N+L++ NG  K+ DFG VSG +   R    F       
Sbjct: 128 LVGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTF------- 177

Query: 201 LTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQY 260
               T  + +PE+ID  +    +E +DIW+LGI + ++     P +K      L A  + 
Sbjct: 178 --VGTPFWMAPEVIDRNKK-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKR 234

Query: 261 PP---FPQYSDRLKNLIRLMLMETPSKRPNICQVLE 293
            P     ++S   K+ +   L++ PS+RP   ++L+
Sbjct: 235 DPPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLK 270

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 69/285 (24%), Positives = 132/285 (46%), Gaps = 32/285 (11%)

Query: 27  YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +      +    +A   ++ +  ++    L +E+   K +K++ ++V
Sbjct: 100 FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTKRKLLSEIQIHKSMKHS-NIV 155

Query: 87  SYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAA 146
            +ID     +       V++L+E C  G L+D +  R    L E E+    +Q    I  
Sbjct: 156 QFIDCFEDDA------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIKY 207

Query: 147 MHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTA 206
           +H+ +  +IHRD+K+ N+    +   KV DFG ++ V+    N +E  Y         T 
Sbjct: 208 LHSRR--IIHRDLKLGNIFFDKDYNLKVGDFG-LAAVL---ANDRERKYT-----VCGTP 256

Query: 207 QYRSPE-MIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHAR-----YQY 260
            Y +PE ++  + G   +   DIW++G+ +Y +     PF+ + +  +++ R     Y Y
Sbjct: 257 NYIAPEVLMGKHSGHSFE--VDIWSIGVMIYALLVGKPPFQ-AKDVNVIYERIKLCKYGY 313

Query: 261 PPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQIKPCPI 305
           P     S   + LI  +L   P +RP I  ++++V    + P  I
Sbjct: 314 PKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDVWFRGVFPARI 358

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 125/282 (44%), Gaps = 48/282 (17%)

Query: 31   GGFAQVYTAEISPPDPYTNANIACLKRVIVPD--------KQGLNTLRAEVDAMKLLKNN 82
            G F  VY +        T   +  +K+V VP         K  +  L++EV  +K L ++
Sbjct: 1160 GSFGAVYLSL-----NITTGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDL-DH 1213

Query: 83   KHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQ 142
             ++V Y+ S     + G  Y +F  +E+   G +   +  RL  R  E  I  + +Q + 
Sbjct: 1214 LNIVQYLGSE----IRGNIYSLF--LEYVAGGSVGSLI--RLYGRFDEKLIRHLNTQVLS 1265

Query: 143  GIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILT 202
            G+  +H+    ++HRD+K +N+L+  +G+ K+ DF    G+ +  +N     Y   D+  
Sbjct: 1266 GLKYLHS--KGILHRDMKADNLLLDEDGICKISDF----GISKKSKNI----YSNSDMTM 1315

Query: 203  NTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQY-- 260
              T  + +PEM+D  +G     K DIW+LG  + ++     P+       ++ A +Q   
Sbjct: 1316 RGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPW---SNLEVVAAMFQIGK 1370

Query: 261  ----PPFPQ-----YSDRLKNLIRLMLMETPSKRPNICQVLE 293
                PP P       S + K+ +       P KRP    +LE
Sbjct: 1371 SKSAPPIPDDTIQLISSKGKDFLSKCFEIDPEKRPTADDLLE 1412

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 133/282 (47%), Gaps = 35/282 (12%)

Query: 19  SHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKL 78
           +H+  + + +  G F  VY A     D  TN  +A     +    + L  L  E+  +  
Sbjct: 19  AHNYIVKECVGRGNFGDVYRA----IDRTTNKVVAIKVVDLENTNERLEVLAQEIFFLAE 74

Query: 79  LKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMS 138
           LK+  ++++YI +    +       ++++ME+C  G   D +     N L E ++  I  
Sbjct: 75  LKS-PYIINYITTLLEDA------SMWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYITR 127

Query: 139 QTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQH 198
           + ++G+  +H  +   IHRDIK  N+L++  G  K+ DFG VSG ++        + ++ 
Sbjct: 128 EILKGLQYLHEQKK--IHRDIKAANILLTEEGHVKLGDFG-VSGQLK--------STLRR 176

Query: 199 DILTNTTAQYRSPEM----IDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL 254
             +   T  + +PE+    I+ Y     DEK DIW+LGI ++++     P  K     +L
Sbjct: 177 GTIVG-TPYWMAPEVASQNIEGY-----DEKIDIWSLGITVFELLKGVPPLVKLDPIRVL 230

Query: 255 H--ARYQYPPFP-QYSDRLKNLIRLMLMETPSKRPNICQVLE 293
              +R   P     YSD  K+ + L L++ P++RP    +L+
Sbjct: 231 ANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERPAAVDLLK 272

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 78/291 (26%), Positives = 131/291 (45%), Gaps = 61/291 (20%)

Query: 17  VGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAM 76
           VG++  KI+K +  G F +VY A   P    T+  + CLK     DK   N +R      
Sbjct: 38  VGNY--KILKQVGEGSFGKVYLALHRP----THRKV-CLK---TSDKNDPNIVR------ 81

Query: 77  KLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEI 136
           ++  + +    YI       V     +V++ +E+C    L D + +   +R+   E  E+
Sbjct: 82  EVFYHRQFDFPYITKLYEVIV--TETKVWMALEYCPGKELYDHLLS--LHRISLLECAEL 137

Query: 137 MSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYV 196
            +Q    +   H++    +HRD+K+EN+L+  NG  K+ DFG                  
Sbjct: 138 FAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG-----------------F 178

Query: 197 QHDILTNTTAQ-------YRSPEMID--LYRGLPIDEKSDIWALGIFLYKICYYTTPFEK 247
             + +T TT +       Y +PE+I+   Y G  I    DIW+LG+ LY +   + PF+ 
Sbjct: 179 TRECMTKTTLETVCGTTVYMAPELIERRTYDGFKI----DIWSLGVILYTLITGSLPFDD 234

Query: 248 SGEAGILHARYQ-YPPFPQYS-----DRLKNLIRLMLMETPSKRPNICQVL 292
             E   +  +++     P Y      D  K+LI  +L + P +RP++ QVL
Sbjct: 235 DDE---VKTKWKIVNEEPNYDSTLIPDDAKDLISRLLAKNPKERPSLPQVL 282

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 114/247 (46%), Gaps = 26/247 (10%)

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMN 121
           D+  +  ++ E+  +  LK   ++  Y  S+   +       ++++ME+C  G L   + 
Sbjct: 71  DEDEVEDVQKEIQFLASLKQLPNITRYYGSYLKNT------SLWIIMEYCGGGSLRSLLR 124

Query: 122 TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVS 181
                ++ E  I  IM + +  +  +H  +  +IHRDIK  NVLI+++G  K+CDFG  +
Sbjct: 125 ---PGKIDEKYIGVIMREILIALKYIH--KDNVIHRDIKAANVLINNDGSIKLCDFGVAA 179

Query: 182 GVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYY 241
            + +     Q             T  + +PE+I    G+  D K+DIW+ GI  Y++   
Sbjct: 180 QLNQTKSRRQTM---------AGTPYWMAPEVI--MEGVYYDTKADIWSTGITAYEVTTG 228

Query: 242 TTPF--EKSGEAGILHARYQYPPFP--QYSDRLKNLIRLMLMETPSKRPNICQVLEEVSR 297
             P+   ++  A  L A+ + P      YS  +K  I   L E PS+RP   ++L+    
Sbjct: 229 NPPYCDVEALRAMQLIAKSKPPRLEGRNYSALIKEFIATCLDEDPSERPTADELLKTAFI 288

Query: 298 LQIKPCP 304
              KP P
Sbjct: 289 KTYKPLP 295

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 83/180 (46%), Gaps = 22/180 (12%)

Query: 115  GLIDFMN-TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYK 173
            G ID  +    +  + E E   I  Q V  I  +H     ++HRDIK ENV++   G  K
Sbjct: 1129 GCIDLFDLIEFKTNMSEVETKLIFMQVVSSIKFLH--DQGIVHRDIKDENVIVDSQGFIK 1186

Query: 174  VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIWAL 231
            + DFGS + V   P           D+   T   Y +PE++  + Y G P     DIWA+
Sbjct: 1187 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYVGKP----QDIWAI 1231

Query: 232  GIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQV 291
            GI LY I +   PF    E  IL A  ++       +   +LI+ +L   P+KRP I ++
Sbjct: 1232 GILLYTIIFKENPFYNIDE--ILEAELKFNTSTGACEDCVDLIKRILTRNPTKRPTIDEI 1289

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 79/270 (29%), Positives = 135/270 (50%), Gaps = 40/270 (14%)

Query: 31  GGFAQVYTA-EISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKH--VVS 87
           G    VYTA E+      TNA++A +K++ + +KQ    L   ++ + ++K +KH  +V+
Sbjct: 338 GASGGVYTAYELG-----TNASVA-IKQMNL-EKQPKKELI--INEILVMKGSKHSNIVN 388

Query: 88  YIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAM 147
           +IDS+  K       +++V+ME+ E G L D +   +   L E +I  +  +T++G+  +
Sbjct: 389 FIDSYLLKG------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLKGLQFL 439

Query: 148 HALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQ 207
           H+    +IHRDIK +N+L+S NG  K+ DFG  + +        E N  +  ++   T  
Sbjct: 440 HSKG--VIHRDIKSDNILLSMNGDIKLTDFGFCAQI-------NEVNLKRTTMV--GTPY 488

Query: 208 YRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF--EKSGEAGILHARYQYPPF-- 263
           + +PE++      P   K DIW+LGI + ++     P+  E    A  L A    P    
Sbjct: 489 WMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKD 545

Query: 264 PQ-YSDRLKNLIRLMLMETPSKRPNICQVL 292
           P+  SD LK  +   L   P  R N  ++L
Sbjct: 546 PENLSDTLKEFLGWCLKVDPEDRANAAELL 575

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 128/275 (46%), Gaps = 32/275 (11%)

Query: 27  YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +    D +    +A   +  +  ++    L +E+   K + +  ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGDIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMAH-PNIV 142

Query: 87  SYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAA 146
            +ID     S       V++L+E C  G L++ +  R    L E E+    +Q    I  
Sbjct: 143 QFIDCFEDDS------NVYILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQICGAIKY 194

Query: 147 MHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTA 206
           MH+ +  +IHRD+K+ N+    N   K+ DFG ++ V+    N  E  Y         T 
Sbjct: 195 MHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYT-----ICGTP 243

Query: 207 QYRSPE-MIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHAR-----YQY 260
            Y +PE ++  + G   +   DIW+LG+ LY +     PF+ + +   ++ R     + +
Sbjct: 244 NYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDFSF 300

Query: 261 PPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEV 295
           P     SD  K LIR +L   P +RP++ ++++ V
Sbjct: 301 PKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 79.7 bits (195), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 96/197 (48%), Gaps = 24/197 (12%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           ++++ME+C  G   D +     N + E ++  I SQ ++G+  +H  +   IHRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLHEQKK--IHRDIKAAN 143

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI----DLYRG 219
           +L++  G  K+ DFG VSG IR       F           T  + +PE++    D Y  
Sbjct: 144 ILLTDEGTVKLGDFG-VSGQIRATLKRGTF---------VGTPYWMAPEVVSKENDGY-- 191

Query: 220 LPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL-HARYQYPP--FPQYSDRLKNLIRL 276
              DEK+DIW+LGI +Y++     P  K     ++ +   + PP     YS   KN +  
Sbjct: 192 ---DEKADIWSLGITVYELLKGAPPLSKCDPMKVMINLPKRKPPALHGHYSHSAKNFVSS 248

Query: 277 MLMETPSKRPNICQVLE 293
            L++ P  R +  +++E
Sbjct: 249 CLVKNPVGRASAYEMVE 265

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 81/341 (23%), Positives = 156/341 (45%), Gaps = 37/341 (10%)

Query: 26  KYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHV 85
           ++L  GGFA+ +  +      +    +A   ++ +  ++    L +E+   K + ++ ++
Sbjct: 85  QFLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSM-SHTNI 140

Query: 86  VSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIA 145
           V +ID     +VN     V++L+E C  G L++ +  R    + E E+   M+Q   GI 
Sbjct: 141 VQFIDCFE-DNVN-----VYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQICGGIQ 192

Query: 146 AMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTT 205
            MH+ +  +IHRD+K+ N+    +   K+ DFG ++ V+   R        +       T
Sbjct: 193 YMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFG-LAAVLANDR--------ERKFTICGT 241

Query: 206 AQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHAR-----YQY 260
             Y +PE++ + +      + DIW++G+ LY +     PF+ + +   ++ R     + Y
Sbjct: 242 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQ-AKDVNTIYERIKQRNFAY 299

Query: 261 PPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVS-RLQIKPCPIRNFYLLRAMSQTAQ 319
           P   + S   K LI  +L   P +RP+I ++++ V  R    P     + L   M+    
Sbjct: 300 PKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYVWFRGTFPP-----YTLNSVMTTVPD 354

Query: 320 LASEPPSMKYVPTQKFLPAQGLQSMKPISNMIPVSHVRTTP 360
            +   P   ++  Q  L A GL S+   ++M+     RT P
Sbjct: 355 YSHITPQESFMNFQNCLEASGLLSVHQ-NHMVANISERTVP 394

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 60/183 (32%), Positives = 85/183 (46%), Gaps = 24/183 (13%)

Query: 112  ERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGL 171
            E G +  F    L+  + E E   +  Q   G+  +H     ++HRDIK ENV++ + G 
Sbjct: 1155 ETGSIDLFDLIELKTNMTEYEAKLLFKQITSGVKHLH--DNGIVHRDIKDENVIVDNKGC 1212

Query: 172  YKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIW 229
             K+ DFGS + V R P           D+   T   Y +PE++  D Y G P     DIW
Sbjct: 1213 VKLIDFGSAAYVKRGP----------FDVFVGTI-DYAAPEVLEGDPYEGKP----QDIW 1257

Query: 230  ALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRP--- 286
            A+G+ LY I Y   PF    E  IL    +  P    S+    LI ++L  + SKRP   
Sbjct: 1258 AIGVLLYTIIYKENPFYNVDE--ILDGDLRINPSVIVSEECVALITMVLDRSLSKRPTVD 1315

Query: 287  NIC 289
            +IC
Sbjct: 1316 DIC 1318

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 79.7 bits (195), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 96/192 (50%), Gaps = 17/192 (8%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           ++++MEFC  G   D +    ++RL E+++  I+ + + G+  +H+ +   IHRD+K  N
Sbjct: 107 MWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLYGLEYLHSQRK--IHRDVKAAN 164

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPID 223
           +L++  G  K+ DFG VSG I        F           T  + +PE+I    G   D
Sbjct: 165 ILLTDEGEVKLGDFG-VSGQIMATLKRNTF---------VGTPYWMAPEIIARDNGY--D 212

Query: 224 EKSDIWALGIFLYKICYYTTPFEKSGEAGIL-HARYQYPPFPQ--YSDRLKNLIRLMLME 280
           EK+DIW+LGI   ++     P+ K     +L +   + PP  Q  ++   ++ I L L +
Sbjct: 213 EKADIWSLGITAMELLTGQPPYAKYDPMKVLMNIPLRKPPRLQGRFTSSARDFIALCLTK 272

Query: 281 TPSKRPNICQVL 292
            P+ RP    +L
Sbjct: 273 DPALRPTASDLL 284

>TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {ON}
           Anc_5.406 YHR102W
          Length = 996

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 113/241 (46%), Gaps = 36/241 (14%)

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMN 121
           D   +  ++ E+  + LL+   ++  Y  S+       +  +++++ME+C  G + + + 
Sbjct: 42  DINEIQDIQNEIKFLSLLRYAPNITYYYHSYL------INRKIWIIMEYCNGGSVRNLIK 95

Query: 122 TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVS 181
                R  E  I  I+ + +  +  +H     +IHRDIK  N+LI+ NG  K+CDFG  +
Sbjct: 96  I---GRFNEIYISVILRELLYALEYIH--HDNIIHRDIKAANILINQNGGIKLCDFGIAA 150

Query: 182 GV--IRPPRNTQEFNYVQHDILTNTTAQYRSPEMI---DLYRGLPIDEKSDIWALGIFLY 236
            +   +P R T              T  + +PE+I    LY     D K+DIW++GI  Y
Sbjct: 151 KLEFSKPKRQTMA-----------GTPYWMAPEVIIESSLY-----DTKADIWSVGITAY 194

Query: 237 KICYYTTPFEK--SGEAGILHARYQYPPFP--QYSDRLKNLIRLMLMETPSKRPNICQVL 292
           +I     P+ +  + +A  L  + + P      YS  LK  I L L E PS+R    ++L
Sbjct: 195 EITTGNPPYCEYDATKAMQLITKLKPPRLEGKMYSKSLKEFIALCLDEDPSERLTSTKLL 254

Query: 293 E 293
           E
Sbjct: 255 E 255

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 133/281 (47%), Gaps = 30/281 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +      +    +A   ++ +  ++    L +E+   K +++  +VV
Sbjct: 96  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHF-NVV 151

Query: 87  SYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAA 146
            +ID     +       V++L+E C  G L++ +  R    + E E+   M+Q    I  
Sbjct: 152 QFIDCFEDDT------NVYILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQICGAIKY 203

Query: 147 MHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTA 206
           MH+ +  +IHRD+K+ N+    N   K+ DFG ++ V+    N +E  Y         T 
Sbjct: 204 MHSRR--VIHRDLKLGNIFFDKNYNLKIGDFG-LAAVL---ANDRERKYT-----VCGTP 252

Query: 207 QYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHAR-----YQYP 261
            Y +PE++ + +      + DIW++G+ +Y +     PF+ S +  +++ R     + +P
Sbjct: 253 NYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ-SKDVNMIYERIKNRDFAFP 310

Query: 262 PFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQIKP 302
                S+  K LI  +L   P +RP+I ++++ V    I P
Sbjct: 311 KDKYISNEAKTLIHDILSTDPLERPSIEEIIDYVWFRGIFP 351

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 100/196 (51%), Gaps = 24/196 (12%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           ++++ME+C  G   D +     N L E ++  I+ +   G+  +H  +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEM----IDLYRG 219
           +L++  G+ K+ DFG VSG IR        + ++ D     T  + +PE+    +D Y  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--------STLKRDTFVG-TPYWMAPEVVCCEVDGY-- 194

Query: 220 LPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL-HARYQYPPFPQ--YSDRLKNLIRL 276
              +EK+DIW+LGI  Y++     P  K     ++ +   + PP  Q  +SD  K+ +  
Sbjct: 195 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSDAAKDFVAG 251

Query: 277 MLMETPSKRPNICQVL 292
            L++TP+ RP+   +L
Sbjct: 252 CLVKTPADRPSAYNLL 267

>CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]
           {ON} similar to uniprot|P38990 Saccharomyces cerevisiae
           YER129w Serine/threonine-protein kinase
          Length = 1162

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 123/280 (43%), Gaps = 58/280 (20%)

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLI--- 117
           P K   + ++ E+  MK   ++KHVV  I+       +  + ++++++E+C RG +    
Sbjct: 188 PGKTENDKIKREIAIMKKC-HHKHVVKLIEVLD----DLKSRKIYLVLEYCSRGEVKWCP 242

Query: 118 -DFMNTRLQ--NRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKV 174
            D + T  +  + L      EI+   V G+  +H     +IHRDIK  N+L+S  G+ K+
Sbjct: 243 PDCLETEAKGPSPLSFQFTREILRGVVLGLEYLH--YQGIIHRDIKPANLLLSETGIVKI 300

Query: 175 CDFG-----SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--------------D 215
            DFG     S S V        E    +    T  T  + +PE+               +
Sbjct: 301 SDFGVSLAASSSNVDGSDETIDELELAK----TAGTPAFFAPEICLGEDAFEKYQLDREE 356

Query: 216 LYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQYP-PFPQYSDRLKN-- 272
           L++G  I  K DIWALG+ LY + +   PF  S E  +       P  FP+YSD LKN  
Sbjct: 357 LFKGSCISFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPKYSDMLKNNQ 416

Query: 273 ---------------LIRLMLMETPSKRPNICQVLEEVSR 297
                          L+  +L + P KR NI    EE+ R
Sbjct: 417 VLQMTEEAEYEAAKDLLTRLLEKNPIKRINI----EEIKR 452

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 94/201 (46%), Gaps = 33/201 (16%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIE 162
           E+++++E+ E G L D++ +R   +L E E +    Q VQG++  H     + HRD+K E
Sbjct: 141 ELYLVLEYVEGGELFDYLISR--GKLPEQEAVHYFKQIVQGVSYCHHFN--ICHRDLKPE 196

Query: 163 NVLISHNGL-YKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTA---QYRSPEMI--DL 216
           N+L+    L  K+ DFG  +                 D L  T+     Y SPE++    
Sbjct: 197 NLLLDKKNLSVKIADFGMAA-------------LETTDKLLETSCGSPHYASPEIVMGQK 243

Query: 217 YRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL----HARYQYPPFPQYSDRLKN 272
           Y G P    SD+W+ GI L+ +     PF       +L      +YQ P     S+  K+
Sbjct: 244 YHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMP--QNISNEAKD 297

Query: 273 LIRLMLMETPSKRPNICQVLE 293
           LI  +L+  P+ R  I +VLE
Sbjct: 298 LIAKILIVDPAMRITIDEVLE 318

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 79/285 (27%), Positives = 134/285 (47%), Gaps = 49/285 (17%)

Query: 31  GGFAQVYTA-EISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKH--VVS 87
           G    VYTA E+      TNA++A  +  +  +KQ    L   ++ + ++K +KH  +V+
Sbjct: 664 GASGGVYTAYELG-----TNASVAIKQMNL--EKQPKKELI--INEIMVMKGSKHRNIVN 714

Query: 88  YIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAM 147
           +IDS+  K       +++V+ME+ E G L D +   +   L E +I  +  +T+ G+  +
Sbjct: 715 FIDSYLLKG------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLAGLQFL 765

Query: 148 HALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQ 207
           H+    +IHRDIK +N+L+S  G  K+ DFG  + +        E N  +  ++   T  
Sbjct: 766 HSKG--VIHRDIKSDNILLSMTGEIKLTDFGFCAQI-------NEINLKRTTMV--GTPY 814

Query: 208 YRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF--EKSGEAGILHARYQYPPFPQ 265
           + +PE++      P   K DIW+LGI + ++     P+  E    A  L A    P   +
Sbjct: 815 WMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKE 871

Query: 266 ---YSDRLKNLIRLMLMETPSKR---------PNICQVLEEVSRL 298
                + L+N +   L   P +R         P + QV EE S L
Sbjct: 872 PDNLGEELQNFLDWCLTVEPDQRASSSQLLKDPFVTQVAEENSSL 916

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 102/202 (50%), Gaps = 35/202 (17%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIE 162
           +V++ +E+C    L D + +   +R+   E +++ +Q V G+   H+L    +HRD+K+E
Sbjct: 103 KVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVGGVHYAHSLN--CVHRDLKLE 158

Query: 163 NVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDL--YRGL 220
           N+L+  +G  K+ DFG     +   + T E        +  TT  Y +PE+I+   Y G 
Sbjct: 159 NILLDKSGDAKLTDFGFTRECM--TKTTLE-------TICGTTV-YMAPELIERKSYDGF 208

Query: 221 PIDEKSDIWALGIFLYKICYYTTPF----EKSGEAGILHARYQYPPFPQYSDRL-----K 271
            I    DIW+LG+ LY +   + PF    E   E  I+H        PQ ++ +     K
Sbjct: 209 KI----DIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQT------PQLNENIVTADAK 258

Query: 272 NLIRLMLMETPSKRPNICQVLE 293
           +LI  +L + P+ RP + Q+L+
Sbjct: 259 DLILRLLAKNPNDRPTVEQILK 280

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 117/230 (50%), Gaps = 30/230 (13%)

Query: 73  VDAMKLLKNNKH--VVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRE 130
           ++ + ++K +KH  +V++IDS+    ++G   +++V+ME+ E G L D +   +   L E
Sbjct: 670 INEILVMKGSKHPNIVNFIDSYL---LDG---DLWVIMEYMEGGSLTDVVTHCI---LTE 720

Query: 131 SEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNT 190
            +I  +  +T+ G+  +H+    ++HRDIK +N+L+S NG  K+ DFG  + V       
Sbjct: 721 GQIGAVCRETLSGLQFLHSKG--VLHRDIKSDNILLSINGNIKLTDFGFCAQV------- 771

Query: 191 QEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF--EKS 248
            E    +  ++   T  + +PE++      P   K DIW+LGI + ++     P+  E  
Sbjct: 772 NETTLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETP 826

Query: 249 GEAGILHARYQYPPFPQ---YSDRLKNLIRLMLMETPSKRPNICQVLEEV 295
             A  L A    P   +    SD LK+ +   L   P +R +  ++LE+V
Sbjct: 827 LRALYLIATNGTPELKEREKLSDVLKHFLDWCLSVNPDQRASATELLEDV 876

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 134/300 (44%), Gaps = 39/300 (13%)

Query: 5   QISLYEPGTILTVGSHHAKII-KYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDK 63
           +I  ++ G+IL  GS    ++ ++ T+G  A V     S        N + +     PD 
Sbjct: 22  KIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKSIFGAVAQNNSSTIVGSNDPDL 81

Query: 64  QGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTR 123
                 R E+  MKLL N+ +V+   D    KS       +++++E+ E+G L + +  R
Sbjct: 82  LPYGIER-EIIIMKLL-NHTNVLRLYDVWETKS------NLYMVLEYVEKGELFNLLVER 133

Query: 124 LQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGV 183
               L E+E +    Q + GI+  HAL   ++HRD+K EN+L+ H    K+ DFG  +  
Sbjct: 134 --GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMAA-- 187

Query: 184 IRPPRNTQEFNYVQHDILTNTTA---QYRSPEMIDLYRGLPIDE-KSDIWALGIFLYKIC 239
                          D L  T+     Y +PE++    GLP    +SD+W+ G+ LY + 
Sbjct: 188 -----------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALL 233

Query: 240 YYTTPFE------KSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLE 293
               PF+      +S    +    Y+ P   + S   ++LI  +L   P +R    ++L+
Sbjct: 234 TGRLPFDEDNGNIRSLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILK 293

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 97/198 (48%), Gaps = 21/198 (10%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           ++ L+E+   G  +  +  +    L E+      SQ +  + ++H +   +IHRDIK EN
Sbjct: 199 LYFLLEYAPHGDFLGLI--KKYGSLNETCARYYASQIIDAVDSLHNIG--IIHRDIKPEN 254

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQE----FNYVQHDILTNTTAQYRSPEMI-DLYR 218
           +L+  N   K+ DFG+   +   P NT +    F+          TA+Y SPE++ D Y 
Sbjct: 255 ILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVGTAEYVSPELLNDNY- 313

Query: 219 GLPIDEKSDIWALGIFLYKICYYTTPFEKSGE----AGILHARYQYPP-FPQYSDRLKNL 273
               D + DIWA G  LY++     PF+ + E      ++  +Y +   FPQ    +K+L
Sbjct: 314 ---TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQI---VKDL 367

Query: 274 IRLMLMETPSKRPNICQV 291
           ++ +L+  P+ R  I Q+
Sbjct: 368 VKKLLVRDPNDRLTIKQI 385

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 81/340 (23%), Positives = 155/340 (45%), Gaps = 37/340 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +         +    +A   ++ +  ++    L +E+   K +KN  ++V
Sbjct: 88  FLGEGGFARCFQFNDDSGKIFAAKTVA---KLSIKSEKTRRKLLSEIQIHKSMKN-VNIV 143

Query: 87  SYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAA 146
            +ID     +       V++L+E C  G L+D +  R    L E E+    +Q    I  
Sbjct: 144 QFIDCFEDDT------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIKY 195

Query: 147 MHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTA 206
           MH+ +  +IHRD+K+ N+    +   K+ DFG ++ V+    N +E  Y         T 
Sbjct: 196 MHSRR--VIHRDLKLGNIFFDKDYNLKIGDFG-LAAVL---ANDRERKYT-----VCGTP 244

Query: 207 QYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHAR-----YQYP 261
            Y +PE++ + +      + DIW++G+ LY +     PF+ S +   ++ R     + +P
Sbjct: 245 NYIAPEVL-MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQ-SKDVNTIYERIKCCDFTFP 302

Query: 262 PFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQIKPCPIRNFYLLRAMSQTAQLA 321
                S   K LI+ +L   P +RP++ ++++ V    + P  I +  +    +   QL 
Sbjct: 303 KDKYISPEAKILIQDLLSLDPLERPSVDEIIDYVWFRGLFPPQIESDVMTNIPNYDNQLT 362

Query: 322 SEPPSMKYVPTQKFLPAQGLQS----MKPISNMIPVSHVR 357
            E   + +   +K L + GL S    + P S+  P+S ++
Sbjct: 363 MEQSIVNF---KKCLESSGLLSDAAAVNPSSDKQPISIIK 399

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 82/182 (45%), Gaps = 21/182 (11%)

Query: 112  ERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGL 171
            E G +  F      + + E EI  +  Q V G+  +H     ++HRDIK EN+++ + G 
Sbjct: 1211 ETGSIDLFDLIEFTSNMTEFEIKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDNKGF 1268

Query: 172  YKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIW 229
             K+ DFGS + V   P           D+   T   Y +PE++  + Y G P     DIW
Sbjct: 1269 IKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGNPYEGKP----QDIW 1313

Query: 230  ALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNIC 289
            ALGI LY I +   PF    E  IL    ++      S     LI+L+L     KRP I 
Sbjct: 1314 ALGILLYTIVFKENPFYNIDE--ILEGDLKFNDPENISQDCIELIKLILNRNVFKRPTID 1371

Query: 290  QV 291
             +
Sbjct: 1372 DI 1373

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 78/316 (24%), Positives = 143/316 (45%), Gaps = 43/316 (13%)

Query: 27  YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +    + +    +A   +  +  ++    L +E+   K + ++ ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAA 146
            +ID     S       V++L+E C  G L++ +  R    L E E+    +Q    I  
Sbjct: 143 QFIDCFEDDS------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIKY 194

Query: 147 MHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTA 206
           MH+ +  +IHRD+K+ N+    N   K+ DFG ++ V+    N  E  Y         T 
Sbjct: 195 MHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYT-----ICGTP 243

Query: 207 QYRSPE-MIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHAR-----YQY 260
            Y +PE ++  + G   +   DIW+LG+ LY +     PF+ + +   ++ R     + +
Sbjct: 244 NYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDFSF 300

Query: 261 PPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQIKPCPIRNFYLLRAMSQTAQL 320
           P     SD  K LIR +L   P +RP++ ++++ V      P  I            A +
Sbjct: 301 PKDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSI-----------PATV 349

Query: 321 ASEPPSMKYVPTQKFL 336
            SE P+ + VP ++ L
Sbjct: 350 MSEVPNFESVPDEQSL 365

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 139/284 (48%), Gaps = 31/284 (10%)

Query: 23  KIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPD-KQGLNTLRAEVDAMKLLKN 81
           +I++ +  G F  VY A        T+  I  +K V + D  + ++ L  E+  +  L++
Sbjct: 21  EILQCIGRGNFGDVYKAR-----DLTSNEIVAIKVVNLEDTDEPIDLLAQEIFFLSELRS 75

Query: 82  NKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTV 141
                 YI ++  K+   V   ++++ME+C  G   + +    ++++ E +   I+S+ +
Sbjct: 76  -----PYITNY--KTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVL 128

Query: 142 QGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDIL 201
            G+  +H+ +   IHRDIK  N+L++ NG  K+ DFG VSG +   R    F        
Sbjct: 129 IGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTF-------- 177

Query: 202 TNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQYP 261
              T  + +PE+ID  +    +E +DIW+LGI + ++     P +K      L A  +  
Sbjct: 178 -VGTPFWMAPEVIDRNKQ-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRD 235

Query: 262 P---FPQYSDRLKNLIRLMLMETPSKRPNICQVLEE--VSRLQI 300
           P     ++S   ++ +   L++ PS+RP   ++L+   V R+++
Sbjct: 236 PPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLKHRFVKRVRL 279

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 84/183 (45%), Gaps = 22/183 (12%)

Query: 115  GLIDFMN-TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYK 173
            G ID  +    +  + E E   I  Q V GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1214 GCIDLFDLIEFKTNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGCVK 1271

Query: 174  VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIWAL 231
            + DFGS + V   P           D+   T   Y +PE++  + Y G P     DIWA+
Sbjct: 1272 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLSGEPYEGKP----QDIWAI 1316

Query: 232  GIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQV 291
            GI LY I +   PF    E  IL    ++      S+    LI+ +L+ +  KRP I ++
Sbjct: 1317 GILLYTIVFKENPFYNIDE--ILEGELKFNNSNDISEDCIELIKKILIRSVPKRPLIEEI 1374

Query: 292  LEE 294
              +
Sbjct: 1375 FND 1377

>TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa] {ON}
            Anc_6.341 YNR031C
          Length = 1575

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 138/309 (44%), Gaps = 56/309 (18%)

Query: 27   YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLN----TLRAEVDAMKLLKNN 82
            ++  G F  VY+A         N  I  +K + + D   +     +++ E+  +++L ++
Sbjct: 1268 FVGGGTFGTVYSAV-----NLDNGEILAVKEIKIQDANAMKKFFPSIKEEMSVLEML-SH 1321

Query: 83   KHVVSY--IDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMS-Q 139
             +VV Y  ++ H  K        V + ME+CE G +   +      R+ +  + ++ + +
Sbjct: 1322 PNVVQYYGVEVHRDK--------VNIFMEYCEGGSMASLLE---HGRIEDEMVTQVYTLE 1370

Query: 140  TVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEF------ 193
             ++G+A +H  Q  ++HRDIK EN+L+  NG+ K  DFG+   + +   +T+ F      
Sbjct: 1371 LLEGLAYLH--QSGVVHRDIKPENILLDFNGIIKYVDFGAAKKIAKNGTDTRGFARSVAS 1428

Query: 194  --------NYVQHDILT----NTTAQYRSPEMIDLYRGLPIDEK---SDIWALGIFLYKI 238
                    N  + D L       T  Y +PE I    G P   +    DIW+LG  + ++
Sbjct: 1429 DSSTGSADNTSEQDGLALQDMMGTPMYMAPESI---TGSPNKGRLGADDIWSLGCVILEM 1485

Query: 239  CYYTTPFEK-SGEAGILH--ARYQYPPFP---QYSDRLKNLIRLMLMETPSKRPNICQVL 292
                 P+ K   E  I++  A    P  P   + S   K  +R  L E P KR +  ++L
Sbjct: 1486 ITGRRPWAKLDNEWAIMYHVAAGHIPQLPSNDEVSSAGKKFLRRCLQENPFKRASAVELL 1545

Query: 293  EEVSRLQIK 301
             +   +QI+
Sbjct: 1546 MDPWIVQIR 1554

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 94/197 (47%), Gaps = 27/197 (13%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIE 162
           +V++ +E+C    L D + ++  +RL   E  E+ +Q    +   H L    +HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLE 162

Query: 163 NVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDL--YRGL 220
           NVL+  NG  K+ DFG            +       + +  TT  Y +PEMI    Y G 
Sbjct: 163 NVLLDKNGNAKLTDFGFTR---------ESMTKAVLETVCGTTV-YMAPEMIQHKPYDGF 212

Query: 221 PIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRL-----KNLIR 275
            +    DIW+LG+ LY +     PF++  +  +L  +      P   +R+     +NLI 
Sbjct: 213 KV----DIWSLGVILYTLLCGCLPFDEDDD--LLTKQKIINDTPVIDERITIPEAQNLIE 266

Query: 276 LMLMETPSKRPNICQVL 292
            +L + P++RPN   +L
Sbjct: 267 QLLSKDPTERPNTSAIL 283

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 127/278 (45%), Gaps = 42/278 (15%)

Query: 31   GGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLN--TLRAEVDAMKL----LKNNKH 84
            G F  V+ A        T   +  +K+V VP K GL   T+   VDA++L    LK+  H
Sbjct: 1149 GSFGAVFLAM-----NITTGEMMAVKQVEVP-KYGLQNETVVNTVDALRLEVSTLKDLDH 1202

Query: 85   --VVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQ 142
              +V Y+   A    NG+ Y +F  +E+   G +   +  R+  R  +  I  +  Q +Q
Sbjct: 1203 LNIVQYLGFEAK---NGI-YSLF--LEYVAGGSVGSLI--RMYGRFDDILIRHLTIQVLQ 1254

Query: 143  GIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILT 202
            G++ +H+    ++HRD+K +N+L+  +G+ K+ DFG +S      R + +  Y   ++  
Sbjct: 1255 GLSYLHSRG--ILHRDMKADNLLLDQDGVCKISDFG-IS------RKSNDI-YSNSEMTM 1304

Query: 203  NTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTP---FEKSGEAGILHARYQ 259
              T  + +PEM+D  +G     K DIW+LG  + ++     P   FE       +     
Sbjct: 1305 KGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNFEVVAAMFKIGQAKS 1362

Query: 260  YPPFPQ-----YSDRLKNLIRLMLMETPSKRPNICQVL 292
             PP P+      S+  K  +       P KRP   ++L
Sbjct: 1363 APPIPEDTLPLISENAKEFLDCCFEIDPEKRPTADKLL 1400

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 126/281 (44%), Gaps = 48/281 (17%)

Query: 31   GGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLN--------TLRAEVDAMKLLKNN 82
            G F  VY          T   +  +K+V VP     N         LR+EV  +K L ++
Sbjct: 1190 GSFGAVYLCL-----NVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DH 1243

Query: 83   KHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQ 142
             ++V Y+      S+    Y +F  +E+   G +   +  R+  R  ES I  + +Q ++
Sbjct: 1244 LNIVQYLGFENKNSI----YSLF--LEYVAGGSVGSLI--RMYGRFDESLIKHLTTQVLR 1295

Query: 143  GIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILT 202
            G+A +H+    ++HRD+K +N+L+  +G+ K+ DF    G+ R  ++     Y   D+  
Sbjct: 1296 GLAYLHSKG--ILHRDMKADNLLLDQDGICKISDF----GISRKSKDI----YSNSDMTM 1345

Query: 203  NTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQY-- 260
              T  + +PEM+D  +G     K DIW+LG  + ++     P+       ++ A ++   
Sbjct: 1346 RGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPW---SNLEVVAAMFKIGK 1400

Query: 261  ----PPFPQYSDRLKNLIRLMLMET-----PSKRPNICQVL 292
                PP P+ +  L   +    ++      P KRP   ++L
Sbjct: 1401 SKSAPPIPEDTLPLITRVGRSFLDACFEIDPEKRPTATKLL 1441

>Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {ON}
           complement(57430..60243) [2814 nt, 938 aa]
          Length = 937

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 132/281 (46%), Gaps = 39/281 (13%)

Query: 19  SHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKL 78
           S +  +IK +  G    VYTA     DP     +A  +  +  +KQ    L   ++ + +
Sbjct: 648 SKYTDLIK-IGQGASGGVYTAH----DPTREGYVAIKQMNL--EKQPKKELI--INEIIV 698

Query: 79  LKNNKH--VVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEI 136
           +K +KH  +V++IDS+  K       +++V+ME+ E G L D +   L   L E+++  +
Sbjct: 699 MKESKHENIVNFIDSYLLKG------DLWVIMEYMEGGSLTDVVTHCL---LTEAQVGAV 749

Query: 137 MSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYV 196
             +T+ G+  +H+    +IHRDIK +N+L+S  G  K+ DFG  + +        E N  
Sbjct: 750 CRETLSGLQFLHSKG--VIHRDIKSDNILLSMRGDIKLTDFGFCAQI-------NELNLK 800

Query: 197 QHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF--EKSGEAGIL 254
           +  ++   T  + +PE++      P   K DIW+LGI + ++     P+  E    A  L
Sbjct: 801 RTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYL 855

Query: 255 HARYQYPPFPQ---YSDRLKNLIRLMLMETPSKRPNICQVL 292
            A    P   +    SD L N +   L   P +R +   +L
Sbjct: 856 IATNGTPSLKEPEALSDALNNFLGWCLKVNPDERASAKDLL 896

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 81/296 (27%), Positives = 140/296 (47%), Gaps = 39/296 (13%)

Query: 8   LYEPGTILTVGSHHAKIIKYLT---SGGFAQVYTA-EISPPDPYTNANIACLKRVIVPDK 63
           LY   T +      +K+ K L     G    VYTA E+      TNA++A +K++ +  +
Sbjct: 650 LYSKLTEICTDGDPSKLYKNLIKIGQGASGGVYTAYEVG-----TNASVA-IKQMNLEKQ 703

Query: 64  QGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTR 123
                +  E+  MK  K+  ++V++IDS+  +       +++V+ME+ E G L D +   
Sbjct: 704 PKKELIINEILVMKASKH-ANIVNFIDSYLLRG------DLWVVMEYMEGGSLTDVVTHC 756

Query: 124 LQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGV 183
           +   L E +I  +  +T++G+  +H+    +IHRDIK +NVL+S +G  K+ DFG  + +
Sbjct: 757 I---LTEGQIGAVSRETLKGLQFLHS--KGVIHRDIKSDNVLLSMSGEIKLTDFGFCAQI 811

Query: 184 IRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTT 243
                   E N  +  ++   T  + +PE++      P   K DIW+LGI + ++     
Sbjct: 812 -------NEINLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEP 859

Query: 244 PF--EKSGEAGILHARYQYPPFPQ---YSDRLKNLIRLMLMETPSKRPNICQVLEE 294
           P+  E    A  L A    P        SD LK+ +   L   P +R    Q+L +
Sbjct: 860 PYLNETPLRALYLIATNGTPELKDADSLSDDLKSFLGWCLHVNPDERATASQLLSD 915

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 121/258 (46%), Gaps = 46/258 (17%)

Query: 31   GGFAQVYTAEISPPDPYTNANIACLKRVIVP-----DKQGLN---TLRAEVDAMKLLKNN 82
            G F  VY A        T   +  +K+V VP     D+  ++    L++EV  +K L N+
Sbjct: 1047 GSFGAVYLALN-----VTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDL-NH 1100

Query: 83   KHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQ 142
             ++V Y+     +  NG+ Y +F  +E+   G +   +  R+  R  +  I  +  Q ++
Sbjct: 1101 VNIVQYL---GFEEKNGI-YSLF--LEYVAGGSVGSLI--RMYGRFDDQLIRHLTKQVLE 1152

Query: 143  GIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILT 202
            G+A +H+    ++HRD+K +N+L+ ++G+ K+ DF    G+ R   N     Y   D+  
Sbjct: 1153 GLAYLHSKG--ILHRDMKADNLLLDNDGVCKISDF----GISRKSNNI----YSNSDMTM 1202

Query: 203  NTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQY-- 260
              T  + +PEM+D   G     K DIW+LG  + ++     P+       ++ A +Q   
Sbjct: 1203 RGTVFWMAPEMVDTAHGY--SAKVDIWSLGCVVLEMFAGKRPW---SNFEVVAAMFQIGK 1257

Query: 261  ----PPFPQYSDRLKNLI 274
                PP P   D  K+L+
Sbjct: 1258 SKTAPPIP---DDTKDLV 1272

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 129/275 (46%), Gaps = 37/275 (13%)

Query: 28  LTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVS 87
           L  G ++ V  A  +  D      +  L +  +  ++ +  +  E +A++ + N+K +V 
Sbjct: 185 LGDGAYSTVMLA--TSIDSKKQYAVKVLNKEYLIKQKKVKYVNIEKNALQRINNSKMIVK 242

Query: 88  YIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAM 147
              +   +S       ++ L+E+C  G  +  M  +    L E+      +Q +  I  +
Sbjct: 243 LFFTFQDES------SLYFLLEYCPNGDFLSLM--KKYGSLNETVACYYSAQVIDAIDYL 294

Query: 148 HALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNT--- 204
           H     +IHRDIK EN+L+      K+ DFG+   +     N       + D+LT +   
Sbjct: 295 HT--NGIIHRDIKPENILLDKEFKIKLTDFGTAKILDSSTNN-------KFDLLTRSKSF 345

Query: 205 --TAQYRSPEMI-DLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGE----AGILHAR 257
             TA+Y +PE++ D +    +D + D+WA G  LY++     PF+ + E      ++  +
Sbjct: 346 VGTAEYVAPELLNDSF----VDYRCDVWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQ 401

Query: 258 YQYPP-FPQYSDRLKNLIRLMLMETPSKRPNICQV 291
           Y +   FP     +++L++ +L++  ++RP+I Q+
Sbjct: 402 YAFTAGFPLI---IRDLVKKILVKDLNQRPSISQI 433

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 97/195 (49%), Gaps = 23/195 (11%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           V++ +E+C    L D++   L+ R+   E   + +Q V  +   H+LQ   +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLP 221
           +L+  NG   + DFG                  Q + +  TT  Y +PE+I  + Y G  
Sbjct: 159 ILLDKNGYAMLTDFGFTRECA---------TKTQLETVCGTTV-YMAPELIKREAYDGYK 208

Query: 222 IDEKSDIWALGIFLYKICYYTTPFEKSGEAGI-LHARYQYPP-FPQY-SDRLKNLIRLML 278
           +    D W+LGI LY + +   PF++       L   ++ P    +Y S + K+LI  +L
Sbjct: 209 V----DTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIVRLL 264

Query: 279 METPSKRPNICQVLE 293
            +  ++RPN+ +VL+
Sbjct: 265 DKNAAQRPNLNEVLQ 279

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 122/285 (42%), Gaps = 59/285 (20%)

Query: 23  KIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNN 82
           KI+K +  G F +VY A   P    T+  + CLK     DK   N +R      ++  + 
Sbjct: 42  KILKQIGEGSFGKVYLALHRP----THRKV-CLK---TSDKNDPNIVR------EVFYHR 87

Query: 83  KHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQ 142
           +    YI       V     +V++ +E+C    L D  +     R+   E  E+ +Q   
Sbjct: 88  QFDFPYITKLYEVIV--TESKVWMALEYCPGKELYD--HLLSLRRISLLECGELFAQISG 143

Query: 143 GIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILT 202
            +   H++    +HRD+K+EN+L+  NG  K+ DFG                    + +T
Sbjct: 144 AVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG-----------------FTRECMT 184

Query: 203 NTTAQ-------YRSPEMID--LYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGI 253
            TT +       Y +PE+I+   Y G  I    DIW+LG+ LY +     PF+   EA  
Sbjct: 185 KTTLETVCGTTVYMAPELIERRTYDGFKI----DIWSLGVILYTLITGYLPFDDDDEAKT 240

Query: 254 LHA------RYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVL 292
                    +Y     P   D  ++LI  +L + P +RP++ QVL
Sbjct: 241 KWKIVNEEPKYDAKVIP---DDARDLISRLLAKNPGERPSLSQVL 282

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 101/197 (51%), Gaps = 25/197 (12%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIE 162
           +V++ +E+C    L D++  +   R+   E  ++ +Q V  +   H+LQ   +HRD+K+E
Sbjct: 102 KVWMALEYCPGNELYDYLLQK--QRIPLDETSKLFAQIVGAVFYAHSLQ--CVHRDLKLE 157

Query: 163 NVLISHNGLYKVCDFGSVSGVIRPPRNTQEF-NYVQHDILTNTTAQYRSPEMI--DLYRG 219
           N+L+   G   + DFG           T+E     Q + +  TT  Y +PE+I  + Y G
Sbjct: 158 NILLDKQGYAMLTDFGF----------TRECATKTQLETICGTTV-YMAPELIKRESYDG 206

Query: 220 LPIDEKSDIWALGIFLYKICYYTTPF-EKSGEAGILHARYQYPPF-PQYSD-RLKNLIRL 276
                K D W+LGI LY + +   PF E+      L    + PP    Y++   K+LI  
Sbjct: 207 Y----KVDTWSLGIILYTMLHGFMPFDEEDPTLTGLKIMNEMPPIVDAYTNVHAKDLILK 262

Query: 277 MLMETPSKRPNICQVLE 293
           +L +TPS+RP++ +VLE
Sbjct: 263 LLRKTPSERPSLNKVLE 279

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 72/301 (23%), Positives = 140/301 (46%), Gaps = 33/301 (10%)

Query: 11  PGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLR 70
           P  I T G  + + + +L  GGFA+ +  +      +    +A   ++ +  ++    L 
Sbjct: 63  PSLIKTKGRDYHRGM-FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLL 118

Query: 71  AEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRE 130
           +E+   K +++  ++V + D     +       V++L+E C  G L+D +  R Q  L E
Sbjct: 119 SEIQIHKSMRH-PNIVQFTDCFEDDT------NVYILLEICPNGSLMDLLKQRKQ--LTE 169

Query: 131 SEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNT 190
            E+    +Q V  I  MH+ +  +IHRD+K+ N+    +   K+ DFG ++ V+    N 
Sbjct: 170 PEVRFFTTQIVGAIKYMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG-LAAVL---AND 223

Query: 191 QEFNYVQHDILTNTTAQYRSPEMI-DLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSG 249
           +E  Y         T  Y +PE++   + G   +   D+W++G+ +Y +     PF+ + 
Sbjct: 224 RERKYT-----ICGTPNYIAPEVLTGKHTGHSFE--VDVWSIGVMIYALLIGKPPFQ-AK 275

Query: 250 EAGILHAR-----YQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQIKPCP 304
           E   ++ R     + +P     S   K LI+ +L   P +RP++ +++E V    + P  
Sbjct: 276 EVNTIYERIKVCDFNFPRDKPISSEAKVLIKDILSLDPLERPSLTEIMEYVWFRNVFPMR 335

Query: 305 I 305
           I
Sbjct: 336 I 336

>NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496
          Length = 895

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 141/285 (49%), Gaps = 51/285 (17%)

Query: 21  HAKIIKYLTSGGFAQVYTA-EISPPDPYTNANIACLKRVIV---PDKQGLNTLRAEVDAM 76
           +A ++K +  GG A VYTA E+      TN ++A +K++ +   P KQ +      ++ +
Sbjct: 613 YANLVK-IGRGGSALVYTAYEVG-----TNLSVA-IKQINLEKQPRKQLI------LNEI 659

Query: 77  KLLKNNKH--VVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEIL 134
            ++K ++H  +V++IDS+    V+G   +++V+ME+ E G L D +   +   LRE +I 
Sbjct: 660 IVMKKSQHPNIVNFIDSYL---VDG---KLWVIMEYMEAGSLTDVVTRCI---LREGQIG 710

Query: 135 EIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGV--IRPPRNTQE 192
            +  + ++G+  +H+    +IHRDIK +NVL+S +G  K+ DFG  + +  I   RNT  
Sbjct: 711 AVCREVLKGLVFLHS--KGVIHRDIKSDNVLLSMDGDIKLTDFGFCAQLNDIHLKRNTMV 768

Query: 193 FNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF--EKSGE 250
                       T  + +PE+++     P   K DIW+LG+ + ++     P+  E    
Sbjct: 769 -----------GTPYWMAPEIVEKKHYCP---KVDIWSLGVMIIEMIEGEPPYLNEPPLR 814

Query: 251 AGILHARYQYPPF---PQYSDRLKNLIRLMLMETPSKRPNICQVL 292
           A  L A    P      + S+ L   I   L   P  R    ++L
Sbjct: 815 ALYLIATNGTPKLKDPEKLSETLSEFINCCLFVDPELRKTAAELL 859

>Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 84/185 (45%), Gaps = 21/185 (11%)

Query: 112  ERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGL 171
            E G +  F     +  + E E   +  Q V  I  +H     ++HRDIK ENV++  +G 
Sbjct: 931  ETGSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLHG--QGIVHRDIKDENVIVDSHGF 988

Query: 172  YKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIW 229
             K+ DFGS + +   P           D+    T  Y +PE++    Y+G P     DIW
Sbjct: 989  VKLIDFGSAAYIKSGP----------FDVFVG-TMDYAAPEVLGGSSYKGKP----QDIW 1033

Query: 230  ALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNIC 289
            ALG+ LY I Y   P+    E  IL    ++    + S+    LI+ +L     KRP I 
Sbjct: 1034 ALGVLLYTIIYKENPYYNIDE--ILEGELRFDKSEKVSEECIGLIKRILTREVDKRPTID 1091

Query: 290  QVLEE 294
            ++ E+
Sbjct: 1092 EIYED 1096

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 105/210 (50%), Gaps = 20/210 (9%)

Query: 88  YIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAM 147
           YI ++ +  V  V+  ++++ME+C  G   D +    +  L E ++  I  + ++G+  +
Sbjct: 91  YITNYFSTFVEDVS--MWIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREILRGLEYL 148

Query: 148 HALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQ 207
           H+ +   IHRDIK  N+L++ +G  K+ DFG VSG +   R    F           T  
Sbjct: 149 HSQRK--IHRDIKAANILLTDDGKVKLGDFG-VSGQMMATRRRDTF---------VGTPF 196

Query: 208 YRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYS 267
           + +PE+I        +EK+DIW+LGI ++++     P  +     +L +     P P+  
Sbjct: 197 WMAPEVIARSE-QGYNEKADIWSLGITVFELLKGQPPLSQHDPMKVLMSIPSRRP-PKLE 254

Query: 268 DRLKNLIR----LMLMETPSKRPNICQVLE 293
           DR  + IR    L L + P+KRP   ++L+
Sbjct: 255 DRYSHAIREFVSLCLNKDPAKRPTASELLK 284

>Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON}
           YHL007C (REAL)
          Length = 923

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 138/282 (48%), Gaps = 41/282 (14%)

Query: 21  HAKIIKYLTSGGFAQVYTA-EISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLL 79
           +A ++K +  G    VYTA EI      TN ++A +K++ + +KQ    L   ++ + ++
Sbjct: 599 YANLVK-IGQGASGGVYTAYEIG-----TNVSVA-IKQMNL-EKQPKKELI--INEILVM 648

Query: 80  KNNKH--VVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIM 137
           K +KH  +V++IDS+  K       +++V+ME+ E G L D +   +   L E +I  + 
Sbjct: 649 KGSKHPNIVNFIDSYVLKG------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVC 699

Query: 138 SQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQ 197
            +T+ G+  +H+    ++HRDIK +N+L+S  G  K+ DFG  + +        E N  +
Sbjct: 700 RETLSGLKFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFGFCAQI-------NELNLKR 750

Query: 198 HDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF--EKSGEAGILH 255
             ++   T  + +PE++      P   K DIW+LGI + ++     P+  E    A  L 
Sbjct: 751 TTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLI 805

Query: 256 ARYQYPPFPQ---YSDRLKNLIRLMLMETPSKRPNICQVLEE 294
           A    P   +    S  LK  +   L   P +R +  ++L +
Sbjct: 806 ATNGTPKLKEPENLSSSLKKFLDWCLCVEPEERASATELLHD 847

>YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One of
            two (see also PSK1) PAS domain containing S/T protein
            kinases; regulates sugar flux and translation in response
            to an unknown metabolite by phosphorylating Ugp1p and
            Gsy2p (sugar flux) and Caf20p, Tif11p and Sro9p
            (translation)
          Length = 1101

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 84/185 (45%), Gaps = 21/185 (11%)

Query: 112  ERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGL 171
            E G +  F     +  + E E   +  Q V  I  +H     ++HRDIK ENV++  +G 
Sbjct: 931  ETGSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLH--DQGIVHRDIKDENVIVDSHGF 988

Query: 172  YKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIW 229
             K+ DFGS + +   P           D+    T  Y +PE++    Y+G P     DIW
Sbjct: 989  VKLIDFGSAAYIKSGP----------FDVFVG-TMDYAAPEVLGGSSYKGKP----QDIW 1033

Query: 230  ALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNIC 289
            ALG+ LY I Y   P+    E  IL    ++      S+   +LI+ +L     KRP I 
Sbjct: 1034 ALGVLLYTIIYKENPYYNIDE--ILEGELRFDKSEHVSEECISLIKRILTREVDKRPTID 1091

Query: 290  QVLEE 294
            ++ E+
Sbjct: 1092 EIYED 1096

>KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa]
           {ON} Anc_2.496 YHL007C
          Length = 836

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 113/229 (49%), Gaps = 30/229 (13%)

Query: 73  VDAMKLLKNNKH--VVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRE 130
           ++ + ++K++KH  +V++IDS   K       +++V+MEF E G L D +   +   L E
Sbjct: 594 INEIIVMKDSKHPNIVNFIDSFLLKG------DLWVIMEFMEGGSLTDVVTHCI---LTE 644

Query: 131 SEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNT 190
            +I  +  +T++G+  +H+    +IHRDIK +N+L+S  G  K+ DFG  + +       
Sbjct: 645 GQIGTVCRETLRGLQFLHSNG--VIHRDIKSDNILLSMKGDIKLTDFGFCAQI------- 695

Query: 191 QEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF--EKS 248
            E N  +  ++   T  + +PE++      P   K DIW+LGI + ++     P+  E  
Sbjct: 696 NEHNLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIESEPPYLNETP 750

Query: 249 GEAGILHARYQYPPFPQ---YSDRLKNLIRLMLMETPSKRPNICQVLEE 294
             A  L A    P   +    SD L + +   L   P +R +   +LE+
Sbjct: 751 LRALYLIATNGTPKLKEPELLSDVLNDFLSWCLKVNPDERASASTLLED 799

>KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} similar
           to uniprot|Q03497 Saccharomyces cerevisiae YHL007C STE20
           Signal transducing kinase of the PAK (p21- activated
           kinase) family involved in pheromone response and
           pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 989

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 130/270 (48%), Gaps = 36/270 (13%)

Query: 31  GGFAQVYTA-EISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYI 89
           G    VYTA E+      TNA++A +K++ +  +     +  E+  MK  K+N ++V++I
Sbjct: 707 GASGGVYTAYELG-----TNASVA-IKQMNLEKQPKKELIVNEILVMKGSKHN-NIVNFI 759

Query: 90  DSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHA 149
           DS+  +       +++V+ME+ E G L D +   +   L E +I  +  +T++G+  +H+
Sbjct: 760 DSYLFRG------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSRETLKGLQFLHS 810

Query: 150 LQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYR 209
               +IHRDIK +N+L+S NG  K+ DFG  + +        E N  +  ++   T  + 
Sbjct: 811 KG--VIHRDIKSDNILLSMNGDIKLTDFGFCAQI-------NEVNLKRTTMV--GTPYWM 859

Query: 210 SPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF--EKSGEAGILHARYQYPPFPQ-- 265
           +PE++      P   K DIW+LGI + ++     P+  E    A  L A    P      
Sbjct: 860 APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKDPG 916

Query: 266 -YSDRLKNLIRLMLMETPSKRPNICQVLEE 294
             S ++   +   LM  P  R     +LE+
Sbjct: 917 NLSHKMAMFLNWCLMVDPEDRGTAADLLED 946

>TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.92
           YDR490C
          Length = 819

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 95/197 (48%), Gaps = 23/197 (11%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           ++ ++E+   G L+  +  R    L  +      +Q +  I A+H++   +IHRDIK EN
Sbjct: 219 LYFVLEYAPHGDLLALL--RRHGSLSRAVTCHYAAQLLSAIGALHSVG--VIHRDIKPEN 274

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTN--TTAQYRSPEMIDLYRGLP 221
           VL+  +   K+ DFG+ + +   P+       V   + T+   TA+Y  PE++       
Sbjct: 275 VLLDSHYRAKLTDFGTAALL---PQTHSNLEQVSRHVTTSFVGTAEYVPPELLAAGHA-- 329

Query: 222 IDEKSDIWALGIFLYKICYYTTPFEKSGE----AGILHARYQYPP-FPQYSDRLKNLIRL 276
            D   D+WA    ++++     PF+   E      ++  RY YPP FP  SD LK+L+R 
Sbjct: 330 -DGTCDLWAWACVVFQLIAGRPPFQARNEFLTFQNVMAVRYTYPPGFP--SD-LKDLLRR 385

Query: 277 MLMETPSKR---PNICQ 290
           +L   P +R   P I Q
Sbjct: 386 VLRHEPRQRLLQPQITQ 402

>Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 84/185 (45%), Gaps = 21/185 (11%)

Query: 112  ERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGL 171
            E G +  F     +  + E E   +  Q V  I  +H     ++HRDIK ENV++  +G 
Sbjct: 931  ETGSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLH--NQGIVHRDIKDENVIVDSHGF 988

Query: 172  YKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIW 229
             K+ DFGS + V   P           D+    T  Y +PE++    Y+G P     DIW
Sbjct: 989  VKLIDFGSAAYVKSGP----------FDVFVG-TMDYAAPEVLGGSSYKGKP----QDIW 1033

Query: 230  ALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNIC 289
            ALG+ LY I Y   P+    E  IL    ++    + S+    LI+ +L     KRP I 
Sbjct: 1034 ALGVLLYTIIYKENPYYNIDE--ILEGELRFDKAEKVSEGCIGLIKRILTREVDKRPTID 1091

Query: 290  QVLEE 294
            ++ E+
Sbjct: 1092 EIYED 1096

>Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (REAL)
          Length = 1360

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 81/177 (45%), Gaps = 22/177 (12%)

Query: 115  GLIDFMN-TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYK 173
            G ID  +    +  + E E   I+ Q V GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1192 GCIDLFDLIEFKTNMTECEAKLIVKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1249

Query: 174  VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIWAL 231
            + DFGS + V   P           D+   T   Y +PE++  + Y G P     DIWA+
Sbjct: 1250 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGNPYEGKP----QDIWAI 1294

Query: 232  GIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNI 288
            GI LY + +   PF    E  IL    ++    + S+    LI+ +L     KRP I
Sbjct: 1295 GILLYTVVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRCVPKRPTI 1349

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 133/285 (46%), Gaps = 32/285 (11%)

Query: 27  YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +      +    +A   ++ +  ++    L +E+   K +K+  ++V
Sbjct: 82  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKH-PNIV 137

Query: 87  SYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAA 146
            +ID     +       V++L+E C  G L+D +  R    L E E+    +Q V  I  
Sbjct: 138 QFIDCFEDDT------NVYILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIVGAIKY 189

Query: 147 MHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTA 206
           MH  +  +IHRD+K+ N+    N   K+ DFG ++ V+    N +E  Y         T 
Sbjct: 190 MHNRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANDRERKYT-----VCGTP 238

Query: 207 QYRSPEMI-DLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHAR-----YQY 260
            Y +PE++   + G   +   DIW++G+ +Y +     PF+ + E  I++ R     Y +
Sbjct: 239 NYIAPEVLAGKHSGHSYE--VDIWSIGVMIYALLIGKPPFQ-AKEVNIIYERIKSGDYIF 295

Query: 261 PPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQIKPCPI 305
           P     S  +  LI+ +L   P +RP++ ++++ V    I P  I
Sbjct: 296 PREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYVWFRGIFPARI 340

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 129/275 (46%), Gaps = 32/275 (11%)

Query: 27  YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +    + +    +A   +  +  ++    L +E+   K + ++ ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAA 146
            +ID     S       V++L+E C  G L++ +  R    L E E+    +Q    I  
Sbjct: 143 QFIDCFEDDS------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIKY 194

Query: 147 MHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTA 206
           MH+ +  +IHRD+K+ N+    N   K+ DFG ++ V+    N  E  Y         T 
Sbjct: 195 MHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYT-----ICGTP 243

Query: 207 QYRSPE-MIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHAR-----YQY 260
            Y +PE ++  + G   +   DIW+LG+ LY +     PF+ + +   ++ R     + +
Sbjct: 244 NYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDFSF 300

Query: 261 PPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEV 295
           P     SD  K LIR +L   P +RP++ ++++ V
Sbjct: 301 PRDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 107/213 (50%), Gaps = 29/213 (13%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           + +++E+   G    ++  +   RL+E     + +Q + G+  MH+    L+HRD+K+EN
Sbjct: 123 IGIVLEYASGGEFYRYIQKK--RRLKEHAACRLFAQLISGVHYMHSKG--LVHRDLKLEN 178

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQ-YRSPEMIDLYRGLPI 222
           +L+  N    + DFG V+          EFN+    + T+  +  Y +PE++   +  P 
Sbjct: 179 LLLDKNENLLITDFGFVN----------EFNHKNELMKTSCGSPCYAAPELVVTTK--PY 226

Query: 223 D-EKSDIWALGIFLYKICYYTTPFEKSGE-------AGILHARYQYP-PFPQYSDRL-KN 272
           +  K+DIW+ G+ +Y +     P++   E       A + H   + P  FP+Y + + ++
Sbjct: 227 EARKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYITKTPLKFPEYINPVPRD 286

Query: 273 LIRLMLMETPSKRPNICQVLEEVSRLQIKPCPI 305
           L+R +L+  P KR N+ QV E+   LQ   CP 
Sbjct: 287 LLRRILVSNPKKRLNLRQV-EQHQWLQPH-CPF 317

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 99/192 (51%), Gaps = 16/192 (8%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           ++++MEFC  G   D +    ++RL E+++  I+ + + G+  +H+ +   IHRDIK  N
Sbjct: 110 MWIVMEFCGGGSCADLLKHLPEHRLSENKVAYIIREVLFGLDYLHSQKK--IHRDIKAAN 167

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPID 223
           +L++ +G  K+ DFG VSG I        F           T  + +PE+I   +    +
Sbjct: 168 ILLTDDGEVKLGDFG-VSGQIMATLKRTTF---------VGTPYWMAPEII-AKKDNGYN 216

Query: 224 EKSDIWALGIFLYKICYYTTPFEKSGEAGIL-HARYQYPPFPQ--YSDRLKNLIRLMLME 280
           EK+DIW+LGI   ++     P+ K     +L +   + PP  Q  ++   ++ I L L++
Sbjct: 217 EKADIWSLGITAIELLTGQPPYAKHDPMKVLVNIPLRKPPKLQGRFTGSARDFIALCLIK 276

Query: 281 TPSKRPNICQVL 292
            P  RP+  ++L
Sbjct: 277 DPDLRPSAAELL 288

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 94/201 (46%), Gaps = 33/201 (16%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIE 162
           E+++++E+ E G L D++ ++   +L ESE +    Q VQ +A  H     + HRD+K E
Sbjct: 148 ELYLVLEYVEGGELFDYLVSK--GKLPESEAIHYFKQIVQAVAYCHGFN--ICHRDLKPE 203

Query: 163 NVLISHNGL-YKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTA---QYRSPEMI--DL 216
           N+L+       K+ DFG  +                 D L  T+     Y SPE++    
Sbjct: 204 NLLLDKKKRSIKIADFGMAA-------------LETSDKLLETSCGSPHYASPEIVLGRK 250

Query: 217 YRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL----HARYQYPPFPQYSDRLKN 272
           Y G P    SD+W+ GI L+ +     PF       +L      +YQ P +   S   K+
Sbjct: 251 YHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQW--LSVEAKD 304

Query: 273 LIRLMLMETPSKRPNICQVLE 293
           LI  +L+  P++R  I Q+L+
Sbjct: 305 LISRILVVDPNRRITIDQILQ 325

>Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {ON}
           YDR523C (REAL)
          Length = 490

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 98/196 (50%), Gaps = 24/196 (12%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           ++++ME+C  G   D +     N L E ++  I+ Q   G+  +H  +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEM----IDLYRG 219
           +L++  G+ K+ DFG VSG IR        +  + D     T  + +PE+    +D Y  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--------STFKRDTFVG-TPYWMAPEVVCCEVDGY-- 194

Query: 220 LPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL-HARYQYPPFPQ--YSDRLKNLIRL 276
              +EK+DIW+LGI  Y++     P  K     ++ +   + PP  Q  +S+  K  +  
Sbjct: 195 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSEAAKEFVAG 251

Query: 277 MLMETPSKRPNICQVL 292
            L++TP+ RP+   +L
Sbjct: 252 CLVKTPADRPSAYDLL 267

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 116/231 (50%), Gaps = 33/231 (14%)

Query: 72  EVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRES 131
           E +A++ L N++ +V    +   +S       ++ L+E+   G  +  M  +    L E 
Sbjct: 215 EKNALQRLNNSRGIVKLYFTFQDES------SLYFLLEYAPNGDFLSIM--KKYGSLNED 266

Query: 132 EILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQ 191
                 +Q +  I  +H+    ++HRDIK EN+L+  +   K+ DFG+   ++ P  NT 
Sbjct: 267 CACYYSAQIIDAIDFLHS--KGIVHRDIKPENILLDKDFKVKLTDFGTAK-ILEPKPNTT 323

Query: 192 EFNYVQHDILTNT-----TAQYRSPEMI-DLYRGLPIDEKSDIWALGIFLYKICYYTTPF 245
           +     +D+L+ +     TA+Y SPE++ D Y    +D + DIWA G  L+++     PF
Sbjct: 324 D----SYDLLSRSKSFVGTAEYVSPELLNDNY----VDYRCDIWAFGCILFQMIAGKPPF 375

Query: 246 EKSGE----AGILHARYQYPP-FPQYSDRLKNLIRLMLMETPSKRPNICQV 291
           + + E      ++  +Y +   FP     +++L++ +L++ P++R  I Q+
Sbjct: 376 KATNEYLTFQKVMKVQYAFTAGFPLV---VRDLVKGILIKQPAQRLTIPQI 423

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 77/299 (25%), Positives = 133/299 (44%), Gaps = 47/299 (15%)

Query: 9   YEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANI-ACLKRVIVPDKQGLN 67
           ++ G  L +GS     + Y +S G  Q    ++     + N N  A    ++ PD     
Sbjct: 20  WKLGETLGLGSTGKVQLAYNSSTG--QQAAIKVISKAVFNNDNANASDSALLTPDSLPYG 77

Query: 68  TLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNR 127
             R E+  MKLL N+ +V+   D     S       +++++E+ E+G L + +  R    
Sbjct: 78  IER-EIIIMKLL-NHPNVLRLYDVWETDS------NLYMVLEYAEKGELFNLLVER--GP 127

Query: 128 LRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPP 187
           L E+E +    Q + GI+  HAL   ++HRD+K EN+L+ H    K+ DFG  +      
Sbjct: 128 LPENEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMAA------ 179

Query: 188 RNTQEFNYVQHDILTNTTA---QYRSPEMIDL--YRGLPIDEKSDIWALGIFLYKICYYT 242
                      D L  T+     Y +PE+I    Y GL    ++D+W+ GI L+ +    
Sbjct: 180 -------LETEDKLLETSCGSPHYAAPEIISGLPYHGL----ETDVWSCGIILFALLTGR 228

Query: 243 TPFEKSGEAG--------ILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLE 293
            PF++  E G        +   +++ P   + S   ++LI  +L   P KR    ++L+
Sbjct: 229 LPFDE--EDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILK 285

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 129/285 (45%), Gaps = 59/285 (20%)

Query: 23  KIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV--PDKQGLNTLRA-----EVDA 75
           KI+K +  G F +VY A   P            ++V++   DK   N +R      + D 
Sbjct: 38  KIMKQIGEGSFGKVYLASHKPTH----------RKVVLKTSDKNDPNVVREVFYHRQFDY 87

Query: 76  MKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILE 135
           + + +  + +V+               +V++ +E+C    L + +      R+   E   
Sbjct: 88  LYITRLYEVIVTET-------------KVWMALEYCPGKELYEHL--LALKRISLDECSR 132

Query: 136 IMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNY 195
           + +Q V  I   H+L    +HRD+K+EN+L+   G  K+ DFG     +         + 
Sbjct: 133 LFAQIVGAIYYAHSLN--CVHRDLKLENILLDKKGNAKLTDFGFTRECV---------SK 181

Query: 196 VQHDILTNTTAQYRSPEMIDL--YRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGI 253
            Q D +  TT  Y +PE+ +   Y G  I    DIWALG+ LY +   + PF++  EA  
Sbjct: 182 SQLDTICGTTV-YMAPELTERKSYDGFKI----DIWALGVILYTMINGSMPFDEDDEA-- 234

Query: 254 LHARYQ-YPPFPQYSDRL-----KNLIRLMLMETPSKRPNICQVL 292
              +++     P+ ++ L     K+LI  +L + P++RP+I ++L
Sbjct: 235 -KTKWKIVNEMPEINEDLVSPDAKDLIEQLLAKDPNERPSIEKIL 278

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 68/275 (24%), Positives = 128/275 (46%), Gaps = 32/275 (11%)

Query: 27  YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +    + +    +A   +  +  ++    L +E+   K + +  ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMAH-PNIV 142

Query: 87  SYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAA 146
            ++D     S       V++L+E C  G L++ +  R    L E E+    +Q    I  
Sbjct: 143 QFVDCFEDDS------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIKY 194

Query: 147 MHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTA 206
           MH+ +  +IHRD+K+ N+    N   K+ DFG ++ V+    N  E  Y         T 
Sbjct: 195 MHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYT-----ICGTP 243

Query: 207 QYRSPE-MIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHAR-----YQY 260
            Y +PE ++  + G   +   DIW+LG+ LY +     PF+ + +   ++ R     + +
Sbjct: 244 NYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDFSF 300

Query: 261 PPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEV 295
           P     SD  K LIR +L   P +RP++ ++++ V
Sbjct: 301 PKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 76.6 bits (187), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 72/345 (20%), Positives = 136/345 (39%), Gaps = 64/345 (18%)

Query: 12  GTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRA 71
           G  +++      +   L  G    +Y  ++  P    +  +  LK+V  P  +     RA
Sbjct: 21  GVRISINGKSYLVTTLLREGELTALY--QVKCPKRSHSGGVYALKKVTCPIGRADFVTRA 78

Query: 72  EVDAMKLLK-NNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRL--QNRL 128
             +     + N+ ++ + +D   A+  NG    +++L+ +   G L D +N  +   + L
Sbjct: 79  MTEISNYQRFNSPYITNILDFQVAQHDNGTKI-IYMLLPYFPAGSLQDLINNMIIRGDSL 137

Query: 129 RESEILEIMSQTVQGIAAMH-------------------------------------ALQ 151
            ES ++ +M    +G+  MH                                      L 
Sbjct: 138 SESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLVDAMELDLLS 197

Query: 152 PPL--------IHRDIKIENVLISHNGLYKVCDFGSVSGVIRPP---RNTQEFNYVQHDI 200
           PPL        +H  +  EN+++S  GL  + +  S    +R P    +  +   +Q  +
Sbjct: 198 PPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASC---VRAPLELTSNSKLLGLQEWL 254

Query: 201 LTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEA-------GI 253
             N+   Y  PE++DL+    I  + DIW+LG   Y + Y  + F +  +         I
Sbjct: 255 NENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQLCGTPIKHSI 314

Query: 254 LHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRL 298
               + +P  P+YS  LK +++  L+  P KRP+I + L +   L
Sbjct: 315 STGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQFQEL 359

>SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] {ON}
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1274

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 87/191 (45%), Gaps = 22/191 (11%)

Query: 112  ERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGL 171
            E G +  F    L+  + E E   I  Q   GI  +H     ++HRDIK EN+++ + G 
Sbjct: 1104 ETGSIDLFDLIELKTNMTEHEAKLIFKQVASGIKHLH--DNGIVHRDIKDENIIVDNKGF 1161

Query: 172  YKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIW 229
             K+ DFGS + V   P           D+   T   Y +PE++  D Y G P     DIW
Sbjct: 1162 VKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGDPYEGKP----QDIW 1206

Query: 230  ALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNIC 289
            A+G+ LY I +   PF    E  IL    +       S+    LIR +L  +  KRP I 
Sbjct: 1207 AIGVLLYTIIFKENPFYNIDE--ILDGDLRISSSVTVSEECIALIRRILNRSVPKRPTIE 1264

Query: 290  QVLEEVSRLQI 300
            ++  + S LQ+
Sbjct: 1265 EIYND-SWLQL 1274

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 102/228 (44%), Gaps = 26/228 (11%)

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMN 121
           D   +  ++ E+  +  LK   ++  Y  S+   +       +++LME+C  G L   + 
Sbjct: 59  DSDEVEDVQREIQFLASLKQMPNITRYYGSYLKDT------SLWILMEYCAGGSLRSLLR 112

Query: 122 TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVS 181
                ++ E  I  IM + +  +  +H     +IHRDIK  NVLI++ G  K+CDFG  +
Sbjct: 113 P---GKIDEKYIGVIMRELLVALKCIHKDN--VIHRDIKAANVLITNEGSVKLCDFGVAA 167

Query: 182 GVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYY 241
            V +     Q             T  + +PE+I    G+  D K DIW+LGI  Y+I   
Sbjct: 168 QVNQTSLRRQTM---------AGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIATG 216

Query: 242 TTPF--EKSGEAGILHARYQYPPFP--QYSDRLKNLIRLMLMETPSKR 285
             P+   ++  A  L  + + P      YS  LK  I L L E P +R
Sbjct: 217 NPPYCDVEALRAMQLIIKSKPPRLEGRSYSSSLKEFIALCLDEDPKER 264

>YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON}
            SSK22MAP kinase kinase kinase of the HOG1
            mitogen-activated signaling pathway; functionally
            redundant with, and homologous to, Ssk2p; interacts with
            and is activated by Ssk1p; phosphorylates Pbs2p
          Length = 1331

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 77/305 (25%), Positives = 140/305 (45%), Gaps = 47/305 (15%)

Query: 27   YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPD----KQGLNTLRAEVDAMKLLKNN 82
            ++  G F QVY+A         N  I  +K + + D    K+    ++ E+  +++L N+
Sbjct: 1039 FIGGGTFGQVYSA-----INLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEML-NH 1092

Query: 83   KHVVSY--IDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMS-Q 139
             ++V Y  ++ H  K        V + ME+CE G L   ++     R+ +  + ++ + +
Sbjct: 1093 PNIVQYYGVEVHRDK--------VNIFMEYCEGGSLASLLD---HGRIEDEMVTQVYTFE 1141

Query: 140  TVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVI----RPPRN--TQEF 193
             ++G+A +H  Q  ++HRDIK EN+L+  NG+ K  DFG+   V+    R  RN   Q+F
Sbjct: 1142 LLEGLAYLH--QSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDF 1199

Query: 194  NYVQHDILTNT--TAQYRSPEMIDLYRGLPIDEK---SDIWALGIFLYKICYYTTPFEK- 247
              V+   L     T  Y +PE I    G  +  K    D+WALG  + ++     P+   
Sbjct: 1200 G-VETKSLNEMMGTPMYMAPETIS---GSAVKGKLGADDVWALGCVVLEMATGRRPWSNL 1255

Query: 248  SGEAGILH--ARYQYPPFPQYSDRL---KNLIRLMLMETPSKRPNICQVLEEVSRLQIKP 302
              E  I++  A  + P  P   +     +  +   L++ P+ R    ++L +   +QI+ 
Sbjct: 1256 DNEWAIMYHVAAGRIPQLPNRDEMTAAGRAFLERCLVQDPTMRATAVELLIDPWMIQIRE 1315

Query: 303  CPIRN 307
                N
Sbjct: 1316 IAFGN 1320

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 76.6 bits (187), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 80/335 (23%), Positives = 138/335 (41%), Gaps = 65/335 (19%)

Query: 15  LTVGSHHAKIIKYLTSGGFAQVYTAE-----ISPPDPYTNANIACLKRVIVP--DKQGLN 67
           L++      I K L    F+ +Y  +      +   P TN  +  LKR+  P  + + ++
Sbjct: 26  LSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTPRTN--LYALKRIRCPFGNIESIS 83

Query: 68  TLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNR 127
               EVD  K  ++  +++  +DS  A+  +G +  V++L+ +   G L D  +  L N 
Sbjct: 84  GAMKEVDNYKRFQS-PYIIHLVDSQVAQQRDG-SKTVYILLPYFPLGSLQDSTSRNLLNG 141

Query: 128 --LRESEILEIMSQTVQGIAAMH--------ALQ---------------------PPL-- 154
             + E+E + I+    +G+  +H        A Q                      PL  
Sbjct: 142 TFISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTPLEL 201

Query: 155 --------------IHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDI 200
                          HRDIK  N+L S +GL  + + GS S          +   +Q  +
Sbjct: 202 DILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQAWV 261

Query: 201 LTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEK----SGEA---GI 253
             + T  Y +PE++ +     +D K DIW+LG   Y + +  +PFE+    SG +    I
Sbjct: 262 SDHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLKYAI 321

Query: 254 LHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNI 288
               + +P   +YS+ L  LI   L   P+ RP+I
Sbjct: 322 GTGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 101/228 (44%), Gaps = 26/228 (11%)

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMN 121
           D   +  ++ E+  +  LK   ++  Y  S+   +       ++++ME+C  G L   + 
Sbjct: 80  DSDEVEDVQREIQFLASLKQVPNITRYYGSYLQDT------NLWIIMEYCAGGSLRTLLR 133

Query: 122 TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVS 181
             +   + E  I  IM + +  +  +H  +  +IHRDIK  NVLI++ G  K+CDFG  +
Sbjct: 134 PGM---IDEKYIGVIMRELLTALQCIH--KDNVIHRDIKAANVLITNEGKVKLCDFGVAA 188

Query: 182 GVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYY 241
            + +     Q             T  + +PE+I    G+  D K DIW+LGI  Y+I   
Sbjct: 189 QLNQTSLRRQTM---------AGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATG 237

Query: 242 TTPFEKSGEAGILHARYQYPPF----PQYSDRLKNLIRLMLMETPSKR 285
             P+ +      +    +  P      QYS  LK  I L L E P +R
Sbjct: 238 NPPYCEIEALRAMQLITKSKPARLEGRQYSSGLKEFIALCLDEDPKER 285

>KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} similar to
            uniprot|P53599 Saccharomyces cerevisiae YNR031C SSK2
            Suppressor of Sensor Kinase (SLN1) A MAP kinase kinase
            kinase activator of Pbs2p
          Length = 1551

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 130/284 (45%), Gaps = 40/284 (14%)

Query: 27   YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPD----KQGLNTLRAEVDAMKLLKNN 82
            ++ SG F  VY+A           +I  +K + + D    KQ   +L+ E+  M++L N+
Sbjct: 1264 FIGSGSFGTVYSAV-----NLDTGDILAVKEIKIQDAKSMKQIFPSLKEEMRVMEIL-NH 1317

Query: 83   KHVVSY--IDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMS-Q 139
             ++V Y  ++ H  K        V + MEFCE   L   +      R+ +  + ++ + Q
Sbjct: 1318 PNIVQYYGVEVHRDK--------VNIFMEFCEGSSLASLLE---HGRIEDEMVTQVYTLQ 1366

Query: 140  TVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSV-----SGVIRPPRNTQEFN 194
             ++G+A +H  Q  ++HRDIK EN+L+  NG+ K  DFG+      +G  R   +    +
Sbjct: 1367 LLEGLACLH--QSGVVHRDIKPENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDANNKS 1424

Query: 195  YVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEK-SGEAGI 253
                D++   T  Y +PE +   +G       DIW+LG  + ++     P+     E  I
Sbjct: 1425 TGGKDMI--GTPMYMAPETVT-GQGHGKFGSDDIWSLGCVVLEMVTGRRPWANLDNEWAI 1481

Query: 254  LH--ARYQYPPFP---QYSDRLKNLIRLMLMETPSKRPNICQVL 292
            ++  A    P FP   + S   +  I   L++  +KR    ++L
Sbjct: 1482 MYHVAAGHLPQFPTKSEISSAGRKFISRCLIQDANKRATAMELL 1525

>NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]
           {ON} Anc_3.92
          Length = 1113

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 93/196 (47%), Gaps = 19/196 (9%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           ++ L+E+   G  +  M  +    L E       +Q +  I  MH     +IHRDIK EN
Sbjct: 244 LYFLLEYAPNGDFLSVM--KKYGSLNEECACYYGAQILDAIGFMHTRG--IIHRDIKPEN 299

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNT-----TAQYRSPEMI-DLY 217
           +L+  +   K+ DFG+   +      T   N   +++LT +     TA+Y SPE++ D Y
Sbjct: 300 ILMDKDMKVKITDFGTAKIL---DEKTNGNNKTSYELLTRSKSFVGTAEYVSPELLNDNY 356

Query: 218 RGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILH--ARYQYPPFPQYSDRLKNLIR 275
                D + DIWA G  LY++     PF+ + E        + QY     +   +++LI+
Sbjct: 357 S----DSRCDIWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPTIIRDLIK 412

Query: 276 LMLMETPSKRPNICQV 291
            +L++ P +R  I Q+
Sbjct: 413 RILLKVPEQRLTIGQI 428

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 93/199 (46%), Gaps = 31/199 (15%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIE 162
           E+++++E+ + G L D++ +R   RL E E +    Q +QG++  HA    + HRD+K E
Sbjct: 190 ELYLVLEYVDGGELFDYLVSR--GRLCEREAVHYFKQIIQGVSYCHAFN--ICHRDLKPE 245

Query: 163 NVLIS-HNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTA--QYRSPEMI--DLY 217
           N+L+   N   K+ DFG  +              V + +L  +     Y SPE++    Y
Sbjct: 246 NLLLDKKNSTIKIADFGMAAL------------EVSNKLLQTSCGSPHYASPEIVMGKQY 293

Query: 218 RGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL----HARYQYPPFPQYSDRLKNL 273
            G P    SD+W+ GI L+ +     PF       +L      +YQ P     S   ++L
Sbjct: 294 HGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKYQMP--QNLSKEAQDL 347

Query: 274 IRLMLMETPSKRPNICQVL 292
           I  +L   P+KR    ++L
Sbjct: 348 IAKILTVNPAKRLTTEEIL 366

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 100/195 (51%), Gaps = 20/195 (10%)

Query: 104 VFVLMEFCERGGLIDFMNT-RLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIE 162
           ++ L+E+   G   DF++  +    L +   +   +Q +  I  +H  Q  +IHRDIK E
Sbjct: 237 LYFLLEYAPNG---DFLSVIKKYGSLNQDCSVYYSAQILDAIDYLH--QKGVIHRDIKPE 291

Query: 163 NVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI-DLYRGLP 221
           N+L+  +   K+ DFG+   ++     TQ +N ++       TA+Y SPE++ D Y    
Sbjct: 292 NILLDKDMKVKLTDFGTAK-LVEKDETTQTYNLLERSKSFVGTAEYVSPELLNDNY---- 346

Query: 222 IDEKSDIWALGIFLYKICYYTTPFEKSGE----AGILHARYQYPP-FPQYSDRLKNLIRL 276
           +D K DIWA G  L+++     PF+ + E      ++  +Y +   FP     +++LI+ 
Sbjct: 347 VDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLI---IRDLIKQ 403

Query: 277 MLMETPSKRPNICQV 291
           +L++ P +R +  QV
Sbjct: 404 ILVKNPEQRLDTLQV 418

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 110/232 (47%), Gaps = 37/232 (15%)

Query: 72  EVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRES 131
           E+  MKLL N+ +V+   D      V   A ++++++E+ E+G L + +  R    L E+
Sbjct: 78  EIIIMKLL-NHPNVLRLYD------VWETAQDLYMVLEYVEKGELFNLLVQR--GPLPEN 128

Query: 132 EILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQ 191
           E +    Q + GI+  HAL   ++HRD+K EN+L+ H    K+ DFG  +          
Sbjct: 129 EAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKLADFGMAA---------- 176

Query: 192 EFNYVQHDILTNTTA---QYRSPEMIDLYRGLPIDE-KSDIWALGIFLYKICYYTTPF-E 246
                  D L  T+     Y +PE++    GLP    +SD+W+ G+ LY +     PF E
Sbjct: 177 ---LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPFDE 230

Query: 247 KSGE-----AGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLE 293
           + G        +   +Y+ P   + S   ++LI  +L   P +R    ++L+
Sbjct: 231 EDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILK 282

>ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL045W and
            YAL017W (FUN31)
          Length = 1259

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 85/183 (46%), Gaps = 24/183 (13%)

Query: 112  ERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGL 171
            E G +  F    L+  + E E   +  Q   G+  +H  +  ++HRDIK ENV++ + G 
Sbjct: 1089 ETGSIDLFDLIELKTNMTEHEAKLLFKQVASGLRHLH--ENGIVHRDIKDENVIVDNRGR 1146

Query: 172  YKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIW 229
             K+ DFGS + V R P           D+   T   Y +PE++  D Y G P     D+W
Sbjct: 1147 VKIIDFGSAAYVKRGP----------FDVFVGTI-DYAAPEVLGGDPYEGKP----QDVW 1191

Query: 230  ALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRP--- 286
            A+G+ LY I Y   PF    E  IL    +  P    S+    LI  +L  + ++RP   
Sbjct: 1192 AVGVLLYTIIYKENPFYNIDE--ILDGDLRISPAVVVSEECVALITRILNRSVNRRPTVD 1249

Query: 287  NIC 289
            +IC
Sbjct: 1250 DIC 1252

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 95/196 (48%), Gaps = 24/196 (12%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           ++++ME+C  G   D +     N L E ++  I+ Q   G+  +H  +   IHRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEM----IDLYRG 219
           +L++  G+ K+ DFG VSG +R       F           T  + +PE+    +D Y  
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHLRSTMKRDTF---------VGTPYWMAPEVVCCEVDGY-- 189

Query: 220 LPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL-HARYQYPPFPQ--YSDRLKNLIRL 276
              +EK+DIW+LGI  Y++     P  K     ++ +   + PP  Q  +SD  K  +  
Sbjct: 190 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSDAAKEFVAG 246

Query: 277 MLMETPSKRPNICQVL 292
            L++ P+ RP+   +L
Sbjct: 247 CLVKVPADRPSAYDLL 262

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 102/231 (44%), Gaps = 32/231 (13%)

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMN 121
           D   +  ++ E+  +  LK   ++  Y  S+   +       ++++ME+C  G L   + 
Sbjct: 59  DSDEVEDVQREIQFLASLKQIHNITRYYGSYLKDT------SLWIIMEYCAGGSLRSLLR 112

Query: 122 TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVS 181
                ++ E  I  IM + +  +  +H  +  +IHRDIK  NVLI++ G  K+CDFG  +
Sbjct: 113 ---PGKIDEKYIGVIMREVLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVAA 167

Query: 182 GVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYY 241
            V +     Q             T  + +PE+I    G+  D K DIW+LGI  Y+I   
Sbjct: 168 QVNQTSLRRQTM---------AGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIATG 216

Query: 242 TTPFEKSGEAGILHARY----QYPPFPQ---YSDRLKNLIRLMLMETPSKR 285
             P+    E   L A        PP  +   YS  LK  I L L E P +R
Sbjct: 217 NPPY---CEVEALRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLDEDPKER 264

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 78/329 (23%), Positives = 139/329 (42%), Gaps = 70/329 (21%)

Query: 13  TILTVGSHHAKIIKYLTSGGFAQVYTAE-ISPPDPYTNANIA---------CLKRVIVP- 61
           T + VGS    + K +  G FA V+ A  I+P  P+ + ++          C    IVP 
Sbjct: 29  TTIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPR 88

Query: 62  ----DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLI 117
               +K+ L  L  E+  +K + ++ H+V  ID          + + +++ME+C  G L 
Sbjct: 89  SKLKNKKLLENLEIEIAILKKI-SHPHIVKLID------FERTSKDFYLIMEYCSLGDLT 141

Query: 118 DFMNTRLQ----------------------NRLRESEILEIMSQTVQGIAAMHALQPPLI 155
             +  R Q                      N L ++ IL  + Q    +  + +    L+
Sbjct: 142 FLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKN--LV 199

Query: 156 HRDIKIENVLIS-----HNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQ--- 207
           HRDIK +N+L+S     +N      D G V     P     +F + +   L NT+     
Sbjct: 200 HRDIKPQNLLLSAPLINYNDPKSFHDLGFVGIYNLPILKIADFGFAR--FLPNTSMAETL 257

Query: 208 -----YRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL------HA 256
                Y +PE+++  +    + K+D+W++G  LY++CY   PF+ S    +       + 
Sbjct: 258 CGSPLYMAPEILNYQK---YNAKADLWSVGTVLYEMCYGNPPFKASNHLELYKKIKKAND 314

Query: 257 RYQYPPFPQYSDRLKNLIRLMLMETPSKR 285
              +P + +  + LK+LI  +L   P +R
Sbjct: 315 LIYFPTYIEIDNNLKSLISKLLTFDPQER 343

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 111/224 (49%), Gaps = 30/224 (13%)

Query: 78  LLKNNKH--VVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILE 135
           +++ +KH  +V++IDS+ AK       +++++ME+ E G L D +   L   L E +I  
Sbjct: 668 VMRESKHSNIVNFIDSYLAKG------DLWIVMEYMEGGSLTDVVTHCL---LSEGQIGA 718

Query: 136 IMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNY 195
           +  +T++G+  +H+    ++HRDIK +N+L+S  G  K+ DFG  + +        E N 
Sbjct: 719 VCRETLKGLQFLHSKG--VLHRDIKSDNILLSLKGNIKLTDFGFCAQI-------NENNL 769

Query: 196 VQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF--EKSGEAGI 253
            +  ++   T  + +PE++      P   K DIW+LGI + ++     P+  E    A  
Sbjct: 770 KRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALY 824

Query: 254 LHARYQYPPFPQ---YSDRLKNLIRLMLMETPSKRPNICQVLEE 294
           L A    P   +    SD L   +   L   PS+R    ++L++
Sbjct: 825 LIATNGTPKLKEPEALSDTLTKFLDWCLKVDPSERATATELLDD 868

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 125/281 (44%), Gaps = 48/281 (17%)

Query: 31   GGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLN--------TLRAEVDAMKLLKNN 82
            G F  VY          T   +  +K+V VP     N         LR+EV  +K L ++
Sbjct: 1184 GSFGAVYLCL-----NVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DH 1237

Query: 83   KHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQ 142
             ++V Y+      ++    Y +F  +E+   G +   +  R+  R  E  I  + +Q ++
Sbjct: 1238 LNIVQYLGFENKNNI----YSLF--LEYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLK 1289

Query: 143  GIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILT 202
            G+A +H+    ++HRD+K +N+L+  +G+ K+ DF    G+ R  ++     Y   D+  
Sbjct: 1290 GLAYLHSKG--ILHRDMKADNLLLDQDGICKISDF----GISRKSKDI----YSNSDMTM 1339

Query: 203  NTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQY-- 260
              T  + +PEM+D  +G     K DIW+LG  + ++     P+       ++ A ++   
Sbjct: 1340 RGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPW---SNLEVVAAMFKIGK 1394

Query: 261  ----PPFPQYSDRL-----KNLIRLMLMETPSKRPNICQVL 292
                PP P+ +  L     +N +       P KRP   ++L
Sbjct: 1395 SKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELL 1435

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 132/281 (46%), Gaps = 30/281 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +      +    +A L    +  ++    L +E+   K +++  ++V
Sbjct: 106 FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMRH-ANIV 161

Query: 87  SYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAA 146
            +ID    ++       V++L+E C  G L++ +  R    L E E+    +Q   GI  
Sbjct: 162 QFIDCFEDET------NVYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGGIKY 213

Query: 147 MHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTA 206
           MH+ +  +IHRD+K+ N+    N   K+ DFG ++ V+    N +E  Y         T 
Sbjct: 214 MHSRR--VIHRDLKLGNIFFDKNYNLKIGDFG-LAAVL---ANDRERKYT-----VCGTP 262

Query: 207 QYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHAR-----YQYP 261
            Y +PE++ + +      + DIW++G+ +Y +     PF+ + +   ++ R     + +P
Sbjct: 263 NYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ-AKDVNTIYERIKCCDFVFP 320

Query: 262 PFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQIKP 302
                S   + L++ +L   P +RP+I +VL+ V    I P
Sbjct: 321 KEKYISSEARILVQDLLSLDPLERPSIMEVLDYVWFRGIFP 361

>YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}
           STE20Cdc42p-activated signal transducing kinase of the
           PAK (p21-activated kinase) family; involved in pheromone
           response, pseudohyphal/invasive growth, vacuole
           inheritance, down-regulation of sterol uptake; GBB motif
           binds Ste4p
          Length = 939

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 134/282 (47%), Gaps = 41/282 (14%)

Query: 21  HAKIIKYLTSGGFAQVYTA-EISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLL 79
           +A ++K +  G    VYTA EI      TN ++A  +  +  +KQ    L   ++ + ++
Sbjct: 620 YANLVK-IGQGASGGVYTAYEIG-----TNVSVAIKQMNL--EKQPKKELI--INEILVM 669

Query: 80  KNNKH--VVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIM 137
           K +KH  +V++IDS+  K       +++V+ME+ E G L D +   +   L E +I  + 
Sbjct: 670 KGSKHPNIVNFIDSYVLKG------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVC 720

Query: 138 SQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQ 197
            +T+ G+  +H+    ++HRDIK +N+L+S  G  K+ DFG  + +        E N  +
Sbjct: 721 RETLSGLEFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFGFCAQI-------NELNLKR 771

Query: 198 HDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF--EKSGEAGILH 255
             ++   T  + +PE++      P   K DIW+LGI + ++     P+  E    A  L 
Sbjct: 772 TTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLI 826

Query: 256 ARYQYPPFPQ---YSDRLKNLIRLMLMETPSKRPNICQVLEE 294
           A    P   +    S  LK  +   L   P  R +  ++L +
Sbjct: 827 ATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHD 868

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 107/221 (48%), Gaps = 26/221 (11%)

Query: 69  LRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRL 128
           ++ E+  +  LK   ++  Y  S+   +      +++++ME+C  G L   +      ++
Sbjct: 69  VQKEIQFLSSLKQVPNITHYYGSYLYDT------KLWIIMEYCAGGSLRTLLR---PGKI 119

Query: 129 RESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPR 188
            E  I  IM + +  +  +H  +  +IHRDIK  NVLI+++G  K+CDFG  + + +   
Sbjct: 120 DEKYIGVIMRELLVALLYIH--KDNVIHRDIKAANVLITNDGRVKLCDFGVAAQLTQ--- 174

Query: 189 NTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF--E 246
                + V+   +   T  + +PE+I    G+  D K DIW+LGI  Y+I     P+   
Sbjct: 175 -----SNVRRQTMAG-TPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEITTGNPPYCDV 226

Query: 247 KSGEAGILHARYQYPPFP--QYSDRLKNLIRLMLMETPSKR 285
           ++  A  L  + + P     QYS  LK  I L L E P +R
Sbjct: 227 EALRAMQLITKSKPPRLEGRQYSPLLKEFIALCLDEDPKER 267

>Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON}
           YHL007C (REAL)
          Length = 939

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 135/282 (47%), Gaps = 41/282 (14%)

Query: 21  HAKIIKYLTSGGFAQVYTA-EISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLL 79
           +A ++K +  G    VYTA EI      TN ++A  +  +  +KQ    L   ++ + ++
Sbjct: 622 YANLVK-IGQGASGGVYTAYEIG-----TNVSVAIKQMNL--EKQPKKELI--INEILVM 671

Query: 80  KNNKH--VVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIM 137
           K ++H  +V++IDS+  K       +++V+ME+ E G L D +   +   L E +I  + 
Sbjct: 672 KGSRHPNIVNFIDSYVLKG------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVC 722

Query: 138 SQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQ 197
            +T+ G+  +H+    ++HRDIK +N+L+S  G  K+ DFG  + +        E N  +
Sbjct: 723 RETLSGLKFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFGFCAQI-------NELNLKR 773

Query: 198 HDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF--EKSGEAGILH 255
             ++   T  + +PE++      P   K DIW+LGI + ++     P+  E    A  L 
Sbjct: 774 TTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLI 828

Query: 256 ARYQYPPFPQ---YSDRLKNLIRLMLMETPSKRPNICQVLEE 294
           A    P   +    S  LK  +   L   P +R +  ++L +
Sbjct: 829 ATNGTPKLKEPENLSSSLKKFLDWCLCVEPEERASATELLHD 870

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 97/195 (49%), Gaps = 23/195 (11%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIE 162
           +V++  E+C    L D +   LQ R+  S  +E+ +Q V  +   H+L    +HRD+K+E
Sbjct: 103 KVWMAQEYCPGKDLYDHV-LSLQ-RVPSSACIELFTQIVGAVYYAHSLN--CVHRDLKLE 158

Query: 163 NVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGL 220
           N+L+  NG  K+ DFG     +              + +  TT  Y +PE+I  + Y G 
Sbjct: 159 NILLDKNGNAKLTDFGFTRECMTK---------TSLETICGTTV-YMAPELIKRESYDGF 208

Query: 221 PIDEKSDIWALGIFLYKICYYTTPFEKSGEAGI-LHARYQYPPFPQ--YSDRLKNLIRLM 277
            I    DIW+LG+ LY +   + PF++  E         + P F     S+  K+L+  +
Sbjct: 209 KI----DIWSLGVILYTMLNGSMPFDEDDETKTEWKIMNEMPVFNDTILSEDAKDLLIKL 264

Query: 278 LMETPSKRPNICQVL 292
           L + P++RP++ ++L
Sbjct: 265 LSKDPNERPSMQEIL 279

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 75/302 (24%), Positives = 135/302 (44%), Gaps = 46/302 (15%)

Query: 5   QISLYEPGTILTVGSHHAKIIKY-LTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDK 63
           QI  ++ G  L +GS     + Y  T+G  A +   ++     + ++N+  +     PD 
Sbjct: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAI---KVISKTIFQDSNVTSMVDNTTPDA 70

Query: 64  QGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTR 123
                 R E+  MKLL N+ +V+   D     S       +++++E+ E+G L + +  R
Sbjct: 71  LPYGIER-EIVIMKLL-NHANVLRLYDVWETNS------NLYMVLEYAEKGELFNLLVER 122

Query: 124 LQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGV 183
               L E+E +    Q + GI+  HAL   ++HRD+K EN+L+      K+ DFG  +  
Sbjct: 123 --GPLPENEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDTKYNIKIADFGMAA-- 176

Query: 184 IRPPRNTQEFNYVQHDILTNTTA---QYRSPEMIDLYRGLPIDE-KSDIWALGIFLYKIC 239
                          D L  T+     Y +PE++    G+P     SD+W+ G+ LY + 
Sbjct: 177 -----------LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVILYALL 222

Query: 240 YYTTPFEKSGEAG--------ILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQV 291
               PF++  E G        +   +++ P   + S   +NLI  +L+  P++R     +
Sbjct: 223 TGRLPFDE--EDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDI 280

Query: 292 LE 293
           L+
Sbjct: 281 LK 282

>KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1.24
            YDR523C
          Length = 1515

 Score = 77.8 bits (190), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 69/310 (22%), Positives = 142/310 (45%), Gaps = 50/310 (16%)

Query: 27   YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGL----NTLRAEVDAMKLLKNN 82
            ++ SG F  V++A           +I  +K + + + + +    + ++ E++ M+ L + 
Sbjct: 1221 FVGSGNFGTVFSAV-----NLDTGDILAVKEIKLHNVKKMERIYSCIKEEIEIMERLNHP 1275

Query: 83   KHVVSY-IDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMS-QT 140
              +  Y ++ H  K        + + M++CE G L   ++     R+ +  + ++ S + 
Sbjct: 1276 NVINCYGVEVHRDK--------LNIFMDYCEGGSLSSLLD---HGRIEDEVVTQVYSLEL 1324

Query: 141  VQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSV--------------SGVIRP 186
            ++G+A +H  +  ++H+DIK +N+L++HNGL K  DFG+                 V+ P
Sbjct: 1325 LEGLAYLH--RSGVVHQDIKPQNILLNHNGLIKYVDFGTARKITANESASVNLDGKVLTP 1382

Query: 187  P----RNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYT 242
            P       ++F+    D++   T  Y +PE++         E  DIW+LG  + ++    
Sbjct: 1383 PPASGGTDKKFDTTVRDMI--GTPMYMAPEVVSGSDRSGCYESGDIWSLGCVILEMVTGK 1440

Query: 243  TPFEK-SGEAGILH--ARYQYPPFP---QYSDRLKNLIRLMLMETPSKRPNICQVLEEVS 296
            +P+     E  I++  A    PP P   + SD  +  +  ML+  P KR    ++L +  
Sbjct: 1441 SPWWNLENEWAIMYHVAAGHTPPLPSENEISDLGREFLERMLVADPKKRATAVELLVDPW 1500

Query: 297  RLQIKPCPIR 306
             +QI+    +
Sbjct: 1501 IVQIRELAFK 1510

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 77.8 bits (190), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 95/195 (48%), Gaps = 15/195 (7%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           ++ L+E+   G L+  +  +      E+  +   +Q +  I  +H++   +IHRDIK EN
Sbjct: 334 LYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSMG--IIHRDIKPEN 389

Query: 164 VLISHNGLYKVCDFGSV----SGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI-DLYR 218
           +L++ +   K+ DFG+            ++   FN ++       TA+Y SPE++ D Y 
Sbjct: 390 ILLTKDFKIKLTDFGTAKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPELLTDSY- 448

Query: 219 GLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHA--RYQYPPFPQYSDRLKNLIRL 276
               D + DIWA G  L+++     PF+ + E        + QY     +   L++LI+ 
Sbjct: 449 ---TDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAGFPTILRDLIKK 505

Query: 277 MLMETPSKRPNICQV 291
           +L++ P+ R  I Q+
Sbjct: 506 ILIKNPNNRLTIHQI 520

>YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One of two
            (see also PSK2) PAS domain containing S/T protein
            kinases; coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1356

 Score = 77.8 bits (190), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 81/180 (45%), Gaps = 22/180 (12%)

Query: 115  GLIDFMN-TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYK 173
            G ID  +    +  + E E   I  Q V GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1188 GCIDLFDLIEFKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1245

Query: 174  VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIWAL 231
            + DFGS + V   P           D+   T   Y +PE++  + Y G P     DIWA+
Sbjct: 1246 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGNPYEGQP----QDIWAI 1290

Query: 232  GIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQV 291
            GI LY + +   PF    E  IL    ++    + S+    LI+ +L     KRP I  +
Sbjct: 1291 GILLYTVVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRCVPKRPTIDDI 1348

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 77.8 bits (190), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 105/223 (47%), Gaps = 34/223 (15%)

Query: 31   GGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLN--------TLRAEVDAMKLLKNN 82
            G F  VY          T   +  +K+V VP     N         LR+EV  +K L ++
Sbjct: 1187 GSFGAVYLCL-----NVTTGEMMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLKDL-DH 1240

Query: 83   KHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQ 142
             ++V Y+      ++    Y +F  +E+   G +   +  R+  R  ES I  + +Q ++
Sbjct: 1241 LNIVQYLGFENKNNI----YSLF--LEYVAGGSVGSLI--RMYGRFDESLIRHLTTQVLK 1292

Query: 143  GIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILT 202
            G+A +H+    ++HRD+K +N+L+  +G+ K+ DF    G+ R  ++     Y   D+  
Sbjct: 1293 GLAYLHSKG--ILHRDMKADNLLLDQDGICKISDF----GISRKSKDI----YSNSDMTM 1342

Query: 203  NTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF 245
              T  + +PEM+D  +G     K DIW+LG  + ++     P+
Sbjct: 1343 RGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPW 1383

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 76.3 bits (186), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 95/196 (48%), Gaps = 24/196 (12%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           ++++ME+C  G   D +     N L E ++  I+ Q   G+  +H  +   IHRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEM----IDLYRG 219
           +L++  G+ K+ DFG VSG IR       F           T  + +PE+    +D Y  
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHIRSTMKRDTF---------VGTPYWMAPEVVCCEVDGY-- 189

Query: 220 LPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL-HARYQYPPFPQ--YSDRLKNLIRL 276
              +EK+DIW+LGI  Y++     P  K     ++ +   + PP  Q  +S+  K  +  
Sbjct: 190 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSEAAKEFVAG 246

Query: 277 MLMETPSKRPNICQVL 292
            L++ P+ RP+   +L
Sbjct: 247 CLVKAPADRPSAYDLL 262

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 102/200 (51%), Gaps = 31/200 (15%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQ-NRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKI 161
           +V++ +E+C    L D +   LQ  R+   E +++ SQ V  +   H+L    +HRD+K+
Sbjct: 111 KVWMALEYCPGRELYDHV---LQMKRIPAEECIQLFSQIVGAVYYAHSLN--CVHRDLKL 165

Query: 162 ENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDL--YRG 219
           EN+L+  +G  K+ DFG     +           V  + +  TT  Y +PE+ +   Y G
Sbjct: 166 ENILLDKDGNAKLTDFGFTRECMEK---------VNLETICGTTV-YMAPELTERKPYDG 215

Query: 220 LPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQ-YPPFPQYSDRL-----KNL 273
             I    DIW+LG+ LY +   + PF++  EA     +++     P+Y+ +      ++L
Sbjct: 216 FKI----DIWSLGVILYTMLSGSMPFDEDDEA---KTKWKIINEEPEYNSKFMTAEGEDL 268

Query: 274 IRLMLMETPSKRPNICQVLE 293
           +R +L +  + RP++ ++L+
Sbjct: 269 VRKLLQKDSNLRPSVREILQ 288

>NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON}
           Anc_3.92
          Length = 1116

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 94/193 (48%), Gaps = 22/193 (11%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           ++ L+E+   G L+  M  +    L E       +Q +  I  MH+    +IHRDIK EN
Sbjct: 248 LYFLLEYAPNGDLLSLM--KKFGSLNEECCCYYGAQIIDAIKFMHS--KGIIHRDIKPEN 303

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNT-----TAQYRSPEMI-DLY 217
           +L+  +   K+ DFG+   +   P  T       +D+LT +     TA+Y SPE++ D Y
Sbjct: 304 ILLDKDMKVKITDFGTAKILDNKPPGT------SYDLLTRSKSFVGTAEYVSPELLNDNY 357

Query: 218 RGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHA--RYQYPPFPQYSDRLKNLIR 275
                D +SDIWA G  ++++     PF+ + E        + QY     +   +++L++
Sbjct: 358 ----TDARSDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPTVVRDLVK 413

Query: 276 LMLMETPSKRPNI 288
            +L++ P +R  I
Sbjct: 414 RILIKAPEQRLTI 426

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 94/204 (46%), Gaps = 41/204 (20%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIE 162
           E+++++E+ + G L D++ +R   +L E E +    Q +QG+A  HA    + HRD+K E
Sbjct: 173 ELYLVLEYVDGGELFDYLVSR--GKLPEREAVHYFKQIIQGVAYCHAFN--ICHRDLKPE 228

Query: 163 NVLIS-HNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTA---QYRSPEMI--DL 216
           N+L+   N + K+ DFG  +  +              D L +T+     Y SPE++    
Sbjct: 229 NLLLDKKNKIIKIADFGMAALEVS-------------DKLLSTSCGSPHYASPEIVMGKS 275

Query: 217 YRGLPIDEKSDIWALGIFLYKICYYTTPFEKSG--------EAGILHARYQYPPFPQYSD 268
           Y G P    +D+W+ GI L+ +     PF            ++G+ H      P      
Sbjct: 276 YHGSP----TDVWSCGIILFALLTGHLPFNHDNIKKLLLKVQSGVYHMPSDLSP------ 325

Query: 269 RLKNLIRLMLMETPSKRPNICQVL 292
             K+LI  +L+  P KR    ++L
Sbjct: 326 DAKDLISKILVVDPDKRLTTTEIL 349

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 96/197 (48%), Gaps = 27/197 (13%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIE 162
           E+++++E+ + G L D++ +R   +L E+E +    Q +QG++  H+    + HRD+K E
Sbjct: 226 ELYLILEYVDGGELFDYLVSR--GKLPEAEAIHYFKQIIQGVSYCHSFN--ICHRDLKPE 281

Query: 163 NVLISHNGLYKV-CDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRG 219
           N+LI          DFG ++ +  P +  Q          +  +  Y SPE++    Y G
Sbjct: 282 NLLIDKKKKSIKIADFG-MAALELPKKLLQ---------TSCGSPHYASPEIVMGKSYHG 331

Query: 220 LPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL----HARYQYPPFPQYSDRLKNLIR 275
            P    SD+W+ GI L+ +     PF       +L      +YQ P     SD  K+LI 
Sbjct: 332 GP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKYQMP--KNLSDEAKDLIS 385

Query: 276 LMLMETPSKRPNICQVL 292
            +L+ +PSKR    ++L
Sbjct: 386 RILVVSPSKRLTTVEIL 402

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 137/290 (47%), Gaps = 31/290 (10%)

Query: 11  PGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLR 70
           P  I T G  + +  ++L  GGFA+ +  +      +    +A   ++ +  ++    L 
Sbjct: 132 PSLIKTRGRDYRRG-QFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTRRKLL 187

Query: 71  AEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRE 130
           +E+   K +K+ +++V ++D      +N     V++L+  C  G L++ +  R    L E
Sbjct: 188 SEIQIHKSMKH-QNIVQFVDCFE-DHIN-----VYILLGMCPNGSLMELLKKR--KILTE 238

Query: 131 SEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNT 190
            E+     Q    I  MH+ +  +IHRD+K+ N+    N   K+ DFG ++ V+    N 
Sbjct: 239 PEVRFFTVQICGAIKYMHSRR--VIHRDLKLGNIFFDENYNLKIGDFG-LAAVL---AND 292

Query: 191 QEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGE 250
           +E  Y         T  Y +PE++ L +      + DIW++G+ ++ +     PF+ + +
Sbjct: 293 RERKYT-----VCGTPNYIAPEVL-LGKHSGHSYEVDIWSIGVMIFALLIGKPPFQ-AKD 345

Query: 251 AGILHAR-----YQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEV 295
              +++R     Y +P     S   K LI+ +L+  P  RP+I +++E V
Sbjct: 346 VNTIYSRIKNSEYTFPINKSISQEAKTLIQDILINDPIARPSINEIMEYV 395

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 77/309 (24%), Positives = 130/309 (42%), Gaps = 46/309 (14%)

Query: 31   GGFAQVYTAEISPPDPYTNANIACLKRVIVP-----DKQGLNTLRAEVDAMKLLKNNKHV 85
            G F  VY          T   +  +K+V VP     D+  L+ L A    +  LK+  HV
Sbjct: 1155 GSFGSVYLGLN-----VTTGEMMAVKQVEVPRYGSQDETTLSVLEALKSEVSTLKDLDHV 1209

Query: 86   --VSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQG 143
              V Y+       V    Y +F  +E+   G +   +  RL  R  E  I  +  Q ++G
Sbjct: 1210 NIVQYLGFENKNHV----YSLF--LEYVAGGSVGSLI--RLFGRFDEDLIRFLAVQVLRG 1261

Query: 144  IAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTN 203
            +A +H+    ++HRD+K +N+L+  +G+ K+ DF    G+ +   N     Y   D+   
Sbjct: 1262 LAYLHSKG--ILHRDMKADNLLLDVDGICKISDF----GISKKSNNI----YSNSDMTMR 1311

Query: 204  TTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTP---FEKSGEAGILHARYQY 260
             T  + +PEM+D  +G     K DIW+LG  + ++     P   FE       +      
Sbjct: 1312 GTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFKIGKFKSA 1369

Query: 261  PPFPQYSDRL-----KNLIRLMLMETPSKRPNICQVLEEVSRLQIKPCPIRNFYLLRAMS 315
            PP P+ + +L     K+ +       P KRP    +L          C +R+ ++ +  S
Sbjct: 1370 PPIPEDTQKLLSAEAKSFLDACFEIDPEKRPTADDLLSHPF------CGVRSRFVFQETS 1423

Query: 316  QTAQLASEP 324
                + S+P
Sbjct: 1424 LARFIRSKP 1432

>Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {ON}
           YDR490C (PKH1) - Ser/Thr protein kinase [contig 184]
           FULL
          Length = 984

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 97/192 (50%), Gaps = 14/192 (7%)

Query: 104 VFVLMEFCERGGLIDFMNT-RLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIE 162
           ++ L+E+   G   DF++  +    L +   +   +Q +  I  +H     ++HRDIK E
Sbjct: 232 LYFLLEYAPNG---DFLSVIKKFGSLSQECAVYYSAQILDAIDYLH--HKGIVHRDIKPE 286

Query: 163 NVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI-DLYRGLP 221
           N+L+  +   K+ DFG+   ++     TQ FN ++       TA+Y SPE++ D Y    
Sbjct: 287 NILLDKDMKVKLTDFGTAR-ILEKDETTQTFNLLERSKSFVGTAEYVSPELLNDNY---- 341

Query: 222 IDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHA--RYQYPPFPQYSDRLKNLIRLMLM 279
           +D K DIWA G  L+++     PF+ + E        + QY     +   +++LI+ +L+
Sbjct: 342 VDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLVIRDLIKKILV 401

Query: 280 ETPSKRPNICQV 291
           ++P +R +  Q+
Sbjct: 402 KSPEQRLDASQI 413

>KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa]
           {ON} Anc_3.60 YNL298W
          Length = 829

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 115/245 (46%), Gaps = 43/245 (17%)

Query: 23  KIIKYLTSGGFAQVYTAEI--SPPDPYTNANIACLKR---VIVPDKQGLNTL------RA 71
           K+I+    G    VY AE   SPP  Y N ++  ++      + DK  +  +      R 
Sbjct: 532 KMIEKAGQGASGSVYLAERLESPPSEYQNDHVVSIENNEPQAIGDKVAIKQMILSKQPRK 591

Query: 72  E--VDAMKLLKNNKH--VVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFM-----NT 122
           E  V+ + ++KN++H  +V++++++          +++V+MEF E G L D +     N 
Sbjct: 592 ELIVNEILVMKNSRHKNIVNFLEAYLK-----TEDDLWVVMEFMEGGSLTDIIENSPTNG 646

Query: 123 RLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSG 182
              + L E +I  I+ +T QG+  +H     +IHRDIK +NVL+      K+ DFG  + 
Sbjct: 647 SNHSPLTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLDTRARVKITDFGFCAK 704

Query: 183 VI--RPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICY 240
           +   R  R T              T  + +PE++   +    DEK D+W+LGI   ++  
Sbjct: 705 LTDKRSKRATMV-----------GTPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLE 750

Query: 241 YTTPF 245
              P+
Sbjct: 751 GEPPY 755

>Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON}
           YHL007C (REAL)
          Length = 980

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 134/282 (47%), Gaps = 41/282 (14%)

Query: 21  HAKIIKYLTSGGFAQVYTA-EISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLL 79
           +A ++K +  G    VYTA EI      TN ++A  +  +  +KQ    L   ++ + ++
Sbjct: 661 YASLVK-IGQGASGGVYTAYEIG-----TNVSVAIKQMNL--EKQPKKELI--INEILVM 710

Query: 80  KNNKH--VVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIM 137
           K +KH  +V++IDS+  K       +++V+ME+ E G L D +   +   L E +I  + 
Sbjct: 711 KGSKHPNIVNFIDSYVLKG------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVC 761

Query: 138 SQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQ 197
            +T+ G+  +H+    ++HRDIK +N+L+S  G  K+ DFG  + +        E N  +
Sbjct: 762 RETLSGLKFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFGFCAQI-------NELNLKR 812

Query: 198 HDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF--EKSGEAGILH 255
             ++   T  + +PE++      P   K DIW+LGI + ++     P+  E    A  L 
Sbjct: 813 TTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLI 867

Query: 256 ARYQYPPFPQ---YSDRLKNLIRLMLMETPSKRPNICQVLEE 294
           A    P   +    S  LK  +   L   P +R +   +L +
Sbjct: 868 ATNGTPKLKEPENLSSYLKKFLDWCLCVEPEERASATDLLHD 909

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 79/291 (27%), Positives = 129/291 (44%), Gaps = 61/291 (20%)

Query: 17  VGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAM 76
           VG++  KI+K +  G F +VY A   P    T+  + CLK     DK   N +R      
Sbjct: 38  VGNY--KILKQIGEGSFGKVYLALHRP----THRKV-CLK---TSDKNDPNIVR------ 81

Query: 77  KLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEI 136
           ++  + +    YI       V     +V++ +E+C    L D  +     RL   E  E+
Sbjct: 82  EVFYHRQFDFPYITKLYEVIV--TESKVWMALEYCPGKELYD--HLLSLRRLSLLECGEL 137

Query: 137 MSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYV 196
            +Q    +   H++    +HRD+K+EN+L+  NG  K+ DFG                  
Sbjct: 138 FAQISGAVYYAHSMH--CVHRDLKLENILLDRNGNAKLTDFG-----------------F 178

Query: 197 QHDILTNTTAQ-------YRSPEMID--LYRGLPIDEKSDIWALGIFLYKICYYTTPFEK 247
             + +T TT +       Y +PE+I+   Y G  I    DIW+LG+ LY +     PF+ 
Sbjct: 179 TRECMTKTTLETVCGTTVYMAPELIERKTYDGFKI----DIWSLGVILYTLITGYLPFDD 234

Query: 248 SGEAGILHARYQ-YPPFPQYS-----DRLKNLIRLMLMETPSKRPNICQVL 292
             E   +  +++     P+Y      D  K+LI  +L + P +RP++ QVL
Sbjct: 235 DDE---VKTKWKIVNEEPKYDSKFIPDDAKDLISRLLAKNPGERPSLPQVL 282

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 113/228 (49%), Gaps = 27/228 (11%)

Query: 72  EVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRES 131
           E + ++ LKN K ++S   +   +S       ++ L+E+   G L+  M  R    + E 
Sbjct: 203 EKNTLQRLKNTKGIISLYFTFQDES------SLYFLLEYAPNGDLLSLM--RKHGSVNEK 254

Query: 132 EILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQ 191
                 +Q +  +  MH     +IHRD+K EN+L+  +   K+ DFG+     R   +T 
Sbjct: 255 CTQYYAAQIIDALGFMH--DKGVIHRDLKPENILLDVDMKVKLTDFGTA----RLLDSTS 308

Query: 192 EFNYVQHDILTNT-----TAQYRSPEMI-DLYRGLPIDEKSDIWALGIFLYKICYYTTPF 245
           E + +++D+LT +     TA+Y SPE++ D Y    +D + DIWA G  L+++     PF
Sbjct: 309 E-DDLKYDLLTRSNSFVGTAEYVSPELLNDNY----VDFRCDIWAFGCILFQMIAGKPPF 363

Query: 246 EKSGEAGILH--ARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQV 291
           + + E        + Q+     +   +++L++ +L++ P +R  I Q+
Sbjct: 364 KANNEYLTFQKVMKVQFAFTAGFPMTVRDLVKNILIKNPERRLLINQI 411

>TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa]
           {ON} Anc_3.60 YNL298W
          Length = 934

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 114/245 (46%), Gaps = 44/245 (17%)

Query: 23  KIIKYLTSGGFAQVYTAEI--SPPDPYTNANI-------------ACLKRVIVPDKQGLN 67
           K+I+    G    VY AE    PPDP +N N                +K++I+  +    
Sbjct: 638 KMIEKAGQGASGSVYLAERIRLPPDPISNNNAKYTTENSSQIGDKVAIKQMILSKQPRKE 697

Query: 68  TLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQN- 126
            +  E+  M+  ++ K++V++++++          +++V+ME+ E G L D +    +N 
Sbjct: 698 LIVNEILVMQDSRH-KNIVNFLEAYLK-----TEDDLWVVMEYMEGGSLTDIIENSPENV 751

Query: 127 ----RLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSG 182
                L E +I  I+ +T QG+  +H     +IHRDIK +NVL+ + G  K+ DFG  + 
Sbjct: 752 TNKSPLTEPQIAYIVRETCQGLKFLHERH--IIHRDIKSDNVLLDNQGRVKITDFGFCAK 809

Query: 183 VI--RPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICY 240
           +   R  R T              T  + +PE++   +    DEK D+W+LGI   ++  
Sbjct: 810 LTDQRSKRATMV-----------GTPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLE 855

Query: 241 YTTPF 245
              P+
Sbjct: 856 GEPPY 860

>TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.496
           YHL007C
          Length = 973

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 117/235 (49%), Gaps = 30/235 (12%)

Query: 13  TILTVG--SHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLR 70
           TI++ G  S H K +  +  G    V+TA     D      +  +K++ +  +     + 
Sbjct: 666 TIVSEGDPSKHYKDLVKIGQGASGGVFTAH----DSRDENRLVAIKQMNLQKQPKKELII 721

Query: 71  AEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRE 130
            E+  MK  ++ +++V++IDS+  K       +++V+ME+ E G L D +   +   L E
Sbjct: 722 NEIIVMKGSRH-ENIVNFIDSYLMKG------DLWVVMEYMEGGSLTDVVTHCI---LTE 771

Query: 131 SEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNT 190
            +I  +  +T+ G+A +H+    +IHRDIK +N+L+S NG  K+ DFG  + +       
Sbjct: 772 GQIGTVCKETLGGLAFLHSKG--VIHRDIKSDNILLSMNGDIKLTDFGFCAQI------- 822

Query: 191 QEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF 245
            E +  +  ++   T  + +PE++      P   K DIW+LGI + ++     P+
Sbjct: 823 NEVHLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 872

>TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.496
            YHL007C
          Length = 1316

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 78/297 (26%), Positives = 139/297 (46%), Gaps = 41/297 (13%)

Query: 31   GGFAQVYTA-EISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYI 89
            G    VYTA E+      TNA++A +K++ +  +     +  E+  MK  K+ K++V++I
Sbjct: 1036 GASGGVYTAYEVG-----TNASVA-VKQMNLEKQPKTELIINEIIVMKESKH-KNIVNFI 1088

Query: 90   DSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHA 149
            DS+  K       +++V+ME+ E G L D +   +   L E +I  +  +T+ G+  +H+
Sbjct: 1089 DSYLLKG------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLNGLKFLHS 1139

Query: 150  LQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYR 209
                +IHRDIK +N+L+S  G  K+ DFG  + +        E +  +  ++   T  + 
Sbjct: 1140 KG--VIHRDIKSDNILLSMQGDIKLTDFGFCAQI-------NEVHLKRTTMV--GTPYWM 1188

Query: 210  SPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF--EKSGEAGILHARYQYPPFPQ-- 265
            +PE++      P   K DIW+LGI + ++     P+  E    A  L A    P   +  
Sbjct: 1189 APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKEPE 1245

Query: 266  -YSDRLKNLIRLMLMETPSKRPNICQVLE-----EVSRLQIKPCPIRNFYLLRAMSQ 316
              S  L N +   L   P  R    ++LE     EV+   I   P+     ++ +++
Sbjct: 1246 KLSSILHNFLDACLKVDPEVRATATELLETELITEVASENISLAPLVKVARMKKIAE 1302

>Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON}
            (95617..100392) [4776 nt, 1592 aa]
          Length = 1591

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 75/312 (24%), Positives = 142/312 (45%), Gaps = 59/312 (18%)

Query: 26   KYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLN----TLRAEVDAMKLLKN 81
            +++ SG F  V++A         +  I  +K + + D + +      ++ E+  +++L N
Sbjct: 1278 QFIGSGTFGNVFSAV-----NLGSGEILAVKEIKIQDSKTMEKIFPLIKEEMSVLEML-N 1331

Query: 82   NKHVVSY--IDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMS- 138
            + ++V Y  I+ H  K        V + MEFCE G L   +      R+ +  + ++ S 
Sbjct: 1332 HPNIVQYYGIEVHRDK--------VNIFMEFCEGGSLASLLE---HGRIEDEMVTQMYSL 1380

Query: 139  QTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRP------------ 186
            Q ++G+A +H  Q  ++HRDIK EN+L+  NG+ K  DFG+   ++              
Sbjct: 1381 QLLEGLAYLH--QSGIVHRDIKPENILLDFNGIIKYVDFGAARKLVESNSKFITTSNKSD 1438

Query: 187  ---PRNTQEFNYVQHD----ILTNTTAQYRSPEMIDLYRGLPIDEK---SDIWALGIFLY 236
                ++T + + +++D    +    T  Y +PE I    G P   K    D+W+LG  + 
Sbjct: 1439 AEDDQDTTKMSSIKNDGNGVMNMVGTPMYMAPEAI---TGSPSKGKFGADDVWSLGCVVL 1495

Query: 237  KICYYTTPFEK-SGEAGILH--ARYQYPPFPQYSDRLKNL----IRLMLMETPSKRPNIC 289
            ++     P+     E  I++  A    PP P  +D L  +    +R  L + PS R    
Sbjct: 1496 EMVTGKRPWANLDNEWAIMYHVAAGHIPPLPA-NDELSTIGFKFLRRSLQQNPSTRATAV 1554

Query: 290  QVLEEVSRLQIK 301
            ++L +   ++I+
Sbjct: 1555 ELLTDPWIVEIR 1566

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 127/276 (46%), Gaps = 34/276 (12%)

Query: 27  YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKH-- 84
           +L  GGFA+ +  +      +    +A  K  I  +K    T R  +  +++ K+ KH  
Sbjct: 95  FLGEGGFARCFQMKDDKGKVFAAKTVA--KLSIKSEK----TRRKLLSEIQIHKSMKHPN 148

Query: 85  VVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGI 144
           +V + D     +       V++L+E C  G +++ +  R    L E E+   M Q +  I
Sbjct: 149 IVQFTDCFEDDT------NVYILLEICPNGSVMELLRQR--KHLTEPEVRFCMIQIIGAI 200

Query: 145 AAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNT 204
             MH+ +  +IHRD+K+ N+        K+ DFG ++ V+    N +E  Y         
Sbjct: 201 RYMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFG-LAAVLA---NDKERKYT-----ICG 249

Query: 205 TAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHAR-----YQ 259
           T  Y +PE++   +      + DIW++G+ LY + +   PF+ + E   ++ R     + 
Sbjct: 250 TPNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQ-AKEVETIYERIKCRDFI 307

Query: 260 YPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEV 295
           +P     S   KNLI  +L   P+ RP++ ++ + V
Sbjct: 308 FPADKPVSSDAKNLISHLLQLNPAARPSLYEITDNV 343

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/264 (23%), Positives = 124/264 (46%), Gaps = 41/264 (15%)

Query: 48   TNANIACLKRVIVPD-----KQGLNTLRAEVDAMKLLKNNKH--VVSYIDSHAAKSVNGV 100
            T   +  +K++ VP      +  LNT+ A    +  LK+  H  +V Y+      ++   
Sbjct: 1156 TTGEMMAVKQIEVPSYGSQSETMLNTVEAMKSEVSTLKDLDHLNIVQYLGFEMKHNI--- 1212

Query: 101  AYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIK 160
             Y +F  +E+   G +   +  R+  R  +  I  + +Q ++G++ +H+    ++HRD+K
Sbjct: 1213 -YSLF--LEYVAGGSVGSLI--RMYGRFDDKLIRHLTNQVLEGLSYLHSQG--ILHRDMK 1265

Query: 161  IENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGL 220
             +N+L+  +G+ K+ DFG +S      + +++  Y   ++    T  + +PEM+D  +G 
Sbjct: 1266 ADNLLLDQDGICKISDFG-IS------KKSEDI-YSNSEMTMRGTVFWMAPEMVDTKQGY 1317

Query: 221  PIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQY------PPFPQYSDRL---- 270
              + K DIW+LG  + ++     P+       ++ A Y+       PP P+ +  L    
Sbjct: 1318 --NAKVDIWSLGCVVLEMFAGKRPW---SNFEVVTAMYKIGQSKSAPPIPEDTKDLISPT 1372

Query: 271  -KNLIRLMLMETPSKRPNICQVLE 293
             KN +       P +RP   Q+LE
Sbjct: 1373 AKNFLNQCFHIDPKERPTAGQLLE 1396

>AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YCR073C
            (SSK22) and YNR031C (SSK2)
          Length = 1483

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 132/288 (45%), Gaps = 33/288 (11%)

Query: 27   YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPD----KQGLNTLRAEVDAMKLLKNN 82
            ++  G F  VY+A           +I  +K +   D    KQ   ++R E+  +++L N+
Sbjct: 1196 FIGGGSFGSVYSAV-----NLDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEML-NH 1249

Query: 83   KHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMS-QTV 141
             +VV Y      +        V + ME+CE G L   +      R+ +  + ++ S Q +
Sbjct: 1250 PNVVQYYGVEVHRD------RVNIFMEYCEGGSLASLLA---HGRIEDEMVTQVYSLQML 1300

Query: 142  QGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDIL 201
            +G+A +H  +  + HRDIK EN+L+  NG+ K  DFG+    +     +++ N  QH   
Sbjct: 1301 EGLAYLH--ESGVDHRDIKPENILLDFNGIIKYVDFGAAK--VLASNGSKKLNLEQHMEG 1356

Query: 202  TNT--TAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEK-SGEAGILH--A 256
                 T  Y SPE I    G       DIW+LG  + ++     P+     +  I++  A
Sbjct: 1357 EKMIGTPMYMSPEAIS-GTGYGKFGSDDIWSLGCVILEMVTGRRPWANLDNQWAIIYQVA 1415

Query: 257  RYQYPPFPQYSDRLKNLIRLM---LMETPSKRPNICQVLEEVSRLQIK 301
              Q P FP  ++  +  I+ +   L++ P++R    ++L +   ++I+
Sbjct: 1416 AGQIPMFPSKNEMSQAGIKFLSRCLIQDPNQRSTAVELLMDPWIIEIR 1463

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 94/200 (47%), Gaps = 31/200 (15%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIE 162
           E+++++E+ + G L D++ ++   +L E E +    Q ++G+   H+    + HRD+K E
Sbjct: 234 ELYLVLEYVDGGELFDYLVSK--GKLTELEAVRYFKQIIRGVQYCHSFN--ICHRDLKPE 289

Query: 163 NVLISHN-GLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTA--QYRSPEMI--DLY 217
           N+L+     L K+ DFG  +              V + +L  +     Y SPE++    Y
Sbjct: 290 NLLLDKKRKLIKIADFGMAAL------------QVSNTLLKTSCGSPHYASPEIVMGKTY 337

Query: 218 RGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL----HARYQYPPFPQYSDRLKNL 273
            G P    SD+W+ GI L+ +     PF       +L    + RYQ P +   S   K+L
Sbjct: 338 NGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLIKVQNGRYQMPNY--LSKDAKDL 391

Query: 274 IRLMLMETPSKRPNICQVLE 293
           I  +L+  P  R    Q+LE
Sbjct: 392 ISRILLVNPKARLTTEQILE 411

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 95/194 (48%), Gaps = 20/194 (10%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           ++++ME+C  G L   +      ++ E  I  IM + +  +  +H  +  +IHRDIK  N
Sbjct: 88  LWIIMEYCAGGSLRSLLRP---GKIDEKYIGVIMRELLVALKVIH--KDNVIHRDIKAAN 142

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPID 223
           VLI++ G  K+CDFG  + + +     Q             T  + +PE+I    G+  D
Sbjct: 143 VLITNEGQVKLCDFGVAAQLNQTSLRRQTM---------AGTPYWMAPEVI--MEGVYYD 191

Query: 224 EKSDIWALGIFLYKICYYTTPF--EKSGEAGILHARYQYPPFPQ--YSDRLKNLIRLMLM 279
            K DIW+LGI  Y+I     P+   ++  A  L  + + P   +  Y+ +LK  I L L 
Sbjct: 192 TKVDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLKEFIALCLD 251

Query: 280 ETPSKRPNICQVLE 293
           E P +R +  ++L+
Sbjct: 252 EDPQERLSAEELLK 265

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 112/242 (46%), Gaps = 42/242 (17%)

Query: 14  ILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV--PDKQGLNTLRA 71
           ++ VG++  +I+K +  G F +VY A   P            ++V++   DK   N +R 
Sbjct: 35  LIEVGNY--RILKQIGEGSFGKVYLALHRPTH----------RKVVLKTSDKNDPNIVR- 81

Query: 72  EVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRES 131
                ++  + +    YI       +     +V++ +E+C    L D +      R+  +
Sbjct: 82  -----EVFYHRQFDYPYIT--KVYEIIVTETKVWMALEYCPGKELYDHL--LFSKRIPIA 132

Query: 132 EILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQ 191
           E  E+ +Q V  +   H+L    +HRD+K+EN+L+  +G  K+ DFG     +   R+T 
Sbjct: 133 ECTELFAQIVGAVYYAHSLN--CVHRDLKLENILLDKHGRAKLTDFGFTRECM--TRSTL 188

Query: 192 EFNYVQHDILTNTTAQYRSPEMIDL--YRGLPIDEKSDIWALGIFLYKICYYTTPFEKSG 249
           E        +  TT  Y +PE+I+   Y G  I    DIWALG+ LY + Y   PF++  
Sbjct: 189 E-------TVCGTTV-YMAPELIERKSYDGFKI----DIWALGVILYTMIYGAMPFDEDD 236

Query: 250 EA 251
           E 
Sbjct: 237 EV 238

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 103/228 (45%), Gaps = 26/228 (11%)

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMN 121
           D   +  ++ E+  +  LK   ++  Y  S+   +       ++++ME+C  G L   + 
Sbjct: 59  DSDEVEDVQREIQFLASLKQISNITRYYGSYLKDT------SLWIIMEYCAGGSLRSLLR 112

Query: 122 TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVS 181
                ++ E  I  IM + +  +  +H  +  +IHRDIK  NVLI++ G  K+CDFG  +
Sbjct: 113 P---GKIDEKYIGVIMRELLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVAA 167

Query: 182 GVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYY 241
            V +     Q             T  + +PE+I    G+  D K DIW+LGI  Y+I   
Sbjct: 168 QVNQTSLRRQTM---------AGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIATG 216

Query: 242 TTPF--EKSGEAGILHARYQYPPFP--QYSDRLKNLIRLMLMETPSKR 285
             P+   ++  A  L  + + P      YS  LK  I L L E P +R
Sbjct: 217 NPPYCDVEALRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLDEDPKER 264

>KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {ON}
           similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007C STE20 Signal transducing kinase of the PAK (p21-
           activated kinase) family involved in pheromone response
           and pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 954

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 79/296 (26%), Positives = 138/296 (46%), Gaps = 39/296 (13%)

Query: 8   LYEPGTILTVGSHHAKIIKYLT---SGGFAQVYTA-EISPPDPYTNANIACLKRVIVPDK 63
           LY   T +      +K+ K L     G    VYTA E+      TNA++A +K++ +  +
Sbjct: 649 LYAKLTEICTDGDPSKLYKSLIKIGQGASGGVYTAYEVG-----TNASVA-IKQMNLEKQ 702

Query: 64  QGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTR 123
                +  E+  MK  K+  ++V++IDS+  +       +++V+ME+ E G L D +   
Sbjct: 703 PKKELIINEILVMKASKH-ANIVNFIDSYLLRG------DLWVVMEYMEGGSLTDVVTHC 755

Query: 124 LQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGV 183
           +   L E +I  +  +T++G+  +H+    +IHRDIK +N+L+S  G  K+ DFG  + +
Sbjct: 756 I---LTEGQIGAVSRETLKGLQFLHSKG--VIHRDIKSDNILLSMTGEIKLTDFGFCAQI 810

Query: 184 IRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTT 243
                   E N  +  ++   T  + +PE++      P   K DIW+LGI + ++     
Sbjct: 811 -------NEINLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEP 858

Query: 244 PF--EKSGEAGILHARYQYPPFPQ---YSDRLKNLIRLMLMETPSKRPNICQVLEE 294
           P+  E    A  L A    P        SD LK  +   L   P +R    ++L +
Sbjct: 859 PYLNETPLRALYLIATNGTPELKDADSLSDDLKGFLGWCLHVDPDERATASELLSD 914

>NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {ON}
           Anc_6.262 YPL236C
          Length = 406

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 78/153 (50%), Gaps = 9/153 (5%)

Query: 156 HRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMID 215
           HR+IK  N+L S +G   + D  S S      +  ++    +  I +  +  + SPE++D
Sbjct: 251 HRNIKPSNILFSSDGSQVISDLSSTSKSNIHLKTGKQILDFKEWIDSCCSVPFMSPELLD 310

Query: 216 LYRGLPIDEKSDIWALGIFLYKICYYTTPFE-------KSGEAGILHARYQYPP-FPQYS 267
           L  G  IDEK DIW+LG  +Y I    +PFE       KS    IL A + +P    +++
Sbjct: 311 LKMGSKIDEKVDIWSLGCTIYTIILGVSPFEREVQLTGKSIRMLILSANFTFPEGMERHA 370

Query: 268 DR-LKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299
            R L + I+  L   P+KRP I Q+L ++  LQ
Sbjct: 371 SRELIDTIKQCLQVDPTKRPTINQLLNDLQALQ 403

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 97/202 (48%), Gaps = 21/202 (10%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           ++ L+E+   G  +  +  +    L E       SQ +  + ++H++   +IHRDIK EN
Sbjct: 199 LYFLLEYAPHGDFLGLI--KKYGSLNEICARYYASQIIDAVDSLHSIG--IIHRDIKPEN 254

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQE----FNYVQHDILTNTTAQYRSPEMI-DLYR 218
           +L+  +   K+ DFG+   +   P N  +    F+          TA+Y SPE++ D Y 
Sbjct: 255 ILLDKDMKVKLTDFGTAKILPEQPSNAADGKPCFDLYAKSKSFVGTAEYVSPELLNDSY- 313

Query: 219 GLPIDEKSDIWALGIFLYKICYYTTPFEKSGE----AGILHARYQYPP-FPQYSDRLKNL 273
               D + DIWA G  LY++     PF+ + E      ++  +Y +   FPQ    +K+L
Sbjct: 314 ---TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQI---VKDL 367

Query: 274 IRLMLMETPSKRPNICQVLEEV 295
           ++ +L+  P+ R  I Q+   V
Sbjct: 368 VKKLLVRDPNDRLAIEQIKAHV 389

>CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} similar
           to uniprot|P08458 Saccharomyces cerevisiae YDR523c SPS1
           ser/thr protein kinase
          Length = 521

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/265 (24%), Positives = 126/265 (47%), Gaps = 27/265 (10%)

Query: 31  GGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYID 90
           G F  VY A+    D + N  +A     +   ++ +  L  E+  +  LK+      Y+ 
Sbjct: 14  GNFGDVYKAK----DTWLNEVVAVKVVNLENSEEEVELLAQEIFFLAELKS-----PYVT 64

Query: 91  SHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHAL 150
           ++ A  V  V+  +++ ME+C  G + D +     + L E +   I  + ++G++ +H+ 
Sbjct: 65  NYIATVVEDVS--MWIAMEYCGGGSVGDLLKYHYTSGLPEHKTRFITREILKGLSYLHSQ 122

Query: 151 QPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRS 210
           +   IHRDIK  N+L++  G  K+ DFG VSG +         +  + D     T  + +
Sbjct: 123 RK--IHRDIKAANILLTDEGKVKLSDFG-VSGKL--------LSSFRRDTFVG-TPYWMA 170

Query: 211 PEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL-HARYQYPP--FPQYS 267
           PE++  +     DE++DIW+LGI + ++   + P  K     ++ +   + PP     +S
Sbjct: 171 PEIV-AHDSEGYDERADIWSLGITVIEMLRGSPPLSKYDPMKVIANLPKRKPPKLHGDFS 229

Query: 268 DRLKNLIRLMLMETPSKRPNICQVL 292
           D  K+ + L L++  + RP    +L
Sbjct: 230 DDAKHFVALCLIKESAIRPTAADLL 254

>Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W
            (REAL)
          Length = 1357

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 79/177 (44%), Gaps = 22/177 (12%)

Query: 115  GLIDFMN-TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYK 173
            G ID  +    +  + E E   I  Q V GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1189 GCIDLFDLIEFKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1246

Query: 174  VCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIWAL 231
            + DFGS + V   P           D+   T   Y +PE++  + Y G P     DIWA+
Sbjct: 1247 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGNPYEGQP----QDIWAI 1291

Query: 232  GIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNI 288
            GI LY + +   PF    E  IL    ++      S+    LI+ +L     KRP I
Sbjct: 1292 GILLYTVVFKENPFYNIDE--ILEGDLKFNNAEGVSEDCIELIKSILNRCVPKRPTI 1346

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 111/235 (47%), Gaps = 37/235 (15%)

Query: 69  LRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRL 128
           +  E+  MKLL N+ +V+   D      V   + ++++++E+ E+G L + +  R    L
Sbjct: 73  IEREIIIMKLL-NHPNVLRLYD------VWETSKDLYMVLEYVEKGELFNLLVER--GPL 123

Query: 129 RESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPR 188
            E+E +    Q + GI+  HAL   ++HRD+K EN+L+ H    K+ DFG  +       
Sbjct: 124 PENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNVKLADFGMAA------- 174

Query: 189 NTQEFNYVQHDILTNTTA---QYRSPEMIDLYRGLPIDE-KSDIWALGIFLYKICYYTTP 244
                     D L  T+     Y +PE++    GLP    +SD+W+ G+ LY +     P
Sbjct: 175 ------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLP 225

Query: 245 F-EKSGE-----AGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLE 293
           F E+ G        +   +++ P   + S   ++LI  +L   P +R    ++L+
Sbjct: 226 FDEEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILK 280

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/281 (23%), Positives = 126/281 (44%), Gaps = 48/281 (17%)

Query: 31   GGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLN--------TLRAEVDAMKLLKNN 82
            G F  VY          T   +  +K+V VP     N         LR+EV  +K L ++
Sbjct: 1184 GSFGAVYLCL-----NVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DH 1237

Query: 83   KHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQ 142
             ++V Y+      ++    Y +F  +E+   G +   +  R+  R  E  I  + +Q ++
Sbjct: 1238 LNIVQYLGFENKDNI----YSLF--LEYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLK 1289

Query: 143  GIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILT 202
            G+A +H+    ++HRD+K +N+L+  +G+ K+ DF    G+ R  ++     Y   D+  
Sbjct: 1290 GLAYLHSKG--ILHRDMKADNLLLDQDGICKISDF----GISRKSKDI----YSNSDMTM 1339

Query: 203  NTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQY-- 260
              T  + +PEM+D  +G     K DIW+LG  + ++     P+       ++ A ++   
Sbjct: 1340 RGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPW---SNLEVVAAMFKIGK 1394

Query: 261  ----PPFPQYSDRLKNLIRLMLMET-----PSKRPNICQVL 292
                PP P+ +  L + +    ++      P KRP   ++L
Sbjct: 1395 SKSAPPIPEDTLPLISQVGRGFLDACFEINPEKRPTATELL 1435

>Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 124/269 (46%), Gaps = 38/269 (14%)

Query: 31  GGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYID 90
           G +  VY A     D      +  +K ++  + + LN + AE+ ++    NN ++V Y  
Sbjct: 34  GSYGVVYKAINKHTD-----QVVAIKEIVYENDEELNDIMAEI-SLLKNLNNNNIVKY-H 86

Query: 91  SHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHAL 150
               KS     YE+++L+E+C  G L   + +R    L E+E    ++QT+ G+  +H  
Sbjct: 87  GFIRKS-----YELYILLEYCANGSLRRLV-SRSPTGLSENESKTYVTQTLWGLKYLHG- 139

Query: 151 QPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQE--FNYVQHDILTNTTAQY 208
              +IHRDIK  N+L+S +   K+ DFG VS ++     T     N++  +IL N  A  
Sbjct: 140 -EGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSALTLAGTLNWMAPEILGNRGAS- 196

Query: 209 RSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHA---RYQYPPFPQ 265
                            SDIW+LG  + ++     P+    +A I +A      YPP   
Sbjct: 197 ---------------TLSDIWSLGATVVELLTKNPPYHNLTDANIYYAVENDTYYPP-TA 240

Query: 266 YSDRLKNLIRLMLMETPSKRPNICQVLEE 294
           +S+ LK+ +    ++   KRP   Q+L+ 
Sbjct: 241 FSESLKDFLSKCFVKNMYKRPTADQLLKH 269

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 130/281 (46%), Gaps = 30/281 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +      +    +A   ++ +  ++    L +E+   K +++  ++V
Sbjct: 84  FLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHF-NIV 139

Query: 87  SYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAA 146
            +ID     +       V++L+E C  G L+D +  R    L E E+    +Q V  +  
Sbjct: 140 QFIDCFEDDT------NVYILLEICPNGSLMDLLKRR--KVLTEPEVRFFTTQIVGAVKY 191

Query: 147 MHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTA 206
           MH+ +  +IHRD+K+ N+    +   K+ DFG ++ V+    N +E  Y         T 
Sbjct: 192 MHSRR--VIHRDLKLGNIFFDKHYNLKIGDFG-LAAVL---ANDRERKYT-----VCGTP 240

Query: 207 QYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHAR-----YQYP 261
            Y +PE++   +      + DIW+ G+ +Y +     PF+ + E  I++ R     Y +P
Sbjct: 241 NYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQ-AKEVNIIYERIKCGDYVFP 298

Query: 262 PFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQIKP 302
                S     LIR +L   P +RP++ ++++ V    I P
Sbjct: 299 RDKCISQEALTLIRDILSIDPLERPSLDEIIDYVWFRGIFP 339

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 94/187 (50%), Gaps = 16/187 (8%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           ++++ME+C  G   D +    +  L E++   I  + ++G+  +H  +   IHRDIK  N
Sbjct: 86  IWIVMEYCGGGSCADLIKYAYKRGLPENKASFITKEVLKGLRYLHEQKK--IHRDIKAAN 143

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPID 223
           +L++ +G+ K+ DFG VSG I+       F           T  + +PE++        +
Sbjct: 144 ILLTDDGMVKLGDFG-VSGQIKATLKKDTF---------VGTPYWMAPEVVKKDES-GYN 192

Query: 224 EKSDIWALGIFLYKICYYTTPFEKSGEAGILHA--RYQYPPF-PQYSDRLKNLIRLMLME 280
           EK+DIW+LGI +Y++     P  K     ++ +  + + P     YS+  K+ I   L++
Sbjct: 193 EKADIWSLGITVYELLKGCPPLAKYDPMKVMISVPKRRAPKLHGHYSEDAKSFISHCLIK 252

Query: 281 TPSKRPN 287
            P+ RPN
Sbjct: 253 DPNARPN 259

>NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141
          Length = 948

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 75/322 (23%), Positives = 134/322 (41%), Gaps = 68/322 (21%)

Query: 15  LTVGSHHAKIIKYLTSGGFAQVYTAEI----------SPPDPYTNANIACLKRVIVPDKQ 64
           +T+G     I K +  G FA V+ A +          SPP    N  I  + R  + +K+
Sbjct: 30  ITIGPDTYMIDKEIGKGSFATVHRAHLLRKQIKDDLTSPP---LNFAIKIVSRSKLKNKK 86

Query: 65  GLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRL 124
            L  L  E+  +K + N+ H+V  ID     +      + +++ME+C  G L   +  R 
Sbjct: 87  LLENLEIEIAILKKI-NHPHIVKLIDCERTTT------DFYLIMEYCALGDLTFLIKKRH 139

Query: 125 Q----------------------NRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIE 162
           +                      N L  + IL  + Q    +  + +    L+HRDIK +
Sbjct: 140 ELIKNHPLLEKIFEKYPSPNENYNGLHRAFILNYLQQLASALKFLRS--KNLVHRDIKPQ 197

Query: 163 NVL-----ISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQ--------YR 209
           N+L     I++N        G +     P     +F + +   L NT+          Y 
Sbjct: 198 NLLLLTPLINYNDSKAFKKLGFIGIYELPILKIADFGFAR--FLPNTSMAETLCGSPLYM 255

Query: 210 SPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL------HARYQYPPF 263
           +PE+++  +    + K+D+W++G  LY++CY T PF+ S    +       + +  +P +
Sbjct: 256 APEILNYQK---YNAKADLWSVGTVLYEMCYGTPPFKASNHLELYKKIKRSNNKINFPNY 312

Query: 264 PQYSDRLKNLIRLMLMETPSKR 285
            Q  + +K LI  +L   P +R
Sbjct: 313 IQIQNDMKILISKLLTFDPQRR 334

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/281 (22%), Positives = 130/281 (46%), Gaps = 30/281 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +         +    +A   ++ +  ++    L +E+   K +K+ +++V
Sbjct: 150 FLGEGGFARCFQIRDDSGKLFAAKTVA---KLSIKTEKTRKKLLSEIQIHKSMKH-QNIV 205

Query: 87  SYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAA 146
            +ID     +       V++L+E C  G L++ +  R Q  L E E+    +Q    I  
Sbjct: 206 QFIDCFEDDT------NVYILLEICPNGSLMELLKKRKQ--LTEPEVRFFTTQICGAIKY 257

Query: 147 MHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTA 206
           MH+ +  +IHRD+K+ N+    N   K+ DFG ++ V+   R        +       T 
Sbjct: 258 MHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG-LAAVLANDR--------ERKFTVCGTP 306

Query: 207 QYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGILHAR-----YQYP 261
            Y +PE++ + +      + D+W++G+ +Y +     PF+ + +   ++ R     + +P
Sbjct: 307 NYIAPEVL-MGKHSGHSYEVDVWSIGVMVYALLVGKPPFQ-AKDVNTIYERIKCCDFIFP 364

Query: 262 PFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQIKP 302
                S   K L++ +L   P +RP+I ++++ V    I P
Sbjct: 365 KEKPISHEAKVLVQDLLSLDPLERPSISEIMDYVWFRGIFP 405

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 102/202 (50%), Gaps = 27/202 (13%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           + +++E+   G    ++  + + RL+ES    + SQ V G+  MH     L+HRD+K+EN
Sbjct: 152 IGIVLEYASGGEFYKYI--QKKRRLKESVASNLFSQLVSGVYYMHCKG--LVHRDLKLEN 207

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQ-YRSPEMIDLYRGLPI 222
           +L+   G   + DFG V+          EF+     + T+  +  Y +PE++   R  P 
Sbjct: 208 LLLDKYGNLIITDFGFVN----------EFSKFSELMKTSCGSPCYAAPELVISTR--PY 255

Query: 223 D-EKSDIWALGIFLYKICYYTTPFE---KSGEAGILHARYQY-----PPFPQY-SDRLKN 272
           +  K+DIW+ GI L+ +     P++   K+ +   +   Y+Y       FP+Y S   ++
Sbjct: 256 EARKADIWSCGIILFAMLAGYLPWDDDPKNPDGNDIAKLYKYITTTPLKFPEYISPMARD 315

Query: 273 LIRLMLMETPSKRPNICQVLEE 294
           L+R +L+  P KR  + Q+L+ 
Sbjct: 316 LLRNILIPYPQKRATLKQILKH 337

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 93/197 (47%), Gaps = 27/197 (13%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIE 162
           E+F+++E+ + G L D++ +R   RL E E +    Q ++G A  H+    + HRD+K E
Sbjct: 131 ELFLVLEYVDGGELFDYLVSR--GRLSEKEAIHYFRQIIEGTAYCHSFN--ICHRDLKPE 186

Query: 163 NVLISH-NGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRG 219
           N+L+   N   K+ DFG  +         Q  N +     +  +  Y SPE++    Y G
Sbjct: 187 NLLLDKKNKRIKIADFGMAA--------LQTSNKLLE--TSCGSPHYASPEIVMGKTYNG 236

Query: 220 LPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL----HARYQYPPFPQYSDRLKNLIR 275
            P    SD+W+ GI L+ +     PF       +L      +YQ P     S   ++LI 
Sbjct: 237 GP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMP--QAISLEAQDLIS 290

Query: 276 LMLMETPSKRPNICQVL 292
            +L+  P+KR  I  +L
Sbjct: 291 RILVVDPNKRITINDIL 307

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 93/195 (47%), Gaps = 20/195 (10%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           ++++ME+C  G +   +      ++ E  I  IM + +  +  +H  +  +IHRDIK  N
Sbjct: 114 LWIIMEYCAGGSVRTLLR---PGKIDEKYIAVIMRELLVALHYIH--KDNVIHRDIKAAN 168

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPID 223
           +LI++ G  K+CDFG  + + +        N ++   +   T  + +PE+I    G+  D
Sbjct: 169 LLITNEGNVKLCDFGVAAQLNQ--------NTMRRQTMAG-TPYWMAPEVI--MEGISYD 217

Query: 224 EKSDIWALGIFLYKICYYTTPFEKSGEAGILHARYQYPPF----PQYSDRLKNLIRLMLM 279
            K+DIW++GI  Y+I     PF +      +    +  P       +   LK  I + L 
Sbjct: 218 TKADIWSVGITAYEIATGNPPFCEMEALRAMQVISKSKPARLEGKNHDPLLKEFIAMCLD 277

Query: 280 ETPSKRPNICQVLEE 294
           E P +RP   ++L E
Sbjct: 278 EDPQERPTADKLLHE 292

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 103/228 (45%), Gaps = 26/228 (11%)

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMN 121
           D+  +  ++ EV  +  +K   ++  Y  S+   +       +++++E+C  G L   + 
Sbjct: 65  DEDEVEDVQREVQFLASMKQTPNITHYYGSYLKDTT------LWIIIEYCAGGSLRTLLR 118

Query: 122 TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVS 181
                ++ E  I  IM + +  +  +H     +IHRDIK  NVLI++ G  K+CDFG  +
Sbjct: 119 ---PGKIDEKYIGIIMREVLIALKYIHKDN--VIHRDIKAANVLITNEGHVKLCDFGVAA 173

Query: 182 GVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYY 241
            + +     Q             T  + +PE+I    G+  D K DIW+LGI  Y+I   
Sbjct: 174 QLNQSSLKRQTM---------AGTPYWMAPEVI--MEGVSYDTKVDIWSLGITTYEIATG 222

Query: 242 TTPF--EKSGEAGILHARYQYPPFP--QYSDRLKNLIRLMLMETPSKR 285
             P+   ++  A  L  + + P      YS  LK  I L L E P +R
Sbjct: 223 NPPYCDVEALRAMQLITKSKPPRLEGRHYSPMLKEFIALCLDEDPKER 270

>Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL045W
            (REAL)
          Length = 1106

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 82/185 (44%), Gaps = 21/185 (11%)

Query: 112  ERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGL 171
            E G +  F     +  + E E   +  Q V  I  +H     ++HRDIK EN+++  +G 
Sbjct: 936  ETGSIDLFDVIEFKKDMVEHEAKLVFKQVVSSIKHLH--DQGIVHRDIKDENIIVDSHGF 993

Query: 172  YKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRGLPIDEKSDIW 229
             K+ DFGS +     P           D+    T  Y +PE++    Y+G P     DIW
Sbjct: 994  VKLIDFGSAAYTKSGP----------FDVFVG-TMDYAAPEVLGGSSYKGKP----QDIW 1038

Query: 230  ALGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNIC 289
            ALG+ LY I Y   P+    E  IL    ++      SD   +LI+ +L     KRP I 
Sbjct: 1039 ALGVLLYTIIYKENPYYNIDE--ILEGELRFDNAENVSDECISLIKGILTREVDKRPTID 1096

Query: 290  QVLEE 294
             + ++
Sbjct: 1097 DIYQD 1101

>Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {ON}
           YDR490C (REAL)
          Length = 764

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 96/198 (48%), Gaps = 21/198 (10%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           ++ L+E+   G  +  +  +    L E       SQ +  + ++H +   +IHRDIK EN
Sbjct: 198 LYFLLEYAPHGDFLALI--KKYGSLNEQCARYYASQIIDAVDSLHTIG--IIHRDIKPEN 253

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQE----FNYVQHDILTNTTAQYRSPEMI-DLYR 218
           +L+  +   K+ DFG+   +   P N  +    F+          TA+Y SPE++ D Y 
Sbjct: 254 ILLDKDMKVKLTDFGTAKILPEEPSNDADGKPCFDLNARSKSFVGTAEYVSPELLNDSY- 312

Query: 219 GLPIDEKSDIWALGIFLYKICYYTTPFEKSGE----AGILHARYQYPP-FPQYSDRLKNL 273
               D + DIWA G  L+++     PF+ S E      ++  +Y +   FPQ    +K+L
Sbjct: 313 ---TDSRCDIWAFGCILFQMVAGKPPFKASNEYLTFQKVMKIQYAFTAGFPQI---IKDL 366

Query: 274 IRLMLMETPSKRPNICQV 291
           ++ +L++ P+ R  I Q+
Sbjct: 367 VKKLLVKEPNDRLTIEQI 384

>Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {ON}
            YNR031C (REAL)
          Length = 1376

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 136/309 (44%), Gaps = 50/309 (16%)

Query: 27   YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLN----TLRAEVDAMKLLKNN 82
            ++  G F QVY+A         N  I  +K + + D + +      ++ E++ +++L N+
Sbjct: 1079 FIGGGTFGQVYSAV-----NLENGEILAVKEINLHDTKTMKKIFPLIKEEMNVLEML-NH 1132

Query: 83   KHVVSY--IDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMS-Q 139
             +VV Y  ++ H  K        V + ME+CE G L   +      R+ +  + ++ + +
Sbjct: 1133 PNVVQYYGVEVHRDK--------VNIFMEYCEGGSLAALLE---HGRIEDEMVTQVYTLE 1181

Query: 140  TVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVI----RPPRNTQ---- 191
             ++G+  +H  Q  ++HRDIK EN+L+  NG+ K  DFG+    +    R  RN      
Sbjct: 1182 LLEGLTYLH--QSGVVHRDIKPENILLDFNGIIKYVDFGTARTFVETSTRAMRNATINDL 1239

Query: 192  -------EFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTP 244
                   E NY+   +    T  Y +PE I            D+WALG  + ++     P
Sbjct: 1240 DLPESEPETNYMDGMM---GTPMYMAPETISGSAAKGKLGADDVWALGCVVLEMVTGRRP 1296

Query: 245  FEK-SGEAGILH--ARYQYPPFP---QYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRL 298
            +     E  I++  A    P FP   + + + +  +   L++ P+ R +  ++L +    
Sbjct: 1297 WSNLDNEWAIMYHVAAGHIPQFPNKDEVTSKGRAFLERCLVQDPASRASAVELLIDPWMA 1356

Query: 299  QIKPCPIRN 307
            QI+     N
Sbjct: 1357 QIRDIAFGN 1365

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 96/195 (49%), Gaps = 25/195 (12%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           V++++E+C    L + +    + RL   E  ++ SQ    +   H L+   +HRD+K+EN
Sbjct: 103 VWMVLEYCSGHELYEHLLK--EQRLSLEESKKLFSQIASAVYYAHELK--CVHRDLKLEN 158

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQEF-NYVQHDILTNTTAQYRSPEMID--LYRGL 220
           VL+  NG  K+ DFG           T+E     Q + +  TT  Y +PE+I+   Y G 
Sbjct: 159 VLLDGNGHAKLTDFGF----------TREMATRSQLETICGTTV-YMAPELIERKCYDGF 207

Query: 221 PIDEKSDIWALGIFLYKICYYTTPFEKSGEAGI-LHARYQYPPFPQ--YSDRLKNLIRLM 277
            +    DIW+LGI LY +     PF++  +    L        F Q   SD   +LI+ M
Sbjct: 208 KV----DIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQEWISDDAIDLIQGM 263

Query: 278 LMETPSKRPNICQVL 292
           L + P++R ++ QVL
Sbjct: 264 LRKNPNERISLAQVL 278

>NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6.341
          Length = 1683

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 70/306 (22%), Positives = 135/306 (44%), Gaps = 52/306 (16%)

Query: 27   YLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNTL----RAEVDAMKLLKNN 82
            ++  G F  VY+A         N  I  +K + + D + +  +    + E+  +++L N+
Sbjct: 1366 FIGGGTFGTVYSAV-----NLDNGEILAVKEIKIQDSKTMKKIFPLVKEEMTVLEML-NH 1419

Query: 83   KHVVSY--IDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMS-Q 139
             ++V Y  ++ H  K        V + ME+CE G +   +      R+ +  + ++ + +
Sbjct: 1420 PNIVQYYGVEVHRDK--------VNIFMEYCEGGSMASLLE---HGRIEDEMVTQVYTLE 1468

Query: 140  TVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQ-- 197
             ++G+A +H  Q  ++HRDIK EN+L+  NG+ K  DFG+   + +        N     
Sbjct: 1469 LLEGLAYLH--QAGVVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTKVTNINSKSKD 1526

Query: 198  ----------------HDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYY 241
                            HD+L   T  Y +PE I  Y+        DIW+ G  + ++   
Sbjct: 1527 DDEPDEKDTEGGANSVHDML--GTPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEMITG 1584

Query: 242  TTPFEK-SGEAGILH--ARYQYP--PFP-QYSDRLKNLIRLMLMETPSKRPNICQVLEEV 295
              P+     E  I++  A  Q P  P+P + S   +  ++  L++ P KR    ++L + 
Sbjct: 1585 RRPWANLDNEWAIIYHVAAGQTPQLPYPNEVSPAGRRFLQRCLVQDPIKRATAVELLMDP 1644

Query: 296  SRLQIK 301
              ++I+
Sbjct: 1645 WIVEIR 1650

>CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31
          Length = 1336

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 79/178 (44%), Gaps = 19/178 (10%)

Query: 112  ERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGL 171
            E G +  F     +  + E E   +  Q V G+  +H     ++HRDIK EN+++   G 
Sbjct: 1166 ETGSIDLFDLIEFKTNMTEIEAKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDSQGF 1223

Query: 172  YKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEK-SDIWA 230
             K+ DFGS + V   P           D+   T   Y +PE++    G P + K  DIWA
Sbjct: 1224 VKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLG---GSPYEGKPQDIWA 1269

Query: 231  LGIFLYKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNI 288
            +GI LY I +   PF    E  IL    ++      S++   LI  +L     KRP I
Sbjct: 1270 IGILLYTIVFKENPFYNIDE--ILEGELKFNSSELVSEQCTTLIAKILNRNVQKRPTI 1325

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 111/235 (47%), Gaps = 37/235 (15%)

Query: 69  LRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRL 128
           +  E+  MKLL N+ +V+   D     S      ++++++E+ E+G L + +  R    L
Sbjct: 76  IEQEIIIMKLL-NHPNVLRLFDVWETNS------DLYLVLEYAEKGELFNMLVER--GPL 126

Query: 129 RESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPR 188
            E+E +    Q + GI+  H+L   ++HRD+K EN+L+ +    K+ DFG  +       
Sbjct: 127 PENEAVRAFRQIIIGISYCHSLG--VVHRDLKPENLLLDNKLNIKIADFGMAA------- 177

Query: 189 NTQEFNYVQHDILTNTTA---QYRSPEMIDLYRGLPIDE-KSDIWALGIFLYKICYYTTP 244
                     D L  T+     Y +PE+I    GLP +   SD+W+ G+ L+ +     P
Sbjct: 178 ------LESEDKLLETSCGSPHYAAPEIIS---GLPYEGFSSDVWSCGVILFALLTGRLP 228

Query: 245 F-EKSGE-----AGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLE 293
           F E+ G        +    ++ P   + +   ++L+  +L   PSKR  I ++L+
Sbjct: 229 FDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILK 283

>Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON}
            similar to Ashbya gossypii ABR014W
          Length = 1122

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 75/270 (27%), Positives = 129/270 (47%), Gaps = 36/270 (13%)

Query: 31   GGFAQVYTA-EISPPDPYTNANIACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYI 89
            G    VYTA EI      TNA++A +K++ +  +     +  E+  MK  K+ K++V++I
Sbjct: 845  GASGGVYTAYEIG-----TNASVA-IKQMNLEKQPKKELIINEILVMKGSKH-KNIVNFI 897

Query: 90   DSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHA 149
            DS+  K       +++V+ME+ E G L D +   +   L E +I  +  +T++G+  +H+
Sbjct: 898  DSYLLKG------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIAAVSRETLRGLHFLHS 948

Query: 150  LQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYR 209
                +IHRDIK +N+L+S +G  K+ DFG  + +        E N  +  ++   T  + 
Sbjct: 949  KG--VIHRDIKSDNILLSMDGNIKLTDFGFCAQI-------NESNLKRTTMV--GTPYWM 997

Query: 210  SPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF--EKSGEAGILHARYQYPPFPQ-- 265
            +PE++      P   K DIW+LGI + ++     P+  E    A  L A    P      
Sbjct: 998  APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKDAG 1054

Query: 266  -YSDRLKNLIRLMLMETPSKRPNICQVLEE 294
              S  LK  +   L   P  R    ++L +
Sbjct: 1055 SLSSVLKRFLNWCLHVNPENRATAVELLSD 1084

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 99/229 (43%), Gaps = 28/229 (12%)

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMN 121
           D   +  ++ E+  +  LK   ++  Y  S+   +       ++++ME C  G L   + 
Sbjct: 59  DSDEVEDVQREIQFLASLKQISNITRYYGSYLKDT------SLWIIMEHCAGGSLRSLLR 112

Query: 122 TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVS 181
                ++ E  I  IM + +  +  +H     +IHRDIK  NVLI++ G  K+CDFG  +
Sbjct: 113 ---PGKIDEKYIGVIMRELLVALKCIHKDN--VIHRDIKAANVLITNEGNVKLCDFGVAA 167

Query: 182 GVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYY 241
            V +     Q             T  + +PE+I    G+  D K DIW+LGI  Y+I   
Sbjct: 168 QVNQTSLRRQTM---------AGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIATG 216

Query: 242 TTPFEKSGEAGILHARYQYPPFPQYSDR-----LKNLIRLMLMETPSKR 285
             P+        +    +  P P+  DR     LK  I L L E P +R
Sbjct: 217 NPPYCDVEALRAMQLIIKSKP-PRLEDRSYSTSLKEFIALCLDEDPKER 264

>NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5.406
          Length = 1015

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 102/228 (44%), Gaps = 26/228 (11%)

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMN 121
           D+  +  ++ EV  +  LK   ++  Y  S+   +       ++++ME+C  G L   + 
Sbjct: 73  DEDEVEDVQREVQFLSSLKQIPNITRYYGSYLKDT------SLWIIMEYCAGGSLRSLLR 126

Query: 122 TRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVS 181
                ++ E  I  IM + +  +  +H  +  +IHRDIK  NVLI++ G  K+CDFG  +
Sbjct: 127 ---PGKIDEKYIGVIMRELLVALKYIH--KDNVIHRDIKAANVLITNEGSVKLCDFGVAA 181

Query: 182 GVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYY 241
            + +     Q             T  + +PE+I    G+  D K DIW+LGI  Y+I   
Sbjct: 182 QLNQSTLRRQTM---------AGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATG 230

Query: 242 TTPF-EKSGEAGILHARYQYPPFPQ---YSDRLKNLIRLMLMETPSKR 285
             P+ E      +       PP  +   Y+  LK  I L L E P +R
Sbjct: 231 NPPYCEVEALRAMQLITKSKPPRLESRSYTPLLKEFIALCLDEDPKER 278

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 93/197 (47%), Gaps = 27/197 (13%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIE 162
           E+F+++E+ + G L D++ +R   RL E E +    Q ++G A  H     + HRD+K E
Sbjct: 131 ELFLVLEYVDGGELFDYLVSR--GRLPEKEAIHYFRQIIEGTAYCHGFN--ICHRDLKPE 186

Query: 163 NVLISH-NGLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMI--DLYRG 219
           N+L+   N   K+ DFG  +         Q  N +     +  +  Y SPE++    Y G
Sbjct: 187 NLLLDKKNKRIKIADFGMAA--------LQTSNKLLE--TSCGSPHYASPEIVMGKNYNG 236

Query: 220 LPIDEKSDIWALGIFLYKICYYTTPFEKSGEAGIL----HARYQYPPFPQYSDRLKNLIR 275
            P    SD+W+ GI L+ +     PF       +L      +YQ P     S   ++LI 
Sbjct: 237 GP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMP--QSVSSGAQDLIS 290

Query: 276 LMLMETPSKRPNICQVL 292
            +L+  P KR +I ++L
Sbjct: 291 RILVVDPDKRISINEIL 307

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 107/228 (46%), Gaps = 26/228 (11%)

Query: 69  LRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFMNTRLQNRL 128
           ++ EV  +  LK   ++  Y  S   ++      +++V+ME+C  G L     T L+   
Sbjct: 66  VQKEVQFLSSLKQVPNITQYYGSFLYET------KLWVIMEYCAGGSL----RTLLRPGK 115

Query: 129 RESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPPR 188
            + + L ++ + +  +A ++  +  +IHRDIK  NVLI++ G  K+CDFG  + +     
Sbjct: 116 IDEKYLGVIVRNLL-VALLYIHKDNVIHRDIKAANVLITNGGHVKLCDFGVAAQLTTANH 174

Query: 189 NTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPF--E 246
             Q             T  + +PE+I    G+  + K+DIW+LGI  Y+I     P+   
Sbjct: 175 KRQTM---------AGTPYWMAPEVI--MEGVYYNTKADIWSLGITTYEIATGNPPYCDV 223

Query: 247 KSGEAGILHARYQYPPFP--QYSDRLKNLIRLMLMETPSKRPNICQVL 292
           ++  A  L  + + P      YS  LK  I L L E P  RP   ++L
Sbjct: 224 EALRAMQLITKSKPPRLEGRNYSPLLKEFIALCLDEDPEARPTAEELL 271

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 96/202 (47%), Gaps = 21/202 (10%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIEN 163
           ++ L+E+   G  +  +  +    L E       SQ +  + ++HA+   +IHRDIK EN
Sbjct: 199 LYFLLEYASHGDFLGLI--KKYGSLNEKCARYYASQIIDAVDSLHAIG--IIHRDIKPEN 254

Query: 164 VLISHNGLYKVCDFGSVSGVIRPPRNTQE----FNYVQHDILTNTTAQYRSPEMI-DLYR 218
           +L+  +   K+ DFG+   +   P N  +    F+          TA+Y SPE++ D Y 
Sbjct: 255 ILLDKDMKVKLTDFGTAKILPEQPSNNADGKPCFDLYARSKSFVGTAEYVSPELLNDSY- 313

Query: 219 GLPIDEKSDIWALGIFLYKICYYTTPFEKSGE----AGILHARYQYPP-FPQYSDRLKNL 273
               D + DIWA G  LY++     PF+ + E      ++  +Y +   FP  +   K+L
Sbjct: 314 ---TDSRCDIWAFGCILYQMVAGKPPFKAANEYLTFQKVMKIQYAFTAGFPLIA---KDL 367

Query: 274 IRLMLMETPSKRPNICQVLEEV 295
           ++ +L+  P+ R  + Q+   V
Sbjct: 368 VKKLLVREPNDRLTVEQIKAHV 389

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 81,370,311
Number of extensions: 3573259
Number of successful extensions: 13928
Number of sequences better than 10.0: 1834
Number of HSP's gapped: 13113
Number of HSP's successfully gapped: 1882
Length of query: 808
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 690
Effective length of database: 39,950,811
Effective search space: 27566059590
Effective search space used: 27566059590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)