Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_9.235.699ON52752724120.0
YIL146C (ATG32)5.699ON52952919980.0
Skud_9.225.699ON53753719940.0
Suva_9.435.699ON51343016100.0
ZYRO0G06666g5.699ON5035107171e-87
TDEL0B022205.699ON4895066862e-83
CAGL0H06545g5.699ON4922344294e-46
SAKL0E14850g5.699ON4704054057e-43
KNAG0L021005.699ON4445053624e-37
AFR283W5.699ON4523823469e-35
TBLA0E020905.699ON7491633531e-34
KAFR0D022505.699ON5563583453e-34
Ecym_40215.699ON4593943381e-33
NCAS0G002605.699ON5103403364e-33
KLTH0E01122g5.699ON4723733311e-32
Kwal_55.197165.699ON4673813081e-29
KLLA0A00660g5.699ON5244172702e-24
TPHA0D045805.699ON47050770.70
Kpol_2001.735.699ON411117723.2
Ecym_63511.264ON796124723.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_9.23
         (527 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON} Y...   933   0.0  
YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}  AT...   774   0.0  
Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON} Y...   772   0.0  
Suva_9.43 Chr9 complement(68866..68940,68994..69068,69093..69122...   624   0.0  
ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {...   280   1e-87
TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {O...   268   2e-83
CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} simila...   169   4e-46
SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} simi...   160   7e-43
KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5....   144   4e-37
AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic ho...   137   9e-35
TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.6...   140   1e-34
KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {O...   137   3e-34
Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON} s...   134   1e-33
NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}...   134   4e-33
KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {...   132   1e-32
Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON...   123   1e-29
KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON...   108   2e-24
TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON}             34   0.70 
Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON} (1997...    32   3.2  
Ecym_6351 Chr6 complement(681995..684385) [2391 bp, 796 aa] {ON}...    32   3.9  

>Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON}
           YIL146C (REAL)
          Length = 527

 Score =  933 bits (2412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/527 (88%), Positives = 465/527 (88%)

Query: 1   MVLNYPQREIKESSSKDMAPTSSSMDICSRSDAQAEEDRGLLDPHLSVLELLGKTGHSPS 60
           MVLNYPQREIKESSSKDMAPTSSSMDICSRSDAQAEEDRGLLDPHLSVLELLGKTGHSPS
Sbjct: 1   MVLNYPQREIKESSSKDMAPTSSSMDICSRSDAQAEEDRGLLDPHLSVLELLGKTGHSPS 60

Query: 61  PMGQSLVTSIDISGHQNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSX 120
           PMGQSLVTSIDISGHQNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTS 
Sbjct: 61  PMGQSLVTSIDISGHQNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSE 120

Query: 121 XXXXXXXAPAADIINIIKQGQEGTNVTSSSHPFRQLHKVISLPIPSREKTPYKEQDINDD 180
                  APAADIINIIKQGQEGTNVTSSSHPFRQLHKVISLPIPSREKTPYKEQDINDD
Sbjct: 121 EEQELLQAPAADIINIIKQGQEGTNVTSSSHPFRQLHKVISLPIPSREKTPYKEQDINDD 180

Query: 181 EDGAYEEDSVTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIPKEYQSL 240
           EDGAYEEDSVTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIPKEYQSL
Sbjct: 181 EDGAYEEDSVTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIPKEYQSL 240

Query: 241 FELPKYHDSATFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVL 300
           FELPKYHDSATFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVL
Sbjct: 241 FELPKYHDSATFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVL 300

Query: 301 KSFLRNKLIKLLFPPVVVTNRKDLKKMFQRLQDLSLXXXXXXXXXXXXXXTTKSRSYYRY 360
           KSFLRNKLIKLLFPPVVVTNRKDLKKMFQRLQDLSL              TTKSRSYYRY
Sbjct: 301 KSFLRNKLIKLLFPPVVVTNRKDLKKMFQRLQDLSLEYAEDENEEGDDDETTKSRSYYRY 360

Query: 361 XXXXXXXXXXXXXXXXXXXXXQRFFTSWFTWGISITIGISFGCCVTYFVTAAYDHQTVKX 420
                                QRFFTSWFTWGISITIGISFGCCVTYFVTAAYDHQTVK 
Sbjct: 361 KKANNSKRKSPKSNKKPKKKKQRFFTSWFTWGISITIGISFGCCVTYFVTAAYDHQTVKS 420

Query: 421 XXXXXXXXXXXXXXXXXXDTVNTPATASPSSSEHFLWFDKGTLQINFHLDGLIMKSLSVI 480
                             DTVNTPATASPSSSEHFLWFDKGTLQINFHLDGLIMKSLSVI
Sbjct: 421 LSLRSSLLTSMLSLDSSSDTVNTPATASPSSSEHFLWFDKGTLQINFHLDGLIMKSLSVI 480

Query: 481 KETWVKMNDFVLHALSRPLSFLENLNRSSDFSIDESNRILALGYILL 527
           KETWVKMNDFVLHALSRPLSFLENLNRSSDFSIDESNRILALGYILL
Sbjct: 481 KETWVKMNDFVLHALSRPLSFLENLNRSSDFSIDESNRILALGYILL 527

>YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}
           ATG32Mitochondrial outer membrane protein required to
           initiate mitophagy; recruits the autophagy adaptor
           protein Atg11p and the ubiquitin-like protein Atg8p to
           the mitochondrial surface to initiate mitophagy, the
           selective vacuolar degradation of mitochondria in
           response to starvation; can promote pexophagy when
           placed ectopically in the peroxisomal membrane
          Length = 529

 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/529 (76%), Positives = 431/529 (81%), Gaps = 2/529 (0%)

Query: 1   MVLNYPQREIKESSSKDMAPTSSSMDICSRSDAQAEEDRGLLDPHLSVLELLGKTGHSPS 60
           MVL Y QRE K SSSK M P SSS  I + S+AQ  ED+GLLDPHLSVLELL KTGHSPS
Sbjct: 1   MVLEYQQREGKGSSSKSMPPDSSSTTIHTCSEAQTGEDKGLLDPHLSVLELLSKTGHSPS 60

Query: 61  PMGQSLVTSIDISGHQNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSX 120
           PMGQ+LVTSIDISG+ NVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTS 
Sbjct: 61  PMGQNLVTSIDISGNHNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSE 120

Query: 121 XXXXXXXAPAADIINIIKQGQEGTNVTSSSHPFRQLHKVISLPIPSREKTPYKEQDINDD 180
                  APAADIINIIKQGQEG NV S SHPF+QL K+ISLP+P +EKTP+ EQD + D
Sbjct: 121 EEQELLQAPAADIINIIKQGQEGANVVSPSHPFKQLQKIISLPLPGKEKTPFNEQDDDGD 180

Query: 181 EDGAYEEDSVTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIPKEYQSL 240
           ED A+EEDSVTITKSLTSSTNSFVMPKLSL+QKNPVFRLLILGRTGS+FYQSIPKEYQSL
Sbjct: 181 EDEAFEEDSVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSL 240

Query: 241 FELPKYHDSATFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVL 300
           FELPKYHDSATFPQYTGI+IIFQELREMVSLLNRIVQYSQGKP+IPICQPGQ IQVKNVL
Sbjct: 241 FELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVL 300

Query: 301 KSFLRNKLIKLLFPPVVVTNRKDLKKMFQRLQDLSLXXXXXXXXXXXXXXT--TKSRSYY 358
           KSFLRNKL+KLLFPPVVVTN++DLKKMFQRLQDLSL                 TKSRSY 
Sbjct: 301 KSFLRNKLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEYGEDVNEEDNDDEAIHTKSRSYC 360

Query: 359 RYXXXXXXXXXXXXXXXXXXXXXQRFFTSWFTWGISITIGISFGCCVTYFVTAAYDHQTV 418
           R                      Q+FFTSWFTWGISITIGISFGCCVTYFVTAAY+HQTV
Sbjct: 361 RNKKAENSKKKSPKSNKKPKRKKQKFFTSWFTWGISITIGISFGCCVTYFVTAAYEHQTV 420

Query: 419 KXXXXXXXXXXXXXXXXXXXDTVNTPATASPSSSEHFLWFDKGTLQINFHLDGLIMKSLS 478
           K                   DT+NTPATASPSS+E FLWFDKGTLQINFH DG IMKSL+
Sbjct: 421 KSLSLRPSILASLLSLDSSSDTINTPATASPSSTEQFLWFDKGTLQINFHSDGFIMKSLT 480

Query: 479 VIKETWVKMNDFVLHALSRPLSFLENLNRSSDFSIDESNRILALGYILL 527
           +IKETW KMN FVLHALS+PL FLENLN+SS+FSIDESNRILALGYILL
Sbjct: 481 IIKETWGKMNTFVLHALSKPLKFLENLNKSSEFSIDESNRILALGYILL 529

>Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON}
           YIL146C (REAL)
          Length = 537

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/537 (74%), Positives = 423/537 (78%), Gaps = 10/537 (1%)

Query: 1   MVLNYPQREIKESSSKDMAPTSSSMDICSRSDAQAEEDRGLLDPHLSVLELLGKTGHSPS 60
           MVL+YPQRE K SSSK+MAP SSSM+I   S+ +A ED+GLLDPHLSVLELLGKTGHSPS
Sbjct: 1   MVLDYPQRETKGSSSKNMAPNSSSMNIRPSSEVEAGEDKGLLDPHLSVLELLGKTGHSPS 60

Query: 61  PMGQSLVTSIDISGHQNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSX 120
           PMG SLVTSIDIS H  VNDSISGSWQAI PLDLGASF+PER SSQTTNGSILSSSDTS 
Sbjct: 61  PMGHSLVTSIDISSHHYVNDSISGSWQAIHPLDLGASFVPERSSSQTTNGSILSSSDTSE 120

Query: 121 XXXXXXXAPAADIINIIKQGQEGTNVTSSSHPFRQLHKVISLPIPSREKTPYKEQDINDD 180
                  APAADIINIIKQGQEG +VTS S PFRQLHKVISLP+P++ +T Y EQD +D+
Sbjct: 121 EEQELLQAPAADIINIIKQGQEGASVTSPSRPFRQLHKVISLPLPAKGRTSYGEQDDDDN 180

Query: 181 ED------GAYEEDSVTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIP 234
                   GAYEEDS TITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIP
Sbjct: 181 NVDDDYDDGAYEEDSGTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIP 240

Query: 235 KEYQSLFELPKYHDSATFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTI 294
           KE+QSLFELPKYHDS  FPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTI
Sbjct: 241 KEHQSLFELPKYHDSTAFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTI 300

Query: 295 QVKNVLKSFLRNKLIKLLFPPVVVTNRKDLKKMFQRLQDLSLXXXXXXXXXXXXXXT--- 351
           QVKNVLKSFLRNKLIKLL+PPVVVTNR+DLKKMFQRLQDLSL                  
Sbjct: 301 QVKNVLKSFLRNKLIKLLYPPVVVTNRRDLKKMFQRLQDLSLEYAEDGDNDDEDNDDEII 360

Query: 352 -TKSRSYYRYXXXXXXXXXXXXXXXXXXXXXQRFFTSWFTWGISITIGISFGCCVTYFVT 410
            T SRSYYR                      QR  T WFTWG+SITIGISFGCCVTYF T
Sbjct: 361 HTNSRSYYRNKKANSSKKKSFKSNKKPKKKKQRSLTRWFTWGVSITIGISFGCCVTYFAT 420

Query: 411 AAYDHQTVKXXXXXXXXXXXXXXXXXXXDTVNTPATASPSSSEHFLWFDKGTLQINFHLD 470
           AAYDHQT K                   DTVNTPAT S SS E FLWFDKGTLQINFH D
Sbjct: 421 AAYDHQTGKSFNLRSSILTSLLSLDSYHDTVNTPATTSTSSGEQFLWFDKGTLQINFHSD 480

Query: 471 GLIMKSLSVIKETWVKMNDFVLHALSRPLSFLENLNRSSDFSIDESNRILALGYILL 527
           G IMKSL+VIK+TW KMN FVL+ALSRPL+FLENLN++SDFS+DESNRILALGYILL
Sbjct: 481 GFIMKSLTVIKDTWSKMNVFVLNALSRPLNFLENLNKNSDFSLDESNRILALGYILL 537

>Suva_9.43 Chr9
           complement(68866..68940,68994..69068,69093..69122,
           69126..70484) [1539 bp, 513 aa] {ON} YIL146C (REAL)
          Length = 513

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/430 (73%), Positives = 343/430 (79%), Gaps = 11/430 (2%)

Query: 1   MVLNYPQREIKESSSKDMAPTSSSMDICSRSDAQAEEDRGLLDPHLSVLELLGKTGHSPS 60
           MVL+Y  RE K SSSK+MAP SSSM+I  RS+ QAEED+GLLDPHLSVLELLGKTG SPS
Sbjct: 1   MVLDYQHRETKGSSSKNMAPNSSSMNIRPRSEGQAEEDKGLLDPHLSVLELLGKTGSSPS 60

Query: 61  PMGQSLVTSIDISGHQNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSX 120
           P+GQSLVTSIDIS H NV D+ISGSWQ IQPLDLGASFIPERCSSQTTNGSILSSSDTS 
Sbjct: 61  PLGQSLVTSIDISNHHNVIDNISGSWQTIQPLDLGASFIPERCSSQTTNGSILSSSDTSE 120

Query: 121 XXXXXXXAPAADIINIIKQGQEGTNVTSSSHPFRQLHKVISLPIPSREKTPYKEQDI--- 177
                  APAADIINIIKQGQ+GT+VTS SHPF+QLH VISLP+P RE+T Y EQ+    
Sbjct: 121 EEQDLLQAPAADIINIIKQGQDGTSVTSPSHPFKQLHTVISLPMPPRERTFYGEQEDVVC 180

Query: 178 --NDDEDGAYEEDSVTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIPK 235
             NDD++G YEEDSVTITKSLTSSTNSFVMPKLSLS+KNPVFRLLILGRTG+NFYQS PK
Sbjct: 181 IDNDDDNGMYEEDSVTITKSLTSSTNSFVMPKLSLSRKNPVFRLLILGRTGTNFYQSTPK 240

Query: 236 EYQSLFELPKYHDSATFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQ 295
           EYQSLFELPK HDS  FPQYTGI+I+FQELREMVSLLNRIV+Y+QGKPIIPICQPGQTIQ
Sbjct: 241 EYQSLFELPKSHDSTIFPQYTGIVIVFQELREMVSLLNRIVEYAQGKPIIPICQPGQTIQ 300

Query: 296 VKNVLKSFLRNKLIKLLFPPVVVTNRKDLKKMFQRLQDLSLXXXXXXXXXXXXXXTTK-- 353
           VKNVLKSFL+N LIKLL+PPVV TNRKDLKKMFQRLQDLSL                   
Sbjct: 301 VKNVLKSFLKNSLIKLLYPPVVATNRKDLKKMFQRLQDLSLEYVEDEKNEDEDEDNDDEI 360

Query: 354 ----SRSYYRYXXXXXXXXXXXXXXXXXXXXXQRFFTSWFTWGISITIGISFGCCVTYFV 409
               SRSYYR                      QR  T WFTWG+SITIGISFGCCVTYFV
Sbjct: 361 IQPYSRSYYRSKKGGSSKKKSSKSNKKSKKKKQRSSTRWFTWGVSITIGISFGCCVTYFV 420

Query: 410 TAAYDHQTVK 419
           TAAYDHQT++
Sbjct: 421 TAAYDHQTIR 430

>ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {ON}
           similar to uniprot|P40458 Saccharomyces cerevisiae
           YIL146C ECM37 Non-essential protein of unknown function
          Length = 503

 Score =  280 bits (717), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 187/510 (36%), Positives = 256/510 (50%), Gaps = 47/510 (9%)

Query: 37  EDRGLLDPHLSVLELLGKTGHS-PSPMGQSLVTSI--DISGHQNV-NDSISGSWQAIQPL 92
           E R +LDPHLSVLELL +   + P    +  V+ I  + +G     N SIS SWQ I   
Sbjct: 22  ERRSILDPHLSVLELLRRPSDTRPHEALKGEVSDIVGNCAGTTGTGNGSISQSWQTIHRN 81

Query: 93  DLGASFIPERCSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQGQEGT---NVTSS 149
           D   S +PERC SQ T   ILSSSDTS        +P+A     + Q    T     T S
Sbjct: 82  DSCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSA-----VHQQLHATPPQKHTKS 136

Query: 150 SHPFRQLHKVISLPIPSREKTPYKEQDINDDEDGAYEED-SVTITKSLTSSTNSFVMPKL 208
              +R L+  I L +P                    EED + TITKSL SS+NSF+MPKL
Sbjct: 137 LEDYRSLNVGIPLVLPEDSNNINNNNKNGSTTGSNGEEDDNDTITKSLNSSSNSFIMPKL 196

Query: 209 SLSQKNPVFRLLILGRTGSNFYQSIPKEYQSLFELPKYHDSATFPQYTGIIIIFQELREM 268
           SLSQK   FR+L+LGR G  FY SIPK+YQ +FELP+ HD A F QYTGI+++FQEL+EM
Sbjct: 197 SLSQKTQKFRILVLGRPGLKFYHSIPKKYQHMFELPRSHDPAEFKQYTGILVVFQELKEM 256

Query: 269 VSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLFPPVVVTNRKDLKKMF 328
           VSLLNR+ Q +  +P+IP+CQ GQ  QV+N+L+S L+N+L+ LL+PPVVV N+ DL  MF
Sbjct: 257 VSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPDLLGMF 316

Query: 329 QRLQDLSLXXXXXXXXXXXXXXTTK---SRSYYRYXXXXXXXXXXXXXXXXXXXXXQRFF 385
           + LQ+LS                      RS  R                          
Sbjct: 317 RFLQELSKTVSDNSDMDAEEPNNGSKRLKRSLQRKKKKFIETSAERNGRPHKKRHNNEKV 376

Query: 386 TSWFTWGISITIGISFGCCVTYFVTAAYDHQTVKXXXXXXXXXXXXXXXXXXXDTVNTPA 445
             W  WG+S+T+G+  G C+++ V++ +                          T N   
Sbjct: 377 NRWVLWGVSLTLGVGVGYCISHLVSSTW-----------------------ISLTTNPLG 413

Query: 446 TASPSS-SEHFLWFDKGTL---QINFHLDGLIMKSLSVIKETWVKMNDFVLHALSRPLSF 501
              P S S+    FD+  L   +++   D     +L + K+   + N  V   L R LS 
Sbjct: 414 PVDPESVSKDLFVFDRQELKLGEMDMDSDHPFGHALFLFKQALKQWNLAVKQFLGRHLSC 473

Query: 502 LENLNRSSDF----SIDESNRILALGYILL 527
           +E +  ++      S + +NR+LALGY++L
Sbjct: 474 MERIGPANCLEWPTSDEHTNRVLALGYVML 503

>TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {ON}
           Anc_5.699 YIL146C
          Length = 489

 Score =  268 bits (686), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 187/506 (36%), Positives = 267/506 (52%), Gaps = 54/506 (10%)

Query: 35  AEEDRGLLDPHLSVLELLGKTGHSPSPMGQSLVTSIDISGHQNVNDSISGSWQAIQPLDL 94
           A E + LLDPHLSVLELL +TG +   +G+ +  + D++   N  +SIS SWQAI   D 
Sbjct: 25  AFEKKSLLDPHLSVLELLERTGDTQR-VGRGVEKADDMA---NTTNSISSSWQAIHRNDA 80

Query: 95  GASFIPERCSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQGQEGTNVTSSSHPFR 154
             + +PERCSSQ     ILSSSDTS        +P         Q Q+   +     PF+
Sbjct: 81  MITGVPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQPPRL-----PFK 135

Query: 155 QLHKVISLPIPSREKTPYKEQDINDDEDGAYEEDSVTITKSLTSSTNSFVMPKLSLSQKN 214
               VI   +P+R++ P  +    D++D   E D  T+TKSL++S+NSFVMPKLSLSQK+
Sbjct: 136 LDVPVI---LPARDQEPSGQTQTPDNDD---ERDDETLTKSLSNSSNSFVMPKLSLSQKS 189

Query: 215 PVFRLLILGRTGSNFYQSIPKEYQSLFELPKYHDSATFPQYTGIIIIFQELREMVSLLNR 274
              R+LILGR G  FYQSIPK YQ  FEL +  D + F Q+TGI+I+FQEL+EMVSLLNR
Sbjct: 190 HKLRILILGRPGLKFYQSIPKRYQHFFELSRLQDPSEFRQFTGILIVFQELKEMVSLLNR 249

Query: 275 IVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLFPPVVVTNRKDLKKMFQRLQDL 334
           + Q +  +P+IP+CQ GQ  QV+NVL+S L++KLI LL+PPVV++N  DL  M++ L DL
Sbjct: 250 VCQCAPTRPVIPVCQTGQHQQVRNVLESLLKSKLISLLYPPVVISNHSDLNNMYRFLLDL 309

Query: 335 SLXXXXXXXXXXXXXXTTK-----SRSYYRYXXXXXXXXXXXXXXXXXXXXXQRFFTSWF 389
           S                        +S+ R                      +     W 
Sbjct: 310 SKTISDNSEDDEDEEERELLDKKIKKSHQRKKKRAGSYDKTDKPRKRRSKETK--INKWI 367

Query: 390 TWGISITIGISFGCCVTYFVTAAYDHQTVKXXXXXXXXXXXXXXXXXXXDTVNTPATASP 449
            WGIS+T+G+  G C++YF ++     + K                    ++ +     P
Sbjct: 368 VWGISLTVGVGVGYCMSYFASSGLISMSAK--------------------SIASINGCRP 407

Query: 450 SSSEHFLWFDKGTL---QINFHLDGLIMKSLSVIKET-----WVKMNDFVLHALSRPLSF 501
             +++ + FD  +L   + +  L+     +L ++K+T     W  M  F++  L  P S 
Sbjct: 408 --NDNVVVFDDSSLGMGEYDHDLENPFAHALYLLKQTLKQWNWA-MKQFLMKHLHLPESS 464

Query: 502 LENLNRSSDFSIDESNRILALGYILL 527
             + N     + D SNR+LALGYILL
Sbjct: 465 -SSTNYKEWGAEDNSNRVLALGYILL 489

>CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} similar
           to uniprot|P40458 Saccharomyces cerevisiae YIL146c ECM37
          Length = 492

 Score =  169 bits (429), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 95/234 (40%), Positives = 135/234 (57%), Gaps = 22/234 (9%)

Query: 185 YEEDSVTITKSLTSSTNSFVMPKLSLSQK-NPVFRLLILGRTGSNFYQSIPKEYQSLFEL 243
           +  DS+++TKS  SS+ SFVMPKLSL+ K +   +LL++GR    F+Q IP+EY+  F +
Sbjct: 177 FTSDSMSLTKSTGSSSTSFVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHI 236

Query: 244 PKYHDSATFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSF 303
            +  D + F  Y GI+I+FQEL+E V++LNRIVQY+  KPIIPICQPGQ I+VKN+LKSF
Sbjct: 237 SQSSDPSEFQNYIGIVIVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSF 296

Query: 304 LRNKLIKLLFPPVVVTNRKDLKKMFQ-------RLQDLSLXXXXXXXXXXXXXXTTKSRS 356
           L+N  I L +PPV + N K ++K+F+       +L++                 T+  R 
Sbjct: 297 LKNDAITLWYPPVTIANEKSMEKLFKHTVKLVNKLENEEDVLSLSTSDKSLSDETSGYRK 356

Query: 357 YYRYXXXXXXXXXXXXXXXXXXXXXQRFFTSWFTWGISITIGISFGCCVTYFVT 410
             R                         ++ W TWGIS+TIG+S G   TY +T
Sbjct: 357 NNRRKKHGGKPSTN--------------YSKWITWGISLTIGVSIGYYATYMIT 396

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 25/94 (26%)

Query: 2  VLNYPQREIKESSSKDMAPTSSSMDICSRSDAQAEEDRGLLDPHLSVLELLGKTGHSPSP 61
          +L + +  +KESSS  +A TS +    S           +LDPH SV+ELL +       
Sbjct: 1  MLRFQRGTVKESSSAKLASTSRNGPESS-----------ILDPHHSVMELLQRQMEGSEV 49

Query: 62 MGQSLVTSIDISGHQNVNDSISGSWQAIQPLDLG 95
            +S V              +  SWQ I+  D+G
Sbjct: 50 PSESGV--------------LGESWQQIRESDVG 69

>SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} similar
           to uniprot|Q753M9 Ashbya gossypii AFR283W AFR283Wp and
           weakly similar to YIL146C uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 470

 Score =  160 bits (405), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 121/405 (29%), Positives = 198/405 (48%), Gaps = 72/405 (17%)

Query: 29  SRSDAQAEEDRGLLDPHLSVLELLGKTG--------HSPSPMGQSLVTSID--ISGHQN- 77
           S S +   + R +LDPH SVL+LL + G         + S +   L ++ +  +S H+  
Sbjct: 19  SASGSMPFQKRSILDPHFSVLQLLERNGCEQEEDVNQASSQIPVELKSAFNRPLSPHKRY 78

Query: 78  ---VNDSISGSWQAIQPLDLGA-SFIPERCSSQTTNGSILSSSDTSXXXXXXXXAPAADI 133
              +N SIS SWQ+I+ +D    + + +  SSQ     ILSSSDTS        +P+   
Sbjct: 79  PEALNQSISDSWQSIKMVDYSILNSLHDTSSSQAVG--ILSSSDTSEEELDHLNSPSPSS 136

Query: 134 INIIKQG-----QEGTNVTSSSHPFRQLHKVISLPIPSREKTPYKEQDINDDEDGAYEED 188
             +   G     Q    V ++S          +LP P                 G  EED
Sbjct: 137 QQVFPNGPPISFQTQAGVLTAS---------ATLPNP-----------------GVLEED 170

Query: 189 -SVTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIPKEYQSLFELPKYH 247
            + T+T SL +S+NSFVMP+LSLSQ++  F +L++G+    F+ ++PK YQ +F++  + 
Sbjct: 171 DNETVTVSLAASSNSFVMPQLSLSQRSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDF- 229

Query: 248 DSATFPQ---YTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFL 304
           +S + P+   YT ++IIFQ+ +E+  +L+ +V    GK IIPICQ GQ  Q+ ++L+ F+
Sbjct: 230 ESISAPKVSHYTAVMIIFQDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFV 289

Query: 305 RNKLIKLLFPPVVVTNRKDLKKMFQRLQDLSLXXXXXXXXXXXXXXTTKSRSYYRYXXXX 364
           + K I+L+F P V++N +++ K+ + L  LS               T     Y       
Sbjct: 290 KAKKIRLMFQPTVMSNHQEIHKLLRYLHRLS---------------TEIDSGYETDETHL 334

Query: 365 XXXXXXXXXXXXXXXXXQRFFTSWFTWGISITIGISFGCCVTYFV 409
                             R    W  WG+S+T+G+  GCC+++ +
Sbjct: 335 KVRKRKKTHKKKSKGTSNR----WVIWGLSLTVGVGIGCCISFIL 375

>KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5.699
           YIL146C
          Length = 444

 Score =  144 bits (362), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 138/505 (27%), Positives = 221/505 (43%), Gaps = 86/505 (17%)

Query: 41  LLDPHLSVLELLGKT----GHSPSPMGQSLVTSIDISGHQNVNDSISGSWQAIQPLDLGA 96
           +LDPHLSVLELL K+    GH+ +P       +  I         +S SW  ++  +L A
Sbjct: 8   VLDPHLSVLELLEKSCERGGHAEAPGSSRNKGAGQIQ--------LSESWCTVERDELSA 59

Query: 97  SFIPERCSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQGQEGTNVTSSSHPFRQL 156
               ER +SQ TN  +LSSSDTS                  ++G+               
Sbjct: 60  M---ERSASQQTNNGVLSSSDTS------------------EEGEPEQGSPGDGEGGGVA 98

Query: 157 HKVISLPIPSREKTPYKEQDINDDEDGAYEEDSVTITKSLTSSTNSFVMPKL-------- 208
              ++ P  S + T      ++DD        S T++KSLTSS+NSF+MPKL        
Sbjct: 99  DTRMARPAMSLQSTSSTLDGVDDD--------SATVSKSLTSSSNSFIMPKLYTTVAGAP 150

Query: 209 ---SLSQKNPVFRLLILGRTGSNFYQ-SIPKEYQSLFEL-PKYHDSATFPQYTGIIIIFQ 263
              S + +   F++ +LGR    F Q ++P++++  FEL    HD A      GI+I+ Q
Sbjct: 151 STVSTALQTRCFKVAVLGRGAVKFCQETVPEQFRHRFELTAGVHDLAQCADRQGILIVVQ 210

Query: 264 ELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLFPPVVVTNRKD 323
           E+RE++SLLNR+       P++ +    + +QVKNVL++F R +L+ LL PPV ++N + 
Sbjct: 211 EVRELISLLNRVHCACPEVPVVAVYDRDRQVQVKNVLRNFTRQRLVSLLHPPVPLSNNEA 270

Query: 324 LKKMFQRLQDLSLXXXXXXXXXXXXXXTTKSRSYYRYXXXXXXXXXXXXXXXXXXXXXQR 383
           L KMF  + +L+               T +    +                       + 
Sbjct: 271 LDKMFHFVDNLARQQEPAGVIHNDPQTTQEQHPDHN-----------EDDPHRGPSKPEG 319

Query: 384 FFTSWFTWGISITIGISFG-CCVTYFVTAAYDHQTVKXXXXXXXXXXXXXXXXXXXDTVN 442
            F  W  WG+SI++GI  G  CV+Y V+++                              
Sbjct: 320 TFKRWLLWGVSISLGIGAGYYCVSYVVSSSM------CVSCFNFRHTDHTLAATTSTAAA 373

Query: 443 TPATASPSSSEHFLWFDKGTLQINFHLDGLIMKSLSVIKETWVKMNDFVLHALSRPLSFL 502
             A A+PS  +H    D  T          +   LS++K +  +   FV  A+ +P  ++
Sbjct: 374 AAAAATPSGIDHDA--DSHT---------TLRHCLSIVKNSLKRATAFVKQAMHKPFHYI 422

Query: 503 ENLNRSSDFSIDESNRILALGYILL 527
           +   RS ++ + + NR L LGY ++
Sbjct: 423 D---RSQEWHLHDPNRFLQLGYAVI 444

>AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL146C (ECM37)
          Length = 452

 Score =  137 bits (346), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 98/382 (25%), Positives = 172/382 (45%), Gaps = 52/382 (13%)

Query: 37  EDRGLLDPHLSVLELLGKT-GHSPSPMGQSLVTSIDISG-HQNVNDSISGSWQAIQPLDL 94
           + +G+LDPHLSVLE+L +  G     + +  V ++      ++++ SIS SWQAI+  D 
Sbjct: 27  QHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTVGKRRVERSLHHSISESWQAIKRSDY 86

Query: 95  GASFIPERCSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQGQEGTNVTSSSHPFR 154
                     +  ++  ILSSSDTS                     +E   +  S+H   
Sbjct: 87  SFLSGTHEVGAMHSSVGILSSSDTS---------------------EEEAEMRPSAHGTV 125

Query: 155 QLHKVISLPIPSREKTPYKEQDINDDEDGAYEEDSVTITKSLTSSTNSFVMPKLSLSQKN 214
            L   ++        +P ++  + +D   A E+D  T+T S+ SS+ S VMPKLSLSQ+ 
Sbjct: 126 HLGSSLA--------SPMRQLLVEEDNSCAEEDDCQTVTISMPSSSTSLVMPKLSLSQRL 177

Query: 215 PVFRLLILGRTGSNFYQSIPKEYQSLFELPKYHDSATF---PQYTGIIIIFQELREMVSL 271
              +LL++G+    F+ +IPK YQ LF++        +    +Y  ++++F ++ +   L
Sbjct: 178 GEPQLLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHDIAQAPEL 237

Query: 272 LNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLFPPVVVTNRKDLKKMFQRL 331
           L+ + + +    +IP+CQ GQ   +  +LK +   K I++   P++++N  +  ++ + L
Sbjct: 238 LDGLCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSNHHEKHRLLKHL 297

Query: 332 QDLSLXXXXXXXXXXXXXXTTKSRSYYRYXXXXXXXXXXXXXXXXXXXXXQRFFTSWFTW 391
            +L                T KS+  +R                            W  W
Sbjct: 298 HNLC----NESESGYETELTVKSKKQHRRPRKKDAGPVA--------------LRHWAIW 339

Query: 392 GISITIGISFGCCVTYFVTAAY 413
             S TIGI  GCC++   T  +
Sbjct: 340 TASFTIGIGIGCCISLMATTRF 361

>TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.699
           YIL146C
          Length = 749

 Score =  140 bits (353), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 106/163 (65%), Gaps = 5/163 (3%)

Query: 178 NDDEDGAYEEDS---VTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGS-NFYQSI 233
           NDD+  +   +S   + +TKS+TSS+NSF+MPKLS +     FR+LILG   +  FYQ+I
Sbjct: 308 NDDQSNSTITNSYNNLNLTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFYQNI 367

Query: 234 PKEYQSLFELPKYHDSATFPQYTGIIIIFQELREMVSLLNRIVQYSQGK-PIIPICQPGQ 292
           P  Y+ LFELP  +    F  Y GI I+  +L +  S+LN+I +YS  K PIIPIC+ GQ
Sbjct: 368 PTSYKYLFELPPNNFDYNFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQ 427

Query: 293 TIQVKNVLKSFLRNKLIKLLFPPVVVTNRKDLKKMFQRLQDLS 335
             +VKN+LK +++ K + LL+PP+V TNR  +  ++  L DLS
Sbjct: 428 INEVKNILKPYIKTKDLSLLYPPIVGTNRDGMNTLYLHLNDLS 470

>KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {ON}
           Anc_5.699 YIL146C
          Length = 556

 Score =  137 bits (345), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 98/358 (27%), Positives = 167/358 (46%), Gaps = 58/358 (16%)

Query: 203 FVMPKLSLSQKNP------VFRLLILGRTGSNFYQSIPKEYQSLFELPKYHDSATFPQYT 256
           F+MP+LSL++K         FR+LI+GR  S  ++ IP ++Q+LF+L K +D   + ++T
Sbjct: 224 FIMPRLSLTKKERQQLNANEFRILIVGRLSSKLFKMIPHKFQNLFQLQKSYDINEYQKFT 283

Query: 257 GIIIIFQELREMVSLLNRIVQYSQGK-PIIPICQPGQTIQVKNVLKSFLRNKLIKLLFPP 315
            I+++ QE RE++SLLNRI +  + K P+I IC+    +Q KNVLKS+LRN LI LL+ P
Sbjct: 284 AILVVIQETRELISLLNRISRSEKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITLLYQP 343

Query: 316 VVVTNRKDLKKMFQRLQDLSLXXXXXXXX------------------XXXXXXTTKSR-- 355
            V++N ++L +M   L++ S+                                 +K R  
Sbjct: 344 FVISNTEELDRMLVFLKETSIKFYEQAYNPKIQIKEKVPNDGNRNAPTSSDLTLSKDRVK 403

Query: 356 -SYYRYXXXXXXXXXXXXXXXXXXXXXQRFFTSWFTWGISITIGISFGCCVTYFVTAAYD 414
              +R+                        +  W  WGIS++IG+  G C++YF ++ + 
Sbjct: 404 NDKHRHTKGDGSGGSKKGNEHDRKPKENEEYNKWIIWGISLSIGVGIGYCISYFGSSPW- 462

Query: 415 HQTVKXXXXXXXXXXXXXXXXXXXDTVNTPATASPSSSEHFLWF-----DKGTLQINFHL 469
                                   D++ +     P S+E F+       D  T +  F  
Sbjct: 463 -------------SSLVQYFNPESDSI-SATVPVPLSNESFVLLHDSDNDSETKKYFF-- 506

Query: 470 DGLIMKSLSVIKETWVKMNDFVLHALSRPLSFLENLNRSSDFSIDESNRILALGYILL 527
                KS++ +K +  K+   +   + +PL+    LN     + D+++ +LALGYIL+
Sbjct: 507 -----KSINFLKYSINKVKVIIKDTIRKPLNAFSYLN---GLNTDDASSLLALGYILI 556

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 17/75 (22%)

Query: 41  LLDPHLSVLELLGKTGHSPSPMGQSLVTSI--DISGHQ---------------NVNDSIS 83
           +LDPHLSVLELL +   +      +++++   DI+                  +V D IS
Sbjct: 30  ILDPHLSVLELLERGFQNVHEQDDTIMSTTPRDIAVEMATVRLNSEASGVSTPSVGDIIS 89

Query: 84  GSWQAIQPLDLGASF 98
            SW  IQ  DL  S 
Sbjct: 90  QSWHTIQRRDLEESL 104

>Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON}
           similar to Ashbya gossypii AFR283W
          Length = 459

 Score =  134 bits (338), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 123/394 (31%), Positives = 171/394 (43%), Gaps = 68/394 (17%)

Query: 39  RGLLDPHLSVLELL-GK---TGHSPSPM-GQSLVTSIDISGHQNVNDSISGSWQAIQPLD 93
           R +LDPHLSVLE+L GK       P  + G S V+     G + ++ SIS SWQ+I+  D
Sbjct: 25  RSILDPHLSVLEILEGKELNKVEGPHELSGASRVSGKQFEGERVLHHSISESWQSIKSTD 84

Query: 94  -LGASFIPERCSSQTTNGSILSSSDTSXXXXXXXXAPA----------ADIINIIKQGQE 142
            L  S   +    Q +   ILSSSDTS        +P           + IINI  Q   
Sbjct: 85  YLFLSRANDTSLQQQSAVGILSSSDTSEEEQDIHPSPPPPNSASSAFDSRIINIAGQAFS 144

Query: 143 GTNVTSSSHPFRQLHKVISLPIPSREKTPYKEQDINDDEDGAYEEDSVTITKSLTSSTNS 202
            T     SH  R                       ++DED    +D  T+T SL ++  S
Sbjct: 145 AT----LSH-LR-----------------------SEDED----DDGETVTVSLPNTMTS 172

Query: 203 FVMPKLSLSQKNPVFRLLILGRTGSNFYQSIPKEYQSLFE---LPKYHDSATFPQYTGII 259
            VMPKLSLS +    ++LI+G+    F+ SIPK YQ +FE   L    D     +Y+ I+
Sbjct: 173 LVMPKLSLSDRIIESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDEKYSTIM 232

Query: 260 IIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLFPPVVVT 319
           +IF ++     LL+RI        IIPICQ GQ   + ++LK ++    IKL   P+V++
Sbjct: 233 VIFHDMGLAPELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMS 292

Query: 320 NRKDLKKMFQRLQDLSLXXXXXXXXXXXXXXTTKSRSYYRYXXXXXXXXXXXXXXXXXXX 379
           N  +  ++ + L  LS                + S S Y                     
Sbjct: 293 NHHEKHRLLKHLHQLS----------------SGSDSGYETEVTVEPVKKLPRKAKKRPS 336

Query: 380 XXQRFFTSWFTWGISITIGISFGCCVTYFVTAAY 413
                F  W  W  SITIGI  GCCV+  V+  Y
Sbjct: 337 KPST-FRDWVVWTASITIGIGIGCCVSLMVSTRY 369

>NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}
           Anc_5.699 YIL146C
          Length = 510

 Score =  134 bits (336), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 120/340 (35%), Positives = 176/340 (51%), Gaps = 60/340 (17%)

Query: 9   EIKESSSKDMAPTSSSMDICSRSDAQAEEDRGLLDPHLSVLELLGKTGHSPSPMGQSLVT 68
           E++ES+  D    SS    C +S         LLDPHLSVLE+L +  +          T
Sbjct: 18  EVQESAGMDNHNDSSE---CVKS---------LLDPHLSVLEMLERKDND---------T 56

Query: 69  SIDISGHQNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSXXXXXXXXA 128
            ++ S        IS SWQ I+        +  + SSQ +N   + SS +          
Sbjct: 57  VMEASSR------ISRSWQNIESPADSKQLLSAK-SSQVSNLVSILSSSSDTSDE----- 104

Query: 129 PAADIINIIKQGQEGTNVTSSSHPFRQLHKVISLPIPSREKTPYKEQDINDDEDGAYEED 188
              D IN +    EG++  + ++P   L   I LP        + +    D++DG     
Sbjct: 105 -EVDRINSLNSAGEGSS-KNYNNP-SPLQNPIYLP-------EFTDVTAGDNDDGI---- 150

Query: 189 SVTITKSLTSST---NSFVMPKLSLSQKNPV---FRLLILGRTGSNFYQSIPKEYQSLFE 242
           + TITKSLTSS+   NSFVMP LSLS        F++LI GR G +FY++IPK+YQ LF 
Sbjct: 151 ASTITKSLTSSSTISNSFVMPTLSLSSSQSQQRKFQILIFGRLGPSFYRTIPKQYQYLFH 210

Query: 243 LPKYHDSAT---FPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPI----CQPGQTIQ 295
           +P   ++ T      +T  +IIF+EL+E+VSLLNRI +    K + P     CQPGQ I+
Sbjct: 211 VPNQLNTLTRNEMDNFTAFLIIFEELKELVSLLNRISEELSFKKVPPPIIPICQPGQKIK 270

Query: 296 VKNVLKSFLRNKLIKLLFPPVVVTNRKDLKKMFQRLQDLS 335
           VK++LK FL+N  + LL P +++ + + L KMF+ +Q +S
Sbjct: 271 VKSILKYFLKNNFVTLLSPIIIINDERALLKMFKTMQSIS 310

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 59/152 (38%), Gaps = 27/152 (17%)

Query: 384 FFTSWFTWGISITIGISFGCCVTYFVTAAYDHQTVKXXXXXXXXXXXXXXXXXXXDTVNT 443
           F   W  W IS+T+G   G  ++Y V  +     ++                        
Sbjct: 378 FKNKWVVWSISLTVGAGMGYIISYCVFNSSKRLPLEKIAHQTR----------------- 420

Query: 444 PATASP----SSSEHFLWFDKGTLQINFHLDGLIMKSLSVIKETWVKMNDFVLHALSRPL 499
           P   S      S+++ L+ ++ T   N +       +    KET  ++N      + +P 
Sbjct: 421 PGPLSSLIHLKSNKNLLYLERTT--PNDYSWSYFQNTWEFCKETVNQLNSTFKKIIRKPF 478

Query: 500 SFLENLN----RSSDFSIDESNRILALGYILL 527
           +  ENL      S D+  DE +RILAL Y+LL
Sbjct: 479 AMFENLITTTINSKDWKFDEQDRILALCYLLL 510

>KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 472

 Score =  132 bits (331), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 103/373 (27%), Positives = 170/373 (45%), Gaps = 47/373 (12%)

Query: 41  LLDPHLSVLELLGKTGHSPSPMGQSLVTSIDI------SGHQNVNDSISGSWQAIQPLDL 94
           +LDPHLSVL+LL +    PS +       I        SG ++VN SIS SWQ+I+  D 
Sbjct: 40  ILDPHLSVLQLLDRAD-PPSELSSLKHGEIAKPATPRRSGFESVNCSISESWQSIKHTD- 97

Query: 95  GASFIPERCSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQGQEGTNVTSSSHPFR 154
             S +  +  +   +  ILSSSDTS        +P+ +            N  +S  P  
Sbjct: 98  -CSMVNTQGDATHQHAGILSSSDTSEDEPDAQLSPSPNNFAF-------PNSATSIFP-E 148

Query: 155 QLHKVISLPIPSREKTPYKEQDINDDEDGAYEEDSVTITKSLTSSTNSFVMPKLSLSQKN 214
             H +        E +  +E   ++  +   E D+ T+T SL +S+NSFVMPKLSL Q++
Sbjct: 149 APHNL--------EASSLREYQNSEIANPREENDNETVTMSLMNSSNSFVMPKLSLIQQS 200

Query: 215 PVFRLLILGRTGSNFYQSIPKEYQSLFELPK--YHDSATFPQYTGIIIIFQELREMVSLL 272
             F +LI+G+    FY+ IP+ Y  +FE+    +       +Y+ +++IF E +E   LL
Sbjct: 201 QKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREMNKYSAVMVIFGEPKEGKELL 260

Query: 273 NRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLFPPVVVTNRKDLKKMFQRLQ 332
            ++  ++    II +CQ GQ  Q+ N+L  + ++  I+L++   V+++ +D+ ++ + L 
Sbjct: 261 EKVAAHNSN--IIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMSDHQDVHRLLRYLN 318

Query: 333 DLSLXXXXXXXXXXXXXXTTKSRSYYRYXXXXXXXXXXXXXXXXXXXXXQRFFTSWFTWG 392
            LS                        Y                     Q     W  W 
Sbjct: 319 TLSTEVDSG------------------YETEVGSRKIRKRRKSSKKRSPQITVNRWVIWS 360

Query: 393 ISITIGISFGCCV 405
           IS+T+G+  G C+
Sbjct: 361 ISLTVGVGLGYCI 373

>Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON}
           YIL146C (ECM37) - (putative) involved in cell wall
           biogenesis [contig 159] FULL
          Length = 467

 Score =  123 bits (308), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 104/381 (27%), Positives = 169/381 (44%), Gaps = 49/381 (12%)

Query: 41  LLDPHLSVLELLGKTG-HS-PSPMGQSLVTS---IDISGHQNVNDSISGSWQAIQPLDLG 95
           +LDPHLSVL+LL +   HS P     S + S   +  S  + +  SIS SWQ+I+  D  
Sbjct: 31  ILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRSSSEPMGRSISDSWQSIRHTDYS 90

Query: 96  ASFIPERCSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQGQEGTNVTSSSHPFRQ 155
              +    S Q     ILSSSDTS        +P+ +        +  T    +SH    
Sbjct: 91  ILNLIGETSHQP--AGILSSSDTSEDEPDHFLSPSPNEYAFANGAK--TVFPEASHA--- 143

Query: 156 LHKVISLPIPSREKTPYKEQDINDDEDGAYEEDSVTITKSLTSSTNSFVMPKLSLSQKNP 215
                    P        +  + +  + A + D+ T+T SL +S+NSFVMPKLSL+Q   
Sbjct: 144 ---------PEGPSLATLQDSVYEHSNVAEDNDNETVTLSLINSSNSFVMPKLSLAQPLR 194

Query: 216 VFRLLILGRTGSNFYQSIPKEYQSLFELPKYHDSATFP-----QYTGIIIIFQELREMVS 270
            F +LI+G+    FY+ IP+ YQ +FE+    D+ +F      Q++ I++IF + +   S
Sbjct: 195 KFSILIVGKPAQRFYRDIPRAYQKMFEVC---DAESFKTRDVDQFSAIMVIFTDPKNGQS 251

Query: 271 LLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLFPPVVVTNRKDLKKMFQR 330
           LL  +   S    II +CQ GQ  Q+ N+L  F +   ++L++   V+++ +D+ ++ + 
Sbjct: 252 LLEMVTGRSSN--IIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDVHRLLRY 309

Query: 331 LQDLSLXXXXXXXXXXXXXXTTKSRSYYRYXXXXXXXXXXXXXXXXXXXXXQRFFTSWFT 390
           L  LS                        Y                           W  
Sbjct: 310 LYTLSNEIDS------------------EYDTEVGPRKVRKRRKSYKKRETPAAVNRWVI 351

Query: 391 WGISITIGISFGCCVTYFVTA 411
           W IS+T+G+  G C++  +++
Sbjct: 352 WSISLTVGVGIGYCISCLLSS 372

>KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 524

 Score =  108 bits (270), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 104/417 (24%), Positives = 185/417 (44%), Gaps = 75/417 (17%)

Query: 41  LLDPHLSVLELLGKTGHSPSPMGQSLVTS---IDISG------HQNVN-----DSISGSW 86
           +LDPH SV++LL   G         L+ +   ID  G      H ++N       ++ SW
Sbjct: 41  ILDPHDSVMDLL--NGQQSCAFDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTDSW 98

Query: 87  QAIQP-----LDLGASFIPERCSSQTTN---GSILSSSDTSXXXXXXXXAPAADI----- 133
           QAI       L+ G        S+   N   G +LSS DTS        AP+ ++     
Sbjct: 99  QAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSS-DTSEEEVEINAAPSPNLSASQQ 157

Query: 134 --------INIIKQGQEGTNVTSSSHPFRQLHKVISLPIPSREKTPYKEQDINDDEDGAY 185
                   ++    G +G N  ++ H F         P+ S +   + + ++     G  
Sbjct: 158 HNQFLAYPLSSTGFGDQG-NSETTVHQFSD-----GDPVKSTKTGQFSKAELGA---GTG 208

Query: 186 EEDSVTITKSLTSSTNSFVMPKLSLSQKNPVFRLLIL--GRTGSNFYQSIPKEYQSLFEL 243
           E++++ +    + + + FVMPKLSLS+    F++LIL  G + ++FY  + + ++ +F++
Sbjct: 209 EDETIMVNLGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDV 268

Query: 244 PKYHDSATFP--QYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLK 301
            K ++++     +YT  +IIF + +++ ++LNR+ +      +IPICQ GQ   V   +K
Sbjct: 269 GKLNEASKEEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKVK 328

Query: 302 SFLRNKLIKLLFPPVVVTNRKDLKKMFQRLQDLSLXXXXXXXXXXXXXXTTKSRSYYRYX 361
           +F  +  IKL+  PVV+++  ++  + + L   SL               TK R   +  
Sbjct: 329 TFANSNKIKLMSYPVVISDHYEIHGLLRHLH--SLYVEVDSDYETDIPKKTKPRKGAK-- 384

Query: 362 XXXXXXXXXXXXXXXXXXXXQRFFTSWFTWGISITIGISFGCCVTY----FVTAAYD 414
                                     W+ W ISI +G+  GCCVT+    F T++Y+
Sbjct: 385 ----------------KKPAPHLAKRWWFWPISIALGVGIGCCVTFYFSKFETSSYN 425

>TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON} 
          Length = 470

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 183 GAYEEDSVTITKSLTSSTNSFVMPKLSLSQKNPVFRLL-ILGRTGSNFYQ 231
            AY       + S TSS+N FVMP+LS S+K    + + ++G    +FYQ
Sbjct: 100 SAYSHSYFDQSASDTSSSNQFVMPRLSYSKKEGSLKAISVVGSHADSFYQ 149

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%)

Query: 37 EDRGLLDPHLSVLELLGKTGHSPSPMGQSLVTSIDISGHQNVNDSISGSWQAI 89
          E R +++PH SVL+LL      P P    +  S +     N    +S SWQ +
Sbjct: 13 ERRSVIEPHYSVLDLLEANMGGPPPSANVISNSTNTQNDWNAIIDLSDSWQIL 65

>Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON}
           (199741..200976) [1236 nt, 412 aa]
          Length = 411

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 12/117 (10%)

Query: 202 SFVMPKLSLSQK-------NPVFRLLILGRTGSNFYQSI-PKEYQSLFELPKYHDSATFP 253
           +F+MPKL +SQ        N   R LI+G     FY  I P  Y+  F++   +   +  
Sbjct: 76  TFIMPKLIVSQNLWDTNNDNNNNRFLIVGNNSLFFYNEILPINYKKFFKIWCLNKLDS-- 133

Query: 254 QYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIK 310
             + +III  +  E+ ++L +I+  S  K    I       +  N++ +  + KLIK
Sbjct: 134 --SNLIIIINDHNELFNILQKILLNSNRKSCFNIIIILIIEKFNNLITNRRKIKLIK 188

>Ecym_6351 Chr6 complement(681995..684385) [2391 bp, 796 aa] {ON}
           similar to Ashbya gossypii AFR085W
          Length = 796

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 61/124 (49%), Gaps = 9/124 (7%)

Query: 186 EEDSVTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIPKEY---QSLFE 242
           ++D   + + L+S+ N+ +   LS+  ++     L LG T ++F +   ++Y        
Sbjct: 678 QQDLGNVVQDLSSARNANI---LSIEDEHDWGSNLNLGNTSNSFNEIAKRQYLPSDPTLL 734

Query: 243 LPKYHDSATFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKS 302
           L K ++ A   Q   +I     LREMVS +N++   ++G+  I +   G  +  ++ ++ 
Sbjct: 735 LAKINEEA---QINKVIRARAPLREMVSYMNKLRMLTKGRGSIHMDYWGMELASQDRIRD 791

Query: 303 FLRN 306
            LR+
Sbjct: 792 ILRD 795

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,871,895
Number of extensions: 1961455
Number of successful extensions: 7654
Number of sequences better than 10.0: 41
Number of HSP's gapped: 7846
Number of HSP's successfully gapped: 56
Length of query: 527
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 413
Effective length of database: 40,409,475
Effective search space: 16689113175
Effective search space used: 16689113175
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)