Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_9.225.700ON1230123060400.0
YIL147C (SLN1)5.700ON1220121853260.0
Skud_9.215.700ON1221121852380.0
Suva_9.415.700ON1219121850910.0
NCAS0G002505.700ON1183125835300.0
KNAG0L021105.700ON1200125434660.0
SAKL0E14872g5.700ON1140122930530.0
TPHA0D045905.700ON1127123729260.0
ZYRO0G06644g5.700ON116697027250.0
TDEL0B022105.700ON109596326320.0
AFR284W5.700ON1103122025960.0
Kwal_55.197075.700ON114397025320.0
TPHA0E002505.700ON1068122123840.0
CAGL0H06567g5.700ON116978320740.0
KLTH0E01100g5.700ON117773520080.0
Kpol_2001.745.700ON111371618790.0
TBLA0I016805.700ON121476818580.0
KLLA0A00638g5.700ON115574018440.0
Ecym_40205.700ON112572218110.0
Kpol_1043.685.700ON104273115750.0
NDAI0F003105.700ON125939214720.0
TBLA0E021005.700ON114071411751e-140
KAFR0D022405.700ON118741211391e-134
CAGL0F09097g4.385ON6301471801e-12
Ecym_50775.230ON7951651792e-12
ADR343C5.230ON7491641712e-11
Kwal_33.152885.230ON5871741684e-11
TDEL0D003204.385ON5471331665e-11
ADL388W4.385ON4821201665e-11
Ecym_74744.385ON4961201666e-11
KNAG0B051405.230ON6481291667e-11
KLTH0B02684g5.230ON5951871667e-11
CAGL0D02882g5.230ON6671491658e-11
KAFR0B069904.385ON5451201622e-10
KNAG0M001804.385ON6151201622e-10
TDEL0E039805.230ON7301431604e-10
NCAS0A064504.385ON6091221594e-10
KAFR0J007005.230ON6201281594e-10
SAKL0B12408g4.385ON4651201576e-10
YHR206W (SKN7)4.385ON6221561586e-10
ZYRO0A11154g5.230ON7761541587e-10
ZYRO0G00484g4.385ON6471221579e-10
NDAI0D034304.385ON5971631551e-09
KLTH0D17182g4.385ON4641201532e-09
KLLA0A10219g4.385ON4751201522e-09
NCAS0D029005.230ON7621411532e-09
Kpol_1004.45.230ON7141581533e-09
Smik_8.2964.385ON6251221523e-09
Kpol_265.24.385ON5491451523e-09
Suva_15.4124.385ON6171221523e-09
Skud_8.2734.385ON6231561523e-09
TPHA0N008505.230ON6701511514e-09
Suva_10.845.230ON6951491514e-09
TPHA0C001504.385ON5101831496e-09
Smik_12.685.230ON7121491497e-09
YLR006C (SSK1)5.230ON7121491481e-08
Skud_12.725.230ON7021491471e-08
Kwal_47.167704.385ON4611221461e-08
NDAI0I020005.230ON8901451443e-08
TBLA0A107004.385ON5871221415e-08
KLLA0E09505g5.230ON635731372e-07
TBLA0D031705.230ON7651581345e-07
SAKL0G12100g5.230ON738731193e-05
KLLA0E04533g7.222ON42193960.011
SAKL0F08184g7.222ON41293860.15
Kwal_47.181517.222ON41493840.28
Ecym_43787.222ON443118810.66
CAGL0L00869g7.222ON41993810.68
TBLA0B015507.222ON39481800.80
TBLA0E049804.385ON791128810.94
KLLA0F14256gsingletonON96669782.1
Skud_6.388.34ON1758111772.4
YFL033C (RIM15)8.34ON1770110772.9
Kpol_1035.408.34ON1517113763.2
Smik_13.1596.31ON70566754.4
Smik_6.468.34ON1760111745.6
KLTH0A03718g7.216ON47482745.6
YMR001C (CDC5)6.31ON70566745.8
Suva_13.1636.31ON70566745.9
Skud_13.1546.31ON70566736.3
Kpol_1072.428.630ON51766737.0
Kwal_23.41394.268ON66886737.2
Suva_6.268.34ON1753111738.6
Suva_2.7101.15ON42170719.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_9.22
         (1230 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...  2331   0.0  
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...  2056   0.0  
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...  2022   0.0  
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...  1965   0.0  
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...  1364   0.0  
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...  1339   0.0  
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...  1180   0.0  
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...  1131   0.0  
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...  1054   0.0  
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...  1018   0.0  
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...  1004   0.0  
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...   979   0.0  
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...   922   0.0  
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...   803   0.0  
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...   778   0.0  
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...   728   0.0  
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....   720   0.0  
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...   714   0.0  
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...   702   0.0  
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   611   0.0  
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...   571   0.0  
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   457   e-140
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...   443   e-134
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    74   1e-12
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    74   2e-12
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    70   2e-11
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    69   4e-11
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    69   5e-11
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    69   5e-11
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    69   6e-11
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    69   7e-11
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    69   7e-11
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    68   8e-11
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    67   2e-10
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    67   2e-10
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    66   4e-10
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    66   4e-10
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    66   4e-10
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    65   6e-10
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    65   6e-10
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    65   7e-10
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    65   9e-10
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     64   1e-09
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    64   2e-09
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    63   2e-09
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    64   2e-09
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    64   3e-09
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    63   3e-09
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    63   3e-09
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    63   3e-09
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    63   3e-09
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    63   4e-09
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    63   4e-09
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    62   6e-09
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    62   7e-09
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    62   1e-08
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    61   1e-08
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    61   1e-08
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    60   3e-08
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    59   5e-08
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    57   2e-07
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    56   5e-07
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    50   3e-05
KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} simila...    42   0.011
SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} simila...    38   0.15 
Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042...    37   0.28 
Ecym_4378 Chr4 (798444..799775) [1332 bp, 443 aa] {ON} similar t...    36   0.66 
CAGL0L00869g Chr12 complement(107233..108492) [1260 bp, 419 aa] ...    36   0.68 
TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.2...    35   0.80 
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    36   0.94 
KLLA0F14256g Chr6 (1321231..1324131) [2901 bp, 966 aa] {ON} simi...    35   2.1  
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    34   2.4  
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    34   2.9  
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    34   3.2  
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    33   4.4  
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    33   5.6  
KLTH0A03718g Chr1 complement(321327..322751) [1425 bp, 474 aa] {...    33   5.6  
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    33   5.8  
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    33   5.9  
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    33   6.3  
Kpol_1072.42 s1072 complement(94079..95632) [1554 bp, 517 aa] {O...    33   7.0  
Kwal_23.4139 s23 complement(587353..589359) [2007 bp, 668 aa] {O...    33   7.2  
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    33   8.6  
Suva_2.710 Chr2 (1247622..1248884) [1263 bp, 421 aa] {ON} YDR528...    32   9.8  

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
            YIL147C (REAL)
          Length = 1230

 Score = 2331 bits (6040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1154/1230 (93%), Positives = 1154/1230 (93%)

Query: 1    MRLRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYI 60
            MRLRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MRLRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSS 120
            AAQLKSSQIDQTLN          SRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSS
Sbjct: 61   AAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSS 120

Query: 121  NLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVV 180
            NLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVV
Sbjct: 121  NLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVV 180

Query: 181  NNTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAL 240
            NNTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAL
Sbjct: 181  NNTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAL 240

Query: 241  YNNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLA 300
            YNNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLA
Sbjct: 241  YNNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLA 300

Query: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360
            LGYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP
Sbjct: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360

Query: 361  IVRLQKATELITEGRGLRPSTPRTVSRASSFKRGFGSGFTVPSSLLQFNTGEXXXXXXXX 420
            IVRLQKATELITEGRGLRPSTPRTVSRASSFKRGFGSGFTVPSSLLQFNTGE        
Sbjct: 361  IVRLQKATELITEGRGLRPSTPRTVSRASSFKRGFGSGFTVPSSLLQFNTGESGSTISAS 420

Query: 421  XXXXXXXXXXXXXXXESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHDLLA 480
                           ESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHDLLA
Sbjct: 421  GHGGSGHGSGAAFSTESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHDLLA 480

Query: 481  PNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540
            PNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA
Sbjct: 481  PNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540

Query: 541  LLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600
            LLEDRVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEETDVNK
Sbjct: 541  LLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600

Query: 601  IRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660
            IRNSLKLIFRSG            FSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ
Sbjct: 601  IRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660

Query: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDL 720
            RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDL
Sbjct: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDL 720

Query: 721  SEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRDTSIIQEE 780
            SEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRDTSIIQEE
Sbjct: 721  SEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRDTSIIQEE 780

Query: 781  ITKRNTAANENIYKRMNDAEKLXXXXXXXXXXXXXXXXXXAIFNSQFNKAPGSDEDEGGN 840
            ITKRNTAANENIYKRMNDAEKL                  AIFNSQFNKAPGSDEDEGGN
Sbjct: 781  ITKRNTAANENIYKRMNDAEKLSSDDVSSIVSTTTSSYDDAIFNSQFNKAPGSDEDEGGN 840

Query: 841  LGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900
            LGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL
Sbjct: 841  LGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900

Query: 901  ANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPESRKNRRVKFNVA 960
            ANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPESRKNRRVKFNVA
Sbjct: 901  ANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPESRKNRRVKFNVA 960

Query: 961  KSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKREGVNGIGRIEQK 1020
            KSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKREGVNGIGRIEQK
Sbjct: 961  KSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKREGVNGIGRIEQK 1020

Query: 1021 LQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGSVNLDRPFLQSTGTATSSRNVPTIQ 1080
            LQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGSVNLDRPFLQSTGTATSSRNVPTIQ
Sbjct: 1021 LQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGSVNLDRPFLQSTGTATSSRNVPTIQ 1080

Query: 1081 DNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYN 1140
            DNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYN
Sbjct: 1081 DNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYN 1140

Query: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200
            MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR
Sbjct: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200

Query: 1201 PKLKTILTEFCAAYQGKKITSEEPKKAKTE 1230
            PKLKTILTEFCAAYQGKKITSEEPKKAKTE
Sbjct: 1201 PKLKTILTEFCAAYQGKKITSEEPKKAKTE 1230

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
            SLN1Histidine kinase osmosensor that regulates a MAP
            kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1220

 Score = 2056 bits (5326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1014/1218 (83%), Positives = 1073/1218 (88%), Gaps = 1/1218 (0%)

Query: 1    MRLRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYI 60
            MR  LPSK E TPPFRIGIR QLTALVSIVAL SLIILAVTTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MRFGLPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSS 120
            AAQLKSSQIDQTLN          SRDALQSSLTS+VAGNKSADNWVDSLSV+QKFLSSS
Sbjct: 61   AAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSS 120

Query: 121  NLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVV 180
            NLFYVAKVYDSSF  VLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLET GILTDPV+
Sbjct: 121  NLFYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVL 180

Query: 181  NNTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAL 240
            N+TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALE S +AIISA+
Sbjct: 181  NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAV 240

Query: 241  YNNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLA 300
            YN+QGKASGYHF+FPPYG+ S L Q VFSIKN+TFISSAFRNGKGGSLKQTN    +N A
Sbjct: 241  YNSQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTA 300

Query: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360
            LGYSPCSF LVNWVA+VSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP
Sbjct: 301  LGYSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360

Query: 361  IVRLQKATELITEGRGLRPSTPRTVSRASSFKRGFGSGFTVPSSLLQFNTGEXXXXXXXX 420
            IVRLQKATELITEGRGLRPSTPRT+SRASSFKRGF SGF VPSSLLQFNT E        
Sbjct: 361  IVRLQKATELITEGRGLRPSTPRTISRASSFKRGFSSGFAVPSSLLQFNTAEAGSTTSVS 420

Query: 421  XXXXXXXXXXXXXXXESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHDLLA 480
                            SSMKSAINLGNEK+ P E+E KIPNN+TDAK+SMDGSLNHDLL 
Sbjct: 421  GHGGSGHGSGAAFSANSSMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDLLG 480

Query: 481  PNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540
            P+SLR+NDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA
Sbjct: 481  PHSLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540

Query: 541  LLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600
            LLE+RVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEETDVNK
Sbjct: 541  LLEERVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600

Query: 601  IRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660
            IRNSLKLIFRSG            FSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ
Sbjct: 601  IRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660

Query: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDL 720
            RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDK+L
Sbjct: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKEL 720

Query: 721  SEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRDTSIIQEE 780
            SEKKQ+KEV++K+GTE+TE  E T+K D+P  SNHRK VDLES+ TS+ SNRDTS IQEE
Sbjct: 721  SEKKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEE 780

Query: 781  ITKRNTAANENIYKRMNDAEKLXXXXXXXXXXXXXXXXXXAIFNSQFNKAPGSDEDEGGN 840
            ITKRNT ANE+IYK++ND EK                   AIFNSQFNKAPGSD++EGGN
Sbjct: 781  ITKRNTVANESIYKKVNDREKASNDDVSSIVSTTTSSYDNAIFNSQFNKAPGSDDEEGGN 840

Query: 841  LGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900
            LG+PIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL
Sbjct: 841  LGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900

Query: 901  ANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPESRKNRRVKFNVA 960
            ANMM+GTM+LESKVGVGSKFTFTLPL QTKEISFA+M+FPFEDEFNPESRKNRRVKF+VA
Sbjct: 901  ANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVA 960

Query: 961  KSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKREGVNGIGRIEQK 1020
            KSIKSRQSTSS+ATPATNRSSL NDVLPE+ SK +++ K   N NM RE  N  G +EQ 
Sbjct: 961  KSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNGGLEQ- 1019

Query: 1021 LQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGSVNLDRPFLQSTGTATSSRNVPTIQ 1080
            LQEKN+KP IC + AE +E+ ++  KHRSR E LGSVNLDRPFLQSTGTATSSRN+PT++
Sbjct: 1020 LQEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATSSRNIPTVK 1079

Query: 1081 DNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYN 1140
            D+DKN+TS+KILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKG NYN
Sbjct: 1080 DDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYN 1139

Query: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200
            MIFMDVQMPKVDGLLSTKMIRRDLGY SPIVALTAFADDSNIKECLESGMNGFLSKPIKR
Sbjct: 1140 MIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1199

Query: 1201 PKLKTILTEFCAAYQGKK 1218
            PKLKTILTEFCAAYQGKK
Sbjct: 1200 PKLKTILTEFCAAYQGKK 1217

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
            YIL147C (REAL)
          Length = 1221

 Score = 2022 bits (5238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 997/1218 (81%), Positives = 1065/1218 (87%)

Query: 1    MRLRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYI 60
            MR RLPS+S+F PPFRIGIRAQLTALVSIVALVSL ILAVTTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MRFRLPSRSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSS 120
            AAQLKSSQ+DQTLN          SRDALQSSLTS+VAGNKS DNWVDSLSVVQKFLSSS
Sbjct: 61   AAQLKSSQVDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSS 120

Query: 121  NLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVV 180
            NLFYVA+VYDSSFTTVLNATNNGTGDLIPEDVLD+LFPLSTD PLPSSLETTGILTDP+V
Sbjct: 121  NLFYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIV 180

Query: 181  NNTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAL 240
            NNTDYLMSMSLPIFANPSIILTDSRVYGYITI+MSAEGLKSVFNDTTALEKSNVAIISA 
Sbjct: 181  NNTDYLMSMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISAT 240

Query: 241  YNNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLA 300
            YN QG+ASGYHF+FPPYGT  ++TQ +F I+NNTFISS FRNGKGGSLK+TN+FG KNLA
Sbjct: 241  YNAQGRASGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLA 300

Query: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360
            LGYSPCSFQLVNWVAVVSQPESVFLSPATKL KII GTVIAIGVFVILLTLPL HWAV+P
Sbjct: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKP 360

Query: 361  IVRLQKATELITEGRGLRPSTPRTVSRASSFKRGFGSGFTVPSSLLQFNTGEXXXXXXXX 420
            IVRLQKATELITEGRGLRPSTPRTVSRASSF+RGF SGFT PSSLLQFNTGE        
Sbjct: 361  IVRLQKATELITEGRGLRPSTPRTVSRASSFRRGFSSGFTAPSSLLQFNTGEACSTTSAN 420

Query: 421  XXXXXXXXXXXXXXXESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHDLLA 480
                           ESSMKSAINLG+EKL PSE+E KIPNN+ D K+SMDGSLNHDLLA
Sbjct: 421  GHGSSGHGSGVALSTESSMKSAINLGHEKLSPSEEENKIPNNHNDVKISMDGSLNHDLLA 480

Query: 481  PNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540
            PNSLRNNDTDRSS+RSHILTTSANLTEARLPDY+RLFSDELSDLTETFNTMTDALDQHYA
Sbjct: 481  PNSLRNNDTDRSSSRSHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYA 540

Query: 541  LLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600
            LLEDRVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEETDVNK
Sbjct: 541  LLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600

Query: 601  IRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660
            IRN+LKLIFRSG            FSKNVLQRTKLE+RDFCITDVALQIKSIFGKVAKDQ
Sbjct: 601  IRNNLKLIFRSGELLLHILTELLTFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQ 660

Query: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDL 720
            RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKD 
Sbjct: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDS 720

Query: 721  SEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRDTSIIQEE 780
            SEK+QFKEVHVK+GTEIT+  E  +K D+P S   RK+V+LESTT SITS RD S IQEE
Sbjct: 721  SEKRQFKEVHVKKGTEITDVVESIDKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQEE 780

Query: 781  ITKRNTAANENIYKRMNDAEKLXXXXXXXXXXXXXXXXXXAIFNSQFNKAPGSDEDEGGN 840
            ITKRNTAANENIYK+ ND EK                   AIFNSQFNKA  SD DE GN
Sbjct: 781  ITKRNTAANENIYKKANDREKSSNDDVSSIVSTTTSSYDDAIFNSQFNKALDSDSDESGN 840

Query: 841  LGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900
            +G+PIENPKTWVISIEVEDTGPGI+PSLQESVF PFVQGDQTLSRQYGGTGLGLSICRQL
Sbjct: 841  VGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQL 900

Query: 901  ANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPESRKNRRVKFNVA 960
            ANMM+GTM+LES+VGVGSKFTFTLPL QTKEISFAN++FPFEDEFNPES+KNRRVKF+VA
Sbjct: 901  ANMMHGTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVA 960

Query: 961  KSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKREGVNGIGRIEQK 1020
            KSIKSRQSTSS+ TP TN ++L NDVL E  S +E ++++ +N   ++EG N  G+ +Q+
Sbjct: 961  KSIKSRQSTSSLTTPVTNSNTLANDVLIEARSSDEEEVEKTKNFIKRKEGENENGKAQQQ 1020

Query: 1021 LQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGSVNLDRPFLQSTGTATSSRNVPTIQ 1080
             QEKN K  + FSSAE S +KTV  K RS+EE+LGSVN+DRPFLQSTGTATSSRNVPT+Q
Sbjct: 1021 PQEKNTKHSVSFSSAERSSQKTVSSKRRSQEENLGSVNIDRPFLQSTGTATSSRNVPTVQ 1080

Query: 1081 DNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYN 1140
              DK+ TSIKILVVEDNHVNQEVI+RMLNLEGI+NIELACDGQEAFDKVKELTSKG NYN
Sbjct: 1081 GGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYN 1140

Query: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200
            MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR
Sbjct: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200

Query: 1201 PKLKTILTEFCAAYQGKK 1218
            PKL TIL+EFCAAYQGKK
Sbjct: 1201 PKLNTILSEFCAAYQGKK 1218

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
            YIL147C (REAL)
          Length = 1219

 Score = 1965 bits (5091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 984/1218 (80%), Positives = 1062/1218 (87%)

Query: 1    MRLRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYI 60
            MR RLPS+S FTPPFRI IRAQLTALVSIVAL+SL+ILAVTTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MRFRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSS 120
            AAQLKSSQIDQTLN          SRDALQ+SLT +VAGNKS+DNWVDS+S+VQKFLSSS
Sbjct: 61   AAQLKSSQIDQTLNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSS 120

Query: 121  NLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVV 180
            NLF+VAKVYDSSFTTVLNATNNGTGDLIP+D+ D LFPLSTD  LPSSLETTGILTDP++
Sbjct: 121  NLFFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPIL 180

Query: 181  NNTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAL 240
            N+TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISA+
Sbjct: 181  NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAV 240

Query: 241  YNNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLA 300
            YNNQ KA  YHF+FPPYGT+S++T+++F IKNNTFISSAF+NGKGGSLK+TNSFGIKNLA
Sbjct: 241  YNNQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLA 300

Query: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360
            LGYSPCSFQLVNWVAVVSQPESVFLSP+TKLAKIITGTVIAIGVFVILLTLPLAHWAVQP
Sbjct: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360

Query: 361  IVRLQKATELITEGRGLRPSTPRTVSRASSFKRGFGSGFTVPSSLLQFNTGEXXXXXXXX 420
            IVRLQKATELITEGRGLRPSTPRTVSR SSFKRGF SGF VPSSLLQFN+GE        
Sbjct: 361  IVRLQKATELITEGRGLRPSTPRTVSRTSSFKRGFSSGFAVPSSLLQFNSGEAGSTTSAS 420

Query: 421  XXXXXXXXXXXXXXXESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHDLLA 480
                           +SSMKSA+N+GNEKL P E+EK+ PN++ +AK+SMDGSLNHDLLA
Sbjct: 421  GHGCSGRGSAAVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLNHDLLA 480

Query: 481  PNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540
            PN+LR++D DRSS+RSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA
Sbjct: 481  PNALRHSDNDRSSSRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540

Query: 541  LLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600
            LLEDRVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEETDVNK
Sbjct: 541  LLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600

Query: 601  IRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660
            IRNSLKLIFRSG            FSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ
Sbjct: 601  IRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660

Query: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDL 720
            RVRLSISLFPN IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTV+VRMKLLGEYDK+L
Sbjct: 661  RVRLSISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKEL 720

Query: 721  SEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRDTSIIQEE 780
            SEKKQFKEVHV++GTEI E     NK D   S N +K +D ESTTTS+TSNRDTS IQEE
Sbjct: 721  SEKKQFKEVHVRKGTEIIEDIGNINKHDAKKSENFKKSMDSESTTTSMTSNRDTSTIQEE 780

Query: 781  ITKRNTAANENIYKRMNDAEKLXXXXXXXXXXXXXXXXXXAIFNSQFNKAPGSDEDEGGN 840
            ITKRNTAANENIYK+  D EK                   AIFNSQFNKA GSD+DEGG+
Sbjct: 781  ITKRNTAANENIYKKTRDREKSSNDDISSIVSTSTSSYDDAIFNSQFNKALGSDDDEGGD 840

Query: 841  LGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900
            LGKPIENPKTW ISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL
Sbjct: 841  LGKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900

Query: 901  ANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPESRKNRRVKFNVA 960
            ANMM+GTM+LESKVGVGSKFTFTLPL QTKEISFANM+FPFEDEFNPESR+NRRVKFNVA
Sbjct: 901  ANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNVA 960

Query: 961  KSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKREGVNGIGRIEQK 1020
            +SIKSRQS SSIATP  NR  L N++L +  S  E + ++  N    +EG N +    Q+
Sbjct: 961  RSIKSRQSASSIATPTANRCGLTNEMLRKSRSNEEEEGRKIINIEEGKEGGNELDEAHQQ 1020

Query: 1021 LQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGSVNLDRPFLQSTGTATSSRNVPTIQ 1080
            LQEKNVK  I FSSA+S+E+K+ P    SREES+GSVNLDRPFLQSTGTATS+RN+PT+ 
Sbjct: 1021 LQEKNVKNSISFSSADSNEQKSAPSTRHSREESVGSVNLDRPFLQSTGTATSNRNIPTVS 1080

Query: 1081 DNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYN 1140
            ++DK+D+SIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQ+AFDKVKELTS+G +YN
Sbjct: 1081 NSDKSDSSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYN 1140

Query: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200
            MIFMDVQMPKVDGLLSTKMIRRDLGY SPIVALTAFADDSNIKECLESGMNGFLSKPIKR
Sbjct: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200

Query: 1201 PKLKTILTEFCAAYQGKK 1218
            PKLKTIL EFCAAYQGKK
Sbjct: 1201 PKLKTILIEFCAAYQGKK 1218

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1183

 Score = 1364 bits (3530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 739/1258 (58%), Positives = 883/1258 (70%), Gaps = 103/1258 (8%)

Query: 1    MRLRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYI 60
            M++ L       PPFR+GIR QLT LVS+VAL SL+ILA+TTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MKVNLSKWYVLKPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSS 120
            AAQLKSSQIDQ LN          SRD LQ  LT++VAGNK+A+NW DS  V+QKFL+S+
Sbjct: 61   AAQLKSSQIDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSN 120

Query: 121  NLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVV 180
            NLF  A++YDSSF  VL ATNNGTGDLIPE VL  L+PL+T+ PL SSLET GILTDPV+
Sbjct: 121  NLFSNAQLYDSSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVL 180

Query: 181  NNTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAL 240
            N + Y+MSMSLPIFANPSIILTDS+VYGYITI+MSAEGLK+VFNDTTALE+SNVAI+S +
Sbjct: 181  NGSTYIMSMSLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGV 240

Query: 241  YNNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLA 300
            YNN+   + YHF+F PYG  S +  S F I NN+F+++A R GKGGS+K+T  F  KN+A
Sbjct: 241  YNNESTLNAYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIA 300

Query: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360
            +GYSPC+F  VNW+A+VSQ ESVFLSP+TKLAKII+GTV+AIGVFV L+T PLAHWAV+P
Sbjct: 301  VGYSPCTFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKP 360

Query: 361  IVRLQKATELITEGRGLRPSTP--RTVSRASSFKRGFGSGFTVPSSLLQFNTGEXXXXXX 418
            IVRLQKATEL++EGRGL+ +TP  + VSR+SS K    S     +S +   +G+      
Sbjct: 361  IVRLQKATELMSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNL---- 416

Query: 419  XXXXXXXXXXXXXXXXXESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHDL 478
                               S  +  +L    L P+      P   TD     D +   ++
Sbjct: 417  -------------------STTTNGHLNQRGLTPT------PMPTTDLPSPSDSNFATEM 451

Query: 479  L--APNSLRNNDTDRS------SNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNT 530
            +  A  S R N   R       SNRS  LTTSANL EAR+PDYRRLFSDELSDLT+TFN 
Sbjct: 452  ISNANTSQRANSISRFTDHTDLSNRSKKLTTSANLIEARVPDYRRLFSDELSDLTDTFNA 511

Query: 531  MTDALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTA 590
            MTDALDQHYALLEDRVRARTKQL             KT+FIANISHELRTPLNGILGMTA
Sbjct: 512  MTDALDQHYALLEDRVRARTKQLEAAKIEAETANEAKTIFIANISHELRTPLNGILGMTA 571

Query: 591  ISMEETDVNKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIK 650
            ISMEETD+ KIR+SLKLIFRSG            FSKNVL+RT LEKRDFCITDVALQIK
Sbjct: 572  ISMEETDIAKIRSSLKLIFRSGELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIK 631

Query: 651  SIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRM 710
            SIFGKVAKDQRVRLSI L PN+IRTM+L+GDSNRIIQIVMNLVSNALKFTPVDG V+VR+
Sbjct: 632  SIFGKVAKDQRVRLSIVLLPNIIRTMILFGDSNRIIQIVMNLVSNALKFTPVDGKVNVRI 691

Query: 711  KLLGEYDKDLSEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITS 770
            KL+GEYD++LS +  FK+V VK GTE  E      K    + +   K  D +++T S+  
Sbjct: 692  KLMGEYDENLSRESNFKKVLVKSGTEFIE-----TKAKAILGA--PKKDDPKTSTESVVQ 744

Query: 771  NRDTSIIQEEITKRNTAANENIYKRMNDAEKL------------------XXXXXXXXXX 812
                  I+E +    ++++ +I    +D +K                             
Sbjct: 745  ------IKENLNSNTSSSSNDIISTTSDEKKYDEKEDEGEEDNSDNDNDDTSMETQSIVS 798

Query: 813  XXXXXXXXAIFNSQFNKAPGSDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESV 872
                    A+FN+QF K P   EDE GNLG  + NPKTWVI+IEV+DTGPGIDPSLQ+SV
Sbjct: 799  TSTSSYDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVIAIEVQDTGPGIDPSLQKSV 858

Query: 873  FHPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEI 932
            F PFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTM L+S+VGVGS FTFT+PL QT+E+
Sbjct: 859  FEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVPLMQTREL 918

Query: 933  SFANMDFPFEDEFNPESRKNRRVKFNVAKSIKSRQSTSSIATPATNRSSLINDVLPEIGS 992
                 D PFEDEFNP SRKNRRVKF +AKS++SR+S SS      + ++ +++V  E   
Sbjct: 919  ELNEDDHPFEDEFNPASRKNRRVKFKLAKSLRSRKSRSSTT--TFSTTNSLHNVQEE--- 973

Query: 993  KNENQIKRFENSNMKREGVNGIGRIEQKLQEKNVKPFICFSSAESSEKKTVPPKHRSREE 1052
            K E+++   E +   ++G    G+ E   QE+            S +K      H     
Sbjct: 974  KEEDKLGDNEET---KDG----GKEEDAHQERR----------HSHDKNNEHNNHL---- 1012

Query: 1053 SLGSVNLDRPFLQSTGTATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNLEG 1112
             LG+VN+DRPFLQSTGTATS+R + T+ D  K     KILV EDNHVNQEVIKRMLNLEG
Sbjct: 1013 -LGTVNMDRPFLQSTGTATSTRTIQTVPDAGK---KFKILVAEDNHVNQEVIKRMLNLEG 1068

Query: 1113 IENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVA 1172
            +ENIELA DGQ+AF++VK +  +G +++MIFMDVQMPKVDGLLSTKMIR DL Y  PIVA
Sbjct: 1069 VENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVA 1128

Query: 1173 LTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQGKKITSEEPKKAKTE 1230
            LTAFADDSNIKECLE+GMNGFLSKPIKRPK+KTIL E+C  +Q K     E  K+K E
Sbjct: 1129 LTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILEEYCPNWQMK---VAEDNKSKNE 1183

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5.700
            YIL147C
          Length = 1200

 Score = 1339 bits (3466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 737/1254 (58%), Positives = 868/1254 (69%), Gaps = 108/1254 (8%)

Query: 1    MRLRLPSKSEFTP--PFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRL 58
            M  RL S   FTP  P+R+GIRAQLT LVSIVA++SL+ILAVTTGVYFTSNYKNLRSDRL
Sbjct: 1    MWFRLRS---FTPKPPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRL 57

Query: 59   YIAAQLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLS 118
            YIAAQLKSSQIDQ LN          SRD LQ+ L ++VAGNKS  NW+DS SV++KFL 
Sbjct: 58   YIAAQLKSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLG 117

Query: 119  SSNLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDP 178
            SSNLF VA+VYDSSFTTVLN TNN TGDLIPEDVL  L PLST+ PLPSSLET GI+T+P
Sbjct: 118  SSNLFSVARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNP 177

Query: 179  VVNNTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIIS 238
            V N + YLMSMSLPIFANPSIILTDSRVYGY+T++MSAEGL SVFNDTTALE+S VAI+S
Sbjct: 178  VKNGSSYLMSMSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVS 237

Query: 239  ALYNNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKN 298
            A+Y N  K   Y F+FPP+G+ S++    F + NNTF+SSA R GKGG+LK T  F    
Sbjct: 238  AVYTNATKLDAYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLK 297

Query: 299  LALGYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAV 358
            LA+GYSP +  L NWVA+V+Q ESVF+SPATKLAKII GTV+ IGVF +L+T PLAHWAV
Sbjct: 298  LAVGYSPSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAV 357

Query: 359  QPIVRLQKATELITEGRGLRPSTPRTVSRASSFKRGFGSGFTVPSSLLQFNTGEXXXXXX 418
            +PIVRLQKATELITE RGLRP+TP + SRA+S  R         SSL+ F          
Sbjct: 358  KPIVRLQKATELITESRGLRPTTPTSGSRANSILRD-------KSSLISFPLHPV----- 405

Query: 419  XXXXXXXXXXXXXXXXXESSMKSAINLGNEKLLPSEDEKKIPNNNTDA----KVSMDGSL 474
                              S+     N  NEK  P  D+    NN++ +     +  + S 
Sbjct: 406  ------------------STNNINNNNSNEKAQPPSDQDTNTNNSSSSIAVSNIREEHSP 447

Query: 475  NHD-LLAPNSLRN--NDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTM 531
            + D + +  SL N  +  +R SN S   TT+ NL +AR+P YR LF DELSDLTETFNTM
Sbjct: 448  HADGVFSGISLSNVSDRLERLSNTSKHYTTAVNLIQARVPSYRALFKDELSDLTETFNTM 507

Query: 532  TDALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAI 591
            TDALDQHYALLE+RVRARTKQL             KTVFIANISHELRTPLNGILGMTAI
Sbjct: 508  TDALDQHYALLEERVRARTKQLEAAKIEAETANEAKTVFIANISHELRTPLNGILGMTAI 567

Query: 592  SMEETDVNKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKS 651
            SMEETD++KIRNSLKLIFRSG            FSKNVL+RTKLEKR+FCITDVALQIKS
Sbjct: 568  SMEETDIDKIRNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEKRNFCITDVALQIKS 627

Query: 652  IFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMK 711
            IFGKVAKDQ VRLSI L PN+IR+MVL+GDSNRIIQIVMNLVSNALKFTPVDG VDVRMK
Sbjct: 628  IFGKVAKDQHVRLSIILSPNMIRSMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVDVRMK 687

Query: 712  LLGEYDKDLSEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSI-TS 770
            +LG YD+ LSEK    +V+VK GTEIT+ +   N     + S  +      S T S   +
Sbjct: 688  VLGLYDEALSEKYNHNKVYVKPGTEITDSTPSLN-----VKSEGQGKDKFTSDTASKNNT 742

Query: 771  NRDTSIIQEEITKR--NTAANENIYKRMNDAEKLXXXXXXXXXXXXXXXXXXAIFNSQFN 828
            + DT+      T R    +  +N+Y+   D E +                  AIFNSQF 
Sbjct: 743  SSDTAYDATPTTDRVAQESDEDNMYE---DNESM--------ISSTTSSYDDAIFNSQFK 791

Query: 829  KAPG-SDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQY 887
            K     DED+   +G  +E PKTWVIS EVED+GPGID  LQESVF PFVQGDQTLSRQY
Sbjct: 792  KTTNLYDEDDESEMGVELETPKTWVISFEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQY 851

Query: 888  GGTGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNP 947
            GGTGLGLSICRQLA MM G M LESKVGVGSKFTFTLPL QT+EI+FAN++ PFEDEFN 
Sbjct: 852  GGTGLGLSICRQLAGMMKGKMLLESKVGVGSKFTFTLPLTQTREINFANVEDPFEDEFNA 911

Query: 948  ESRKNRRVKFNVAKSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMK 1007
            +S+KNR+VKF +A+S+ SR+S SSI T   +    ++   P    +      + + S   
Sbjct: 912  KSKKNRKVKFRMARSLNSRKSRSSIVTAGASSHHSVHTRTPTKSPR-----LKCDRSVSD 966

Query: 1008 REGVNGIGRIEQKLQEKNVKPFICFSSAESSEKKTVPPKHRSREE-------SLGSVNLD 1060
            R  +N   R  +          I F S ES +   +   HR+R++       S  +++LD
Sbjct: 967  RVVINSPERTGEN---------ITFRS-ESDDH--LSHMHRNRDKDHERLSASNSTMSLD 1014

Query: 1061 RPFLQSTGTATSSRNVP---TIQDNDKNDT-------------------SIKILVVEDNH 1098
            RPFLQSTGTATS+R++P   + ++   ND                    + KILV EDNH
Sbjct: 1015 RPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKILVAEDNH 1074

Query: 1099 VNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTK 1158
            VNQEVIKRML LEG+++I+LACDGQ+AFDKVK+L  KG  YN+IFMDVQMPKVDGL STK
Sbjct: 1075 VNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTK 1134

Query: 1159 MIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCA 1212
            MIR DL    PIVALTAFADDSNIKECL++GM+GFLSKPIKR KLKTIL EFC+
Sbjct: 1135 MIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCS 1188

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} similar
            to uniprot|P39928 Saccharomyces cerevisiae YIL147C SLN1
            Histidine kinase osmosensor that regulates a MAP kinase
            cascade; transmembrane protein with an intracellular
            kinase domain that signals to Ypd1p and Ssk1p, thereby
            forming a phosphorelay system similar to bacterial
            two-component regulators
          Length = 1140

 Score = 1180 bits (3053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/1229 (52%), Positives = 809/1229 (65%), Gaps = 120/1229 (9%)

Query: 8    KSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67
            +S+  PPF++GIR QL ALV +VAL+SL+ILAVTTGVYFT+NYK+LR+DRL++AAQLKSS
Sbjct: 8    RSKLKPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHVAAQLKSS 67

Query: 68   QIDQTLNXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNLFYVAK 127
            QIDQ LN          +RD LQ SL  + AGN + +NW ++  V++KFL SS+LF VA+
Sbjct: 68   QIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVAR 127

Query: 128  VYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNNTDYLM 187
            +YDS+F TVLNATNNG+G+L+PE VL +LFPLSTD PL SSL+T+GILTDPV+N+T Y+M
Sbjct: 128  IYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVM 187

Query: 188  SMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYNNQGKA 247
            SMSLPIFA+PSI+LT+S + GYIT++MSAE LK VFNDTTAL+KS+VAI+SA Y+NQ   
Sbjct: 188  SMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLP 247

Query: 248  SGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLALGYSPCS 307
              YHF+FPP+G  + +    F+I+N +FI SAF + K GS+K+T+ F  K++A+GYSPC 
Sbjct: 248  VSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCL 307

Query: 308  FQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKA 367
            F+ V WVAV+SQPE+VFLSP+T+L  II GT + I VF+ L+T PLAHWAV+PIVRLQKA
Sbjct: 308  FKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKA 367

Query: 368  TELITEGRGLRP---STPRTVSRASSFKRGFGSGFTVPSSLLQFNTGEXXXXXXXXXXXX 424
            TE+IT  RGLR    S P   SR +SF++   +  ++ S                     
Sbjct: 368  TEIITARRGLRSYNQSAP--ASRTNSFRKRPSTSSSIGSVFRTITDRPHERDNGHSNFEL 425

Query: 425  XXXXXXXXXXXESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHDLLAPNSL 484
                       E+ M+  I+              +P+ N                 P S 
Sbjct: 426  HHRTSNSVDSQEARMELEIS------------GALPDTNP--------------TTPTSY 459

Query: 485  RNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLED 544
             N   D+ S +S     S NL +AR+P Y RLFSDELS+LT+TFNTMTD LD+HYALLED
Sbjct: 460  TN---DQHSYKSDNFVNSTNLIDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLED 516

Query: 545  RVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNS 604
            RVRARTKQL             KTVFIANISHELRTPLNGILGMTAISM E D+ K++NS
Sbjct: 517  RVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNS 576

Query: 605  LKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRL 664
            LKLIFRSG            FSKNVLQRTKLE+R+F I DVALQ+KSIFGK+AKDQ V L
Sbjct: 577  LKLIFRSGELLLHILTELLTFSKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNL 636

Query: 665  SISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDLSEKK 724
            SI L PN+IRTM+LWGDSNRIIQIVMNLVSNALKF+PVDG V VR+KLLGEYD   S+  
Sbjct: 637  SIILSPNVIRTMILWGDSNRIIQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDS 696

Query: 725  QFKEVHVKRGTEITEYSE--------ETNKCD-----IPISSNHRKHVDLESTTTSITSN 771
             + +V +K GTEI + S         E  K D     +   S+  + +  E   +S  S+
Sbjct: 697  NYNDVFIKPGTEIPDASASKSSLSTLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSS 756

Query: 772  RDTSIIQEEITKRNTAANENIYKRMNDAEKLXXXXXXXXXXXXXXXXXXAIFNSQFNKAP 831
             D     E  T  +T    N    ++D+                     AI ++Q  K P
Sbjct: 757  SDGKDESEADTDTDTDKRSN--SEISDSLS--------LVSSNNSSYDDAILHAQLRKVP 806

Query: 832  --GSDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGG 889
              G+ ED G +LG+ +E  KTWVI+IEVEDTGPGI+P+L ESVF PFVQGDQTLSRQYGG
Sbjct: 807  SCGNGEDSGDSLGRKLEISKTWVIAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGG 866

Query: 890  TGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPES 949
            TGLGLSICRQLA MM GTM+LESKVGVGSKFTFT+PL QT+E+SF +++ PFEDEFN  S
Sbjct: 867  TGLGLSICRQLAKMMKGTMKLESKVGVGSKFTFTVPLTQTREVSFDDVENPFEDEFNAHS 926

Query: 950  RKNRRVKFNVAKSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKRE 1009
            +KNR+VKF + K+     S  S + P+ N S         + S  ++  ++   S  + E
Sbjct: 927  KKNRKVKFKMNKN-----SGGSKSRPSVNTS---------LNSGTDSTAEKMALS--ESE 970

Query: 1010 GVNGIGRIEQKLQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGSVNLDRPFLQSTGT 1069
               G  R++        +PF+  +   +S +     K           +L+RPF      
Sbjct: 971  VSVGSVRVD--------RPFLQSTGTATSTRSITTVK-----------SLERPF------ 1005

Query: 1070 ATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKV 1129
                                KILV EDN+VNQEV+KRMLNLEG+ +I+LACDGQEAFDKV
Sbjct: 1006 --------------------KILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKV 1045

Query: 1130 KELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESG 1189
            K L     +Y +IFMDVQMP+VDGLLSTKMIR++L Y  PIVALTAFADDSNIK CL+SG
Sbjct: 1046 KALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSG 1105

Query: 1190 MNGFLSKPIKRPKLKTILTEFCAAYQGKK 1218
            MNGFLSKPIKRPKLK++L+EFC  +  K+
Sbjct: 1106 MNGFLSKPIKRPKLKSVLSEFCPDFVEKR 1134

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_5.700
            YIL147C
          Length = 1127

 Score = 1131 bits (2926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 646/1237 (52%), Positives = 796/1237 (64%), Gaps = 134/1237 (10%)

Query: 3    LRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAA 62
            ++L  K  + PP+RI IRAQLTALVS+VA++SLIILAVT GVYFT+NYKNL++ RLYIAA
Sbjct: 1    MQLIPKKFWKPPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAA 60

Query: 63   QLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNL 122
            QLK+SQIDQTLN          S + LQ+SL S+ AGN S+ NW +S  V++KFL+SS+L
Sbjct: 61   QLKASQIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDL 120

Query: 123  FYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNN 182
            F VA++YD++F  ++NATNN +G+ +PE V+D LF LS +  LPSSLET GI TDPV+N 
Sbjct: 121  FSVARLYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNG 180

Query: 183  TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYN 242
            +++LMSMSLPIFANPSIIL+DSR+YGY+++IMSAEGLKSVFNDTTALE S V +ISA Y+
Sbjct: 181  SNFLMSMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYS 240

Query: 243  NQGKASGYHFIFP-PYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLAL 301
                   ++F+F   Y  A       + I N+TF+ +   NGKGG++K+TN F     A+
Sbjct: 241  ITTNLEYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAV 300

Query: 302  GYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPI 361
            GYS CSF LVNW+A+V+QPE+ F   ATKL +II+G V+A+ VFV LLT PL+HWAVQP+
Sbjct: 301  GYSSCSFSLVNWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPL 360

Query: 362  VRLQKATELITEGRGLRPSTP---RTVSRASSFKRGFGSGFTVPSSLLQFNTGEXXXXXX 418
            +RLQKATE I EGRGLRP  P    +VSR SS K        V SSL  FN  +      
Sbjct: 361  IRLQKATERIAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSL-GFNANKLSDS-- 417

Query: 419  XXXXXXXXXXXXXXXXXESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHDL 478
                               S+ +     N     S     I  NN  +  SM  + + DL
Sbjct: 418  ------------------GSITANNFKNNTSSSNSITSSHIYGNNNSSHSSMGINPDDDL 459

Query: 479  LAPNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQH 538
                          S+ S    TSANL EAR+P Y RL  DELS+LT+TFNTMTDALDQH
Sbjct: 460  --------------SSSSQKYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQH 505

Query: 539  YALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDV 598
            Y LLE+RVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEE DV
Sbjct: 506  YCLLEERVRARTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDV 565

Query: 599  NKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAK 658
            +KIR +LKLIFRSG            FSKNVLQRTKLEKRDFCIT+VALQIKSIFGK+AK
Sbjct: 566  DKIRGNLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAK 625

Query: 659  DQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDK 718
            DQ V+LSI L PN++R+ VLWGDSNRIIQ+VMNLVSNALKFTPVDG VDVR+ LLGEYD+
Sbjct: 626  DQHVKLSIILMPNILRSYVLWGDSNRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDE 685

Query: 719  DLSEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRDTSIIQ 778
            + S+ + +K+V+VK+GTE+            P++ +H K          I+   +T +  
Sbjct: 686  ERSKAEDYKKVYVKQGTEL------------PLNISHLK----TEENNDISRKSETELNN 729

Query: 779  EE-----ITKRNTA------ANENIYKRMNDAEKLXXXXXXXXXXXXXXXXXXAIFNSQF 827
            +E     I+K +TA       NE++   +++ +K+                       Q 
Sbjct: 730  DENETHTISKDDTADSSIKIGNEDV--EISEVDKMGMASLVTTSSKSYDDTALM---KQL 784

Query: 828  NKAPGSDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQY 887
             K+   D+DE   LG  ++  KTWVIS+EV+DTG GIDP LQESVF PFVQGDQ LSRQY
Sbjct: 785  IKSTDLDDDEN-KLGVELKEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQY 843

Query: 888  GGTGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNP 947
            GGTGLGLSIC+QL+ MMNGTM LES+VGVGSKF FTLPL QT+EIS  + D  F DEFN 
Sbjct: 844  GGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLKQTREISIPD-DELFNDEFNA 902

Query: 948  ESRKNRRVKFNVAKSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMK 1007
             S+KNR+VKF  + S     S  SI T  +  SSL                      N +
Sbjct: 903  VSKKNRKVKFKFSGS----SSAKSIKTRNSIGSSL----------------------NNR 936

Query: 1008 REGVNGIGRIEQKLQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGSVNLDRPFLQST 1067
                +         +E NV+P                           SV L+RPFLQST
Sbjct: 937  HSTTSIDSSSSDSDEEDNVRP--------------------------SSVRLNRPFLQST 970

Query: 1068 GTATSSRNVPTI----QDNDKNDTS-----IKILVVEDNHVNQEVIKRMLNLEGIENIEL 1118
            GTATS++NVPT+     D  KN        I ILV EDNHVNQEVIKRML LEGI NI+L
Sbjct: 971  GTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEGINNIDL 1030

Query: 1119 ACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFAD 1178
            A DGQ+AFDK K L+   GNY++IFMDVQMP++DGL +TKMIR +L Y  PIVAL+AF  
Sbjct: 1031 ARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQPIVALSAFPK 1090

Query: 1179 DSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQ 1215
            + N+KECL+ GMN FLSKPIKRP LK IL ++   +Q
Sbjct: 1091 EENVKECLDVGMNDFLSKPIKRPDLKIILKKYIEDFQ 1127

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1166

 Score = 1054 bits (2725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/970 (58%), Positives = 681/970 (70%), Gaps = 62/970 (6%)

Query: 1   MRLRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYI 60
           M +R     +F  P R+GIRAQLTALVSIVALVSLIILAV+TGVYFT NYKNLRS+RLY+
Sbjct: 1   MWMRQLMFGKFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYM 60

Query: 61  AAQLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSS 120
           AAQLKS+QIDQ LN          SRD LQ +L ++VAGNK+  NWVDS +V+QKFL+SS
Sbjct: 61  AAQLKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSS 120

Query: 121 NLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVV 180
            LF VA +YD++FT VL+ATNNGTG+ IPE  LD L PLS + PLPSSL++ GILT+PV+
Sbjct: 121 GLFSVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVL 180

Query: 181 NNTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAL 240
           N T YLMSMSLPIFANPSIILT S VYGYITI+MSA+ LK+VF+DTTALEKSNVAI+SA+
Sbjct: 181 NGTSYLMSMSLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAV 240

Query: 241 YNNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLA 300
           Y+     S Y+F+F P G  S++      IKN TF+SSA R GKGG+L++T     K +A
Sbjct: 241 YDQNETLSSYNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVA 300

Query: 301 LGYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360
           +GYSPCS   VNW+AVV Q E+VF+ PATKL KII+GTV+ IGVFV L+T PLAHWAV+P
Sbjct: 301 VGYSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKP 360

Query: 361 IVRLQKATELITEGRGLRPSTP----RTVSRASSFKRGFGSGFTVPSSLLQFNTGEXXXX 416
           IVRLQKATELITEGRGLR S+P      VSR SSF       F  PS     N G     
Sbjct: 361 IVRLQKATELITEGRGLRASSPGAGSSNVSRRSSF-------FHRPS-----NCG----- 403

Query: 417 XXXXXXXXXXXXXXXXXXXESSMKSAI-NLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLN 475
                               SS++S + +  NEK      E+           +M+GS+N
Sbjct: 404 --------------------SSIRSRVTDNHNEKGHDLHGEQI-----QHGFFAMNGSIN 438

Query: 476 HDLLAPNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDAL 535
           H L A  S+ ++  +  S++S  LTTSANL EAR+P YRR FSDELS+LT+TFNTMTDAL
Sbjct: 439 HSLAA--SIASSGNEALSDKSKGLTTSANLIEARVPVYRRFFSDELSELTDTFNTMTDAL 496

Query: 536 DQHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEE 595
           DQHYALLEDRVRART+QL             KTVFIANISHELRTPLNGILGMTAISMEE
Sbjct: 497 DQHYALLEDRVRARTRQLEAAKIDAEAANEAKTVFIANISHELRTPLNGILGMTAISMEE 556

Query: 596 TDVNKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGK 655
            D++KI+NSLKLIFRSG            FSKNVL+RTKLEKR+F +TDVALQIKSIFGK
Sbjct: 557 RDIDKIQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEKRNFSVTDVALQIKSIFGK 616

Query: 656 VAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGE 715
           VAKDQRVRLSI+L+PNLIRTMVL+GDSNRIIQIVMNLVSNALKFTPVDG V+V M LLGE
Sbjct: 617 VAKDQRVRLSITLYPNLIRTMVLFGDSNRIIQIVMNLVSNALKFTPVDGKVNVYMSLLGE 676

Query: 716 YDKDLSEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRDTS 775
           YD + SE +  K+V+V  GTE  + ++E +K  I      ++   +E+T    +SN    
Sbjct: 677 YDAERSENENHKKVYVIPGTE-PKGNDEKDKGGI----EEKERFSIENTPNDTSSNSSNK 731

Query: 776 IIQEEITKRNTAANENIYKRMND-----AEKLXXXXXXXXXXXXXXXXXXAIFNSQFNKA 830
               E T      N+   K+ +D      E +                   +F+SQF K 
Sbjct: 732 HSDTETTP---GLNDTDEKQASDDMDGGEEDVEDADEVSSFSTSTSSYNDTVFHSQFKKT 788

Query: 831 PGSDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGT 890
           P   +D    LG  +++ K WVISI VEDTGPGID SL ESVF PFVQGDQ LSRQYGGT
Sbjct: 789 PKVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQALSRQYGGT 848

Query: 891 GLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPESR 950
           GLGLSICRQLA MMNGTM L+SK+GVGS+FTFT+PL QT+EI+F ++   FEDEFNP+S+
Sbjct: 849 GLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDIPAAFEDEFNPDSK 908

Query: 951 KNRRVKFNVA 960
           KNR+VKF +A
Sbjct: 909 KNRKVKFKIA 918

 Score =  236 bits (603), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 138/175 (78%), Gaps = 7/175 (4%)

Query: 1056 SVNLDRPFLQSTGTATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIEN 1115
            SV LDRPFLQSTGTA+S+ N+ T        T  KILV EDN VNQEVIKRMLNLEG+ N
Sbjct: 955  SVRLDRPFLQSTGTASSNTNLGT------TSTINKILVAEDNDVNQEVIKRMLNLEGVHN 1008

Query: 1116 IELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTA 1175
            IEL CDGQEA DKVK+L   G +YN+IFMDVQMPK+DGLLSTKMIRRDL Y  PIVALTA
Sbjct: 1009 IELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTA 1068

Query: 1176 FADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQGKKITSEEPKKAKTE 1230
            FADDSNI+ECL++GM+GFL+KPIKR +L+ I+ EFC   Q ++   +EPK ++ +
Sbjct: 1069 FADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPDKQPQE-QDKEPKSSEND 1122

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1095

 Score = 1018 bits (2632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/963 (57%), Positives = 661/963 (68%), Gaps = 73/963 (7%)

Query: 1   MRLRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYI 60
           MRL   +K +F+PPFRI IR QLTALVS+VALVSLIILAVTTGVYFTSNYK+LRS+RLY+
Sbjct: 1   MRLGTIAKEKFSPPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYV 60

Query: 61  AAQLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSS 120
           AAQLKSSQIDQ LN          S+  LQ+SL ++V+GNK+  NWVDS SV+QKFLSSS
Sbjct: 61  AAQLKSSQIDQNLNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSS 120

Query: 121 NLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVV 180
            LF VA+VYD+ F TVLNATNNGTGD++ +DVL  L PLS++  LP+SLE+ G+LTDPV+
Sbjct: 121 ALFSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVL 180

Query: 181 NNTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAL 240
           N T YLMSMSLPI+ANPSIILT+SRVYGY+TIIMSA+ LKSV++D TALEKS+V I+SA+
Sbjct: 181 NGTSYLMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAI 240

Query: 241 YNNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLA 300
           Y        Y F+F PYGT   +    + I NN+F+S+A R GK GS ++T+ F  +  A
Sbjct: 241 YKKDQGLGSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSA 300

Query: 301 LGYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360
           +GYSPCSF+ VNWVA++SQ E+VF+ P+T+L KII G V+ IG FV + T PLAHWAVQP
Sbjct: 301 VGYSPCSFKFVNWVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQP 360

Query: 361 IVRLQKATELITEGRGLRPSTPRTVSRASS---FKRGFGSGFTVPSSLLQFNTGEXXXXX 417
           IVRLQKATE+ITEGRGLR  TP + S + +    +R F    +V S  L    G      
Sbjct: 361 IVRLQKATEIITEGRGLRSGTPGSSSVSRNSSFIRRRFSGSSSVRSPSLADEKG------ 414

Query: 418 XXXXXXXXXXXXXXXXXXESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHD 477
                              +S + + N           ++ +P+ N++A++S D      
Sbjct: 415 ---------------AVGRASTEGSFNY----------DQAVPSLNSNAEISSD------ 443

Query: 478 LLAPNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQ 537
                            R+    TS+NL EAR+P YR  FSDE S+LT+TFNTMT+ALDQ
Sbjct: 444 -----------------RTRKYMTSSNLVEARVPVYRIFFSDEFSELTDTFNTMTNALDQ 486

Query: 538 HYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETD 597
           HYALLEDRVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEE D
Sbjct: 487 HYALLEDRVRARTKQLEAAKVEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEERD 546

Query: 598 VNKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVA 657
           ++KI++SLKLIFRSG            FSKNVLQRTKLEKRDF ITDVA+QIKSIFGKVA
Sbjct: 547 IDKIQSSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVA 606

Query: 658 KDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYD 717
           KDQRV+ SI+LFPN IR MVL+GDSNRIIQIVMNLVSNALKFTPVDG V VRM+LLGEYD
Sbjct: 607 KDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVSVRMRLLGEYD 666

Query: 718 KDLSEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRDTSII 777
           K  SE + FK V+V  GTE  E     +    P      K  DLE    S   N      
Sbjct: 667 KQRSENEDFKAVYVIDGTEPRE-----DGLIPPPVKQFEKQEDLEKEKISEKHN------ 715

Query: 778 QEEITKRNTAANENIYKRMNDAEKLXXXXXXXXXXXXXXXXXXAIFNSQFNKAPGSDEDE 837
            EE    + +   N+  +  D+++                    IF++QF K   S  DE
Sbjct: 716 -EEEASTSDSEKTNLDDKTPDSKRSDADDQVSLISISTSSYDDTIFHTQFKKHTSSSGDE 774

Query: 838 GGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSIC 897
            G+L   +E+PK W IS+EVEDTGPGIDPSL ESVF PFVQGDQ LSRQYGGTGLGLSIC
Sbjct: 775 NGHL---LEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSIC 831

Query: 898 RQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPESRKNRRVKF 957
           RQLA MMNGTM+L+SK+GVGSKFTFTLPL QT+EI F + +  FEDEFNP S+KNR+VKF
Sbjct: 832 RQLATMMNGTMKLDSKLGVGSKFTFTLPLTQTREIEFEDEN-AFEDEFNPLSKKNRKVKF 890

Query: 958 NVA 960
            VA
Sbjct: 891 KVA 893

 Score =  248 bits (633), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 117/161 (72%), Positives = 139/161 (86%), Gaps = 3/161 (1%)

Query: 1051 EESLGSVNLDRPFLQSTGTATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNL 1110
            E S+G+V+LDRPFLQSTGTA+SS+NV  + + +K   S +ILV EDNHVNQEVIKRML L
Sbjct: 928  EFSVGNVSLDRPFLQSTGTASSSKNVTVVSNVNK---SYRILVAEDNHVNQEVIKRMLTL 984

Query: 1111 EGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPI 1170
            EGI+ I+LA DGQ+AFDKVK L  KG +Y +IFMDVQMPKVDGLL+TKMIR+DL Y+ PI
Sbjct: 985  EGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPI 1044

Query: 1171 VALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFC 1211
            VALTAFADDSNI+ CLE+GMNGFLSKPIKRPKLKTI+ ++C
Sbjct: 1045 VALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score = 1004 bits (2596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/1220 (47%), Positives = 739/1220 (60%), Gaps = 161/1220 (13%)

Query: 13   PPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQT 72
            PPF+ G+R QLT LV I+AL SLIILA TTGVYFTSNY+ LR+DRL++AA+L SSQ+DQ+
Sbjct: 15   PPFKAGLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLRADRLHVAARLMSSQVDQS 74

Query: 73   LNXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNLFYVAKVYDSS 132
            L           ++D +Q++L+ + AGN+SA+NW+++  ++  FL  S  FY+A +YD  
Sbjct: 75   LTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFYIAYLYDEM 134

Query: 133  FTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNNTDYLMSMSLP 192
            +  VL+  NN T   + E+ L  L PL  D    +      + T P  N T  LMSM+LP
Sbjct: 135  YQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLPY-NKTLNLMSMTLP 193

Query: 193  IFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYNNQGKASGYHF 252
            + A  S I+    V G++TI+MSA+ + +V NDT+ L +S V+I++ + N++G    Y F
Sbjct: 194  VEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTGIPNDKGNLVKYRF 250

Query: 253  IFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSF--------GIKNLALGYS 304
            +FPP  T  ++T++ + IKN +F+  AF N     +  T+SF          K +A+GYS
Sbjct: 251  VFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGHDFKKVAVGYS 310

Query: 305  PCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRL 364
             C F+ ++WVAVVSQ ESVFLSPA KL KII GTV+ + VF+ ++T  LA WAV+PIVRL
Sbjct: 311  ACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILASWAVKPIVRL 370

Query: 365  QKATELITEGRGLRP--STPRTVSRASSFKRG--FGSGFTVPSSLLQFNTGEXXXXXXXX 420
            QKATE I  GRGLR    + R+ S+ +S  R    GS  ++P  L +             
Sbjct: 371  QKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSLPRELFE------------- 417

Query: 421  XXXXXXXXXXXXXXXESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHDLLA 480
                                         + P   E    N+ + + +S     +H+   
Sbjct: 418  -------------------------KKHHVSPFVTENHAANSGSCSSMS-----DHERYL 447

Query: 481  PNSLRNNDTDRSSNRSHIL-------TTSANLTEARLPDYRRLFSDELSDLTETFNTMTD 533
             +  R +D + S+N   IL       T++ N  + R+P YRRLF+DELS+LT+TFNTMTD
Sbjct: 448  HHIARYHDGETSTN---ILSDHEKGSTSATNWIDTRVPVYRRLFTDELSELTDTFNTMTD 504

Query: 534  ALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISM 593
             LD+ Y +LEDRVRARTKQL             KTVFIANI HELRTPLNGILGMTAI+M
Sbjct: 505  ELDRQYVVLEDRVRARTKQLEAAKIQAEAANEAKTVFIANIFHELRTPLNGILGMTAIAM 564

Query: 594  EETDVNKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIF 653
             E D  KI+NSLKLIFRSG            FSKNVL+RTKLE+R F I D+ALQ+KSIF
Sbjct: 565  AEQDQEKIQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEERHFSIIDIALQVKSIF 624

Query: 654  GKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLL 713
            GK+AKDQ V+LSI L PN IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDG VDVR+KL+
Sbjct: 625  GKLAKDQHVKLSIYLMPNAIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLV 684

Query: 714  GEYDKDLSEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRD 773
            GEYD   SE   F EV++  GTE+T  S      +IP      +    E  T   T  R 
Sbjct: 685  GEYDSARSEACNFSEVYILPGTEVTNSSVN----NIPTVVEEEEKACEEEPTADDTPER- 739

Query: 774  TSIIQEEITKRNTAANENIYKRMNDAEKLXXXXXXXXXXXXXXXXXXAIFNSQFNKAPG- 832
                                 +  D+E +                  A+ ++Q  K P  
Sbjct: 740  ---------------------KKKDSETVDDADAISISSSVATSYDDAVLHAQLKKIPTF 778

Query: 833  ---SDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGG 889
                D D    + K +E P++WVI IEV+DTGPGI+PSL ESVF PFVQGDQTLSRQYGG
Sbjct: 779  IDLEDSDNNVTMSK-LEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGG 837

Query: 890  TGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPES 949
            TGLGLSICRQLA MM GTM+LESKVG GSKFTFT+PL QT  + F + D  FEDEFN  S
Sbjct: 838  TGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFS 897

Query: 950  RKNRRVKFNVAKSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKRE 1009
            +KNR+VKF + +S KSR+                                +  NS     
Sbjct: 898  KKNRKVKFQLNRSGKSRKG-------------------------------KMNNS----- 921

Query: 1010 GVNGIGRIEQKLQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGSVNLDRPFLQSTGT 1069
              NG G I +   E        F  +ES             E S GSV +DRPFLQSTGT
Sbjct: 922  --NGAGSIAESAIES-------FGKSES-------------EASFGSVRVDRPFLQSTGT 959

Query: 1070 ATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKV 1129
            ATS+R+VPT+      ++S++ILV EDN+VNQEVIKRML+LEG  NI+LACDG++A+ KV
Sbjct: 960  ATSTRSVPTLS---SAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKV 1016

Query: 1130 KELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESG 1189
              L  +G +Y++IFMDVQMP++DGLL+TK++R+ L Y+ PIVALTAFADDSNIKECLESG
Sbjct: 1017 SALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESG 1076

Query: 1190 MNGFLSKPIKRPKLKTILTE 1209
            MN FL+KPIKRP LK IL E
Sbjct: 1077 MNSFLAKPIKRPMLKKILLE 1096

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
           YIL147C (SLN1) - histidine kinase osmosensor that
           regulates an osmosensing MAP kinase cascade and is
           similar to bacterial two-component regulators [contig
           159] FULL
          Length = 1143

 Score =  979 bits (2532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/970 (52%), Positives = 654/970 (67%), Gaps = 76/970 (7%)

Query: 14  PFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQTL 73
           P  + IR QLTALV +VAL+SLIILAV TGVYFTS++K+LR++RL++AAQLKSSQIDQ L
Sbjct: 20  PLVVSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLRAERLHVAAQLKSSQIDQNL 79

Query: 74  NXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNLFYVAKVYDSSF 133
           N          +RD LQ++LT ++AGN S +NW D+ + + KFL SSNLF +A+VYDSSF
Sbjct: 80  NYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLARVYDSSF 139

Query: 134 TTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNNTDYLMSMSLPI 193
             VLN +NNG+G+LIPE++L  LFPLSTD  LPSSLE TG+LTDPV+N + YLMSMSLPI
Sbjct: 140 QDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYLMSMSLPI 199

Query: 194 FANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYNNQGKASGYHFI 253
           FANPSIIL+ ++VYGYIT+++SAEGLKSV+NDTTAL+ S+V I+S +Y++  + +GYH +
Sbjct: 200 FANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDDH-ELAGYHLV 258

Query: 254 FPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLALGYSPCSFQLVNW 313
           FPPY     +    + I+N +F+  A ++GKGGS+K T  F  K +A+GYSPC+  L  W
Sbjct: 259 FPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSPCNSTLAQW 318

Query: 314 VAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELITE 373
           VA+++QPE++FLSP+T+LAKII GT IAI V   ++T PL+HWAVQPIVRLQKATE+IT 
Sbjct: 319 VAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQKATEIITA 378

Query: 374 GRGLRPSTPRTV------SRASSFKRGFGSGFTVPSSLLQFNTGEXXXXXXXXXXXXXXX 427
           GRGLR     T+      S A SF   FG+G    S                        
Sbjct: 379 GRGLRSDNSSTLFSHKRTSTAESFSSIFGTGSVRRSG----------------------- 415

Query: 428 XXXXXXXXESSMKSAINLGNEKLLPSEDEKKIP-NNNTDAKVSMDGSLNHDLL------- 479
                        S    G +K +P +  K++P  N++DA   ++     D+        
Sbjct: 416 -------------SVARAGRDKYIP-DSSKEVPRGNSSDAIHEVNQENIEDIEMQKVNSP 461

Query: 480 APNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHY 539
            P S+ N      S R     TS NL EAR+P Y+RLFSDELS+LTETFNTMTD LD+HY
Sbjct: 462 TPYSMMNESQAVKSER---YITSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHY 518

Query: 540 ALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVN 599
           ALLEDRVRART+QL             KTVFIANISHELRTPLNGILGMTAI+M E D  
Sbjct: 519 ALLEDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTA 578

Query: 600 KIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKD 659
           K+++SLKLIFRSG            FSKNVL+RTKLE+RDF I D+ALQ++SIFGK+AKD
Sbjct: 579 KVKSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKD 638

Query: 660 QRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKD 719
           Q V L+IS+ PNL+R+MVLWGDSNRI+QIVMNLVSNALKFTPVDG VDV+ +LLGEYD++
Sbjct: 639 QHVNLTISILPNLLRSMVLWGDSNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEE 698

Query: 720 LSEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRDTSIIQE 779
            S+  ++KEV V   TE       T+  +     N    VD ++   S+ S        E
Sbjct: 699 KSKASEYKEVFVLPPTE-----SRTSSTEAKDEKNAESCVDSDTNVLSLPST------AE 747

Query: 780 EITKRNTAANENIYKRMNDAEKLXXXX-------XXXXXXXXXXXXXXAIFNSQFNKAPG 832
              ++N    +       D+E +                         AIF ++  K   
Sbjct: 748 STDEKNVKIGQRSESEAIDSEAIESSDEDDENEDTKSIGSGNTSSYDDAIFQTRLRKDSS 807

Query: 833 SDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGL 892
           ++E+E G   + +E+PK WVIS+EV DTGPGIDP+L ESVF PFVQGDQTLSRQYGGTGL
Sbjct: 808 NEENEEG---RALESPKKWVISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGL 864

Query: 893 GLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPESRKN 952
           GLSICRQLA MM+GTM+L+S+VGVGSKF+FT+PL QTKE+ F +++ PFEDEFNP+S+KN
Sbjct: 865 GLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLTQTKELLFEDVENPFEDEFNPDSKKN 924

Query: 953 RRVKFNVAKS 962
           R+VKF + KS
Sbjct: 925 RKVKFRMGKS 934

 Score =  239 bits (609), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 135/161 (83%), Gaps = 4/161 (2%)

Query: 1051 EESLGSVNLDRPFLQSTGTATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNL 1110
            E S+GSV +DRPFLQSTGTA S+  V T    D+     KILV EDN+VNQEVIKRMLNL
Sbjct: 970  EVSVGSVRVDRPFLQSTGTALSTTLVTTSSLADRR----KILVAEDNNVNQEVIKRMLNL 1025

Query: 1111 EGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPI 1170
            EG+E++ELACDGQ+AFDKVK   + G +Y++IFMDVQMP+VDGL +T+MIR++LGY  PI
Sbjct: 1026 EGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELGYSHPI 1085

Query: 1171 VALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFC 1211
            VALTAFADDSNIKECL++GMNGFLSKPIKRPK+K IL E+C
Sbjct: 1086 VALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYC 1126

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1068

 Score =  922 bits (2384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/1221 (44%), Positives = 722/1221 (59%), Gaps = 178/1221 (14%)

Query: 3    LRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAA 62
            LRL +    +PP+ + +RAQL  L  IV+++SL+IL+++TGVYFT+NYK+LR+++L+IAA
Sbjct: 6    LRLAT----SPPYPMNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFIAA 61

Query: 63   QLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNL 122
            QLKSSQ+DQ+LN            D L  +L  + +GNK+ +NWV+S+S V  FL+SS++
Sbjct: 62   QLKSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSI 121

Query: 123  FYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNN 182
            F  A +YD++F  + N +NNGTG  IP+D++  L PLS+D  LP+S+ T G LTDPV+N 
Sbjct: 122  FSRATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNT 181

Query: 183  TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALY- 241
            ++YLMS+SLPIF NPSIIL+DSRVYGY+TII  A  + +VFNDTTALE SNVAIISA Y 
Sbjct: 182  SNYLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYR 241

Query: 242  NNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLAL 301
            N+   A GYHF+FPPYG+ +++    + + NN+F+  AF     GS+  T  F    +A+
Sbjct: 242  NSTTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAV 301

Query: 302  GYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPI 361
            GYS C+F L NWVAVVSQPESVF S   KL KII+GTV+ I   V  +T  ++++ V+PI
Sbjct: 302  GYSTCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPI 361

Query: 362  VRLQKATELITEGRGLRPSTPRTVSRASSFKRGFGSGFTVPSSLLQFNTGEXXXXXXXXX 421
            ++L++ATELI+ GRGLRP       R S                 Q NT           
Sbjct: 362  IKLKQATELISRGRGLRPYYENLSDRTS-----------------QDNT----------- 393

Query: 422  XXXXXXXXXXXXXXESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHDLLAP 481
                            S ++ I+L +     +E EK +P    D +     SL++  +A 
Sbjct: 394  ----------------STRTTIDLSDLDGYTNEKEKSLPTCTEDER---SKSLSN--IAS 432

Query: 482  NSLRNNDTDRS----SNRSHILT-TSANLT------EARLPDYRRLFSDELSDLTETFNT 530
             S+    T R     S+RS +L+ TS N          R+P +    +DEL++L ETFN 
Sbjct: 433  KSIFT--TLRKILGFSSRSGMLSPTSTNFIVNNDTKTVRVPVHSTYITDELTELKETFNI 490

Query: 531  MTDALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTA 590
            M D+LD+H  LLE+RV+ARTK+L             KTVFIANISHELRTPLNGILGMTA
Sbjct: 491  MADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKTVFIANISHELRTPLNGILGMTA 550

Query: 591  ISMEETDVNKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIK 650
            I++EE D  K++ SLKLI+RSG            FSKNVLQ+TKLEK  FCI D+ALQIK
Sbjct: 551  IALEEDDNEKLQGSLKLIYRSGELLLHILTELLTFSKNVLQKTKLEKIHFCIHDIALQIK 610

Query: 651  SIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRM 710
            SIFGK+AKDQ V  SI + PNLIRTMV +GDSNRIIQ++MNLVSNALKFTP+DG VDVR+
Sbjct: 611  SIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQVIMNLVSNALKFTPIDGNVDVRI 670

Query: 711  KLLGEYDKDLSEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITS 770
            KLLGEYD++ S    + +V++K GT  T                    +  E  +  I+ 
Sbjct: 671  KLLGEYDEEKSSLNNYDKVYIKEGTSFT---------------GDNDAIPTEPISDKISF 715

Query: 771  NRDTSIIQEEITKRNTAANENIYKRMNDAEKLXXXXXXXXXXXXXXXXXXAIFNSQF-NK 829
               +S I +  +K  T  N+NI   +   +                     I  S + NK
Sbjct: 716  AGGSSSIHDYCSK--TDENDNIKTEIKSDDS-----------TISDYSEENIMGSYYENK 762

Query: 830  APGSDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGG 889
             PG +      LG PI  PK WVIS++VEDTGPGI P+LQ+SVF PFVQGDQTLSRQYGG
Sbjct: 763  NPGQEL-----LGVPIPKPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGG 817

Query: 890  TGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPES 949
            TGLGLSICRQLA++M+GTM L+S  G+GSKFTFT+PL Q ++I F+  +  FEDEFN  S
Sbjct: 818  TGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNS 877

Query: 950  RKNRRVKFNVAKSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKRE 1009
            +KNR+V F   K + SR   S  A                                 K +
Sbjct: 878  KKNRKVNFKTDK-VTSRGIPSKAAE--------------------------------KND 904

Query: 1010 GVNGIGRIEQKLQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGSVNLDRPFLQSTGT 1069
              N  G+     + K+               KT+ P H +  E     N+D+   +    
Sbjct: 905  DANTNGQTTLNAEAKS---------------KTLKPTHITISED----NIDQHDFK---- 941

Query: 1070 ATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKV 1129
                  V  ++DN  N   IK L               L LE I+ IE A DGQEA D V
Sbjct: 942  ------VLIVEDNMVNQEVIKRL---------------LKLEKIKTIEYAVDGQEAIDIV 980

Query: 1130 KELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESG 1189
            K+  S+   +++IFMD+QMP VDG  +T++IR +L Y  PIVALTAFADDSN KEC  SG
Sbjct: 981  KKKISEKDKFDIIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSG 1040

Query: 1190 MNGFLSKPIKRPKLKTILTEF 1210
            MN FL+KPIKR +LK I+ EF
Sbjct: 1041 MNAFLAKPIKRFELKEIIKEF 1061

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar to
            uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score =  803 bits (2074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/783 (58%), Positives = 529/783 (67%), Gaps = 60/783 (7%)

Query: 464  TDAKVSMDGSLNHDL-LAPNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELS 522
            +D+  + DGSL+HDL  +  S R +D DRSS+RS  LTTS NL EARLPDYRRLFSDELS
Sbjct: 426  SDSNYATDGSLSHDLQTSQASNRPSDNDRSSSRSRFLTTSTNLNEARLPDYRRLFSDELS 485

Query: 523  DLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPL 582
            DLT TFN MTDALDQHYALLEDRVRARTKQL             KTVFIANISHELRTPL
Sbjct: 486  DLTNTFNAMTDALDQHYALLEDRVRARTKQLEAAKIQAEAANEAKTVFIANISHELRTPL 545

Query: 583  NGILGMTAISMEETDVNKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCI 642
            NGILGMTAISMEETD+ KIRNSLKLIFRSG            FSKNVL+RT LEKR+FCI
Sbjct: 546  NGILGMTAISMEETDIAKIRNSLKLIFRSGELLLHILTELLTFSKNVLKRTALEKRNFCI 605

Query: 643  TDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPV 702
            TDVALQIKSIFGKVAKDQ VRLSISL PN+IRTMVLWGDSNRIIQIVMNLVSNALKFTPV
Sbjct: 606  TDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIVMNLVSNALKFTPV 665

Query: 703  DGTVDVRMKLLGEYDKDLSEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLE 762
            DG V+VR+KLLGEYD++ ++   FK++H                  I  S  H++H    
Sbjct: 666  DGKVNVRIKLLGEYDEEATKADNFKQIHT-----------------IADSDAHQQHPVSS 708

Query: 763  STTTSITSNRDTSIIQEEITKRNTAANENIYKRMNDAEKLXXXXXXXXXXXXXXXXXX-- 820
            S    +  +  TS         +   NE  Y   +D   +                    
Sbjct: 709  SPNGVLVKHLSTSSDSNSNLSDSDKYNEKTYDEDDDEHSITNISDHSDDLSSLVSSSTSS 768

Query: 821  ---AIFNSQFNKAPGSDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFV 877
               A+FN+QF K P   ED    LG  + + KTWV +IEVEDTGPGIDP L ESVF PFV
Sbjct: 769  YDNALFNTQFKKTPDLYEDSNDGLGTELADQKTWVFAIEVEDTGPGIDPKLHESVFEPFV 828

Query: 878  QGDQTLSRQYGGTGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANM 937
            QGDQTLSRQYGGTGLGLSICRQLA MM+GTM+LESKVGVGSKFTFT+PL QT+ I F   
Sbjct: 829  QGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTRVIKFDEE 888

Query: 938  DFPFEDEFNPESRKNRRVKF-NVAKSIKSRQSTSSIATPATNRSSLINDVLPEIGSK--N 994
            +  FEDEFNPES+KNRRVKF +  +S+ SR+S +S+    TN S          G K  +
Sbjct: 889  EDLFEDEFNPESKKNRRVKFKDSTRSLHSRRSRTSVDR-ITNHS----------GDKQSS 937

Query: 995  ENQIKRFENSNMKREGVNGIGRIEQKLQEKNVKPFICFSSAESSEKKTVPPKHRSREESL 1054
            E     F+ S +K E       IEQ  +  N+      + +++S   +     + +EE  
Sbjct: 938  EGHSTSFKISEVKDED------IEQSPEPDNLPKVGDENDSKASSSSSKSDNIKEKEE-- 989

Query: 1055 GSVNLDRPFLQSTGTATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIE 1114
              V+LDRPFLQSTGTATSSRNVPT+ D        KILV EDNHVNQEVIKRMLNLEGI 
Sbjct: 990  -KVHLDRPFLQSTGTATSSRNVPTMAD---VTMRFKILVAEDNHVNQEVIKRMLNLEGIN 1045

Query: 1115 NIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALT 1174
            NI+LACDGQ+AFDKV+ L  +  +Y+MIFMD+QMPKVDGLLSTKMIRRDL YK  IVALT
Sbjct: 1046 NIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALT 1105

Query: 1175 AFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAY-----------QGKKITSEE 1223
            AFADDSNIKEC+E+GMNGFLSKPIKRPKLK IL E+C  +             KK+   +
Sbjct: 1106 AFADDSNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNWIEMKKSKENKDGDKKVEENK 1165

Query: 1224 PKK 1226
            PKK
Sbjct: 1166 PKK 1168

 Score =  541 bits (1395), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 258/375 (68%), Positives = 305/375 (81%), Gaps = 1/375 (0%)

Query: 6   PSKSEF-TPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAAQL 64
           P +  F  PPFRIGIRAQLTALVSIVA +SLIILAVTTGVYFTSNYKNLRSDRLYIAAQL
Sbjct: 8   PRRRRFLKPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQL 67

Query: 65  KSSQIDQTLNXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNLFY 124
           KSSQ+DQ LN          SRD LQ++L S+VAGNK+ +NW +S +V+QKFLSSSNLF+
Sbjct: 68  KSSQLDQNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFLSSSNLFF 127

Query: 125 VAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNNTD 184
           +++VYD  F  VLN TNNGTGD +PE + + LFPLSTD PLPSSL T G+LTDPV+N TD
Sbjct: 128 LSRVYDYDFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTD 187

Query: 185 YLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYNNQ 244
           YLMSMSLPIFANPSII +D +VYGYIT++MSAEGL+SVFNDTTALEKSNVAI+SA Y+N 
Sbjct: 188 YLMSMSLPIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNY 247

Query: 245 GKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLALGYS 304
            K   Y F+FPPYG + ++    F + +++F++ AF+  KGGS+K+T  F  K++A+GY 
Sbjct: 248 TKIDSYRFVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYY 307

Query: 305 PCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRL 364
           PCSF  VNWVAVVSQ ESVFLSP+TKL KII+GTV+ I VFV LLT PLA WAV+PIVRL
Sbjct: 308 PCSFNFVNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRL 367

Query: 365 QKATELITEGRGLRP 379
           QKATELI EGRGLRP
Sbjct: 368 QKATELIAEGRGLRP 382

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1177

 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/735 (54%), Positives = 510/735 (69%), Gaps = 47/735 (6%)

Query: 7   SKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKS 66
           +K +  PPF I IR QLTALV +VAL+SLIILAV TGVYFTS++K++R++RLY+A+QLK+
Sbjct: 13  AKRKLKPPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMRAERLYVASQLKA 72

Query: 67  SQIDQTLNXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNLFYVA 126
           SQIDQ L           +RD LQ++LT ++AGN + +NW D+++ + KFL SSNLF +A
Sbjct: 73  SQIDQNLYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLA 132

Query: 127 KVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNNTDYL 186
           +VYDSSF  VLNA+NN +G+L+PE VL  LFPLST+  LPSSLE  G+LTDPV+N+T YL
Sbjct: 133 RVYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYL 192

Query: 187 MSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYNNQGK 246
           MSMSLPIFANPSIIL+ S+VYGYIT+++SAEGLK+VFNDTTALE S+V ++S +Y+N+ +
Sbjct: 193 MSMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDNR-E 251

Query: 247 ASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLALGYSPC 306
            +GYH +FPPYG  S +    ++I N++F+  AF+  KGGS+K T+    K +A+GYSPC
Sbjct: 252 LAGYHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPC 311

Query: 307 SFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQK 366
           S  LV WVA+++QPES FL P+T+LA+II GT +AI V    +T PL+HWAVQPIVRLQK
Sbjct: 312 SSDLVQWVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSHWAVQPIVRLQK 371

Query: 367 ATELITEGRGLRPSTPRTV--SRASSFKRGFGSGFTVPSSLLQFNTGEXXXXXXXXXXXX 424
           ATE+IT GRGLR     T+   + SS    F S    P+S+ +                 
Sbjct: 372 ATEIITAGRGLRSDNGSTLYSHKRSSTAESFSSALH-PASIRRSG--------------- 415

Query: 425 XXXXXXXXXXXESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHDLLA---- 480
                           S       K +P E  K   N N   ++  DG  N++  A    
Sbjct: 416 ----------------SVARSSKHKYIP-ESAKGTLNKNDFEEIQPDGIENNEDAALQKV 458

Query: 481 ----PNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALD 536
               P SL    +++ S RS    TS NL EAR+P Y RLFSDELS+LTETFNTMTD LD
Sbjct: 459 HSPTPGSLF---SEQRSARSERYITSTNLIEARVPTYNRLFSDELSELTETFNTMTDELD 515

Query: 537 QHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEET 596
           +HYALLEDRVRART+QL             KTVFIANISHELRTPLNGILGMTAI+M E 
Sbjct: 516 RHYALLEDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEN 575

Query: 597 DVNKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKV 656
           D+ K+++SLKLIFRSG            FSKNVL+RTKLE+RDF + ++ALQ++SIFGK+
Sbjct: 576 DMQKVKSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKL 635

Query: 657 AKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEY 716
           AKDQ V L+IS+ PN++RTMVLWGDSNRI+QIVMNLVSNALKFTPVDG V+V+  LLGEY
Sbjct: 636 AKDQHVNLTISIIPNVLRTMVLWGDSNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEY 695

Query: 717 DKDLSEKKQFKEVHV 731
           D+  +    F    V
Sbjct: 696 DESKASNGCFDRAAV 710

 Score =  233 bits (595), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 142/186 (76%), Gaps = 8/186 (4%)

Query: 1045 PKHRSREESLGSVNLDRPFLQSTGTATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVI 1104
            P     E S+GSV +DRPFLQSTGTA S+R+V T    +K     K+LV EDN+VNQEVI
Sbjct: 997  PTVSESEVSVGSVRVDRPFLQSTGTALSTRSVTTTSVANK----CKVLVAEDNNVNQEVI 1052

Query: 1105 KRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDL 1164
            KRMLNLEG+++++LACDGQ+AFDKVK     G  Y++IFMDVQMP+VDGL +T+MIR +L
Sbjct: 1053 KRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNEL 1112

Query: 1165 GYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQGKKITSEEP 1224
             Y  PIVALTA+ADD NIKEC+++GMNGFL+KPI+RPK+K IL+E+C  Y      ++  
Sbjct: 1113 SYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEYCPTY----FKADGE 1168

Query: 1225 KKAKTE 1230
            KK KTE
Sbjct: 1169 KKGKTE 1174

 Score =  209 bits (531), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 118/142 (83%), Gaps = 6/142 (4%)

Query: 821 AIFNSQFNKA-PGSDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQG 879
           AIF+S+  K   G +ED     G+P+E+P+   I++EV+DTGPGI+P+LQESVF PFVQG
Sbjct: 840 AIFHSRLRKGNSGENED-----GRPLEHPRRLAIAMEVQDTGPGIEPALQESVFEPFVQG 894

Query: 880 DQTLSRQYGGTGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDF 939
           DQTLSRQYGGTGLGLSICRQLA MMNG+M L+SKVGVGSKFTFT+PL QTKE+ F   + 
Sbjct: 895 DQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKELCFEEDEN 954

Query: 940 PFEDEFNPESRKNRRVKFNVAK 961
           PFEDEFNP+S+KNR+VKF V+K
Sbjct: 955 PFEDEFNPDSKKNRKVKFKVSK 976

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
            (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score =  728 bits (1879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/716 (56%), Positives = 474/716 (66%), Gaps = 72/716 (10%)

Query: 501  TSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXXX 560
            T++NL +AR+P Y R   DELS+LT+TFN MT+ALDQHY LLEDRVRARTKQL       
Sbjct: 456  TTSNLVQARVPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLEAAKIEA 515

Query: 561  XXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGXXXXXXXX 620
                  KTVFIANISHELRTPLNGILGMTAISMEE D +KI+ +LKLIFRSG        
Sbjct: 516  EAANEAKTVFIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGELLLHILT 575

Query: 621  XXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWG 680
                FSKNVL+RT LEKRDFCIT++ALQIKSIFGKVA+DQ V+L I L PN IR+MVLWG
Sbjct: 576  ELLTFSKNVLKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWG 635

Query: 681  DSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDLSEKKQFKEVHVKRGTEI--- 737
            DSNRIIQIVMNLVSNALKFTP+DG VDVR+KLLGEYD++ S    +KEV++K GTE+   
Sbjct: 636  DSNRIIQIVMNLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIG 695

Query: 738  -TEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRDTSIIQEEITKRNTAANENIYKRM 796
              + ++   K    +S       D  S+ + ++ +     + E+  K + + NE+     
Sbjct: 696  NGKKTDMVRKKIQELSEKDCIEGDTASSGSHMSGSSKIDKLIEDEEKNSFSDNEDT---N 752

Query: 797  NDAEKLXXXXXXXXXXXXXXXXXXAIFNSQFNKAPGSDEDEGGNLGKPIENPKTWVISIE 856
            ND E L                  A    QF K P  D+ E   LG  +  PKTWVIS+E
Sbjct: 753  NDIEIL------SMTTSSTRSYDDAALQRQFKKTPDLDDKE-ETLGVELSEPKTWVISVE 805

Query: 857  VEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMRLESKVGV 916
            VEDTGPGI+P LQE+VF PFVQGDQ LSRQYGGTGLGLSICRQLA MM+GTM+LES VGV
Sbjct: 806  VEDTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGV 865

Query: 917  GSKFTFTLPLPQTKEISFANMDFPFEDEFNPESRKNRRVKFNVAKSIKSRQSTSSIATPA 976
            GSKF FT+PL QT+EI F   D  FEDEFN ES+KNRR+KF +  S KS  S        
Sbjct: 866  GSKFIFTVPLKQTREIHFD--DEKFEDEFNAESKKNRRIKFKIYDSSKSHDSNDE----- 918

Query: 977  TNRSSLINDVLPEIGSKNENQIKRFENSNMKREGVNGIGRIEQKLQEKNVKPFICFSSAE 1036
                        E G K+   I   ++SN + +  NG                       
Sbjct: 919  -----------DEEGIKSSRDI---DSSNNEHKDENG----------------------- 941

Query: 1037 SSEKKTVPPKHRSREESLGSVNLDRPFLQSTGTATSSRNVPT-IQDNDKN-DTSIKILVV 1094
                 T P  H         V LDRPFLQSTGTATSS+ +PT I   D N + SI+ILV 
Sbjct: 942  -----TSPDNH-------SKVRLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVA 989

Query: 1095 EDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGL 1154
            EDNHVNQEVIKRMLNLE I+NI+LACDGQ+AFDKVK L      Y++IFMDVQMPKVDGL
Sbjct: 990  EDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGL 1049

Query: 1155 LSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1210
            +STKMIR+DL YK PIVALTAFA+D NIKECL++GM+GFL KPIKRPKLK IL E+
Sbjct: 1050 VSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105

 Score =  501 bits (1289), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 245/380 (64%), Positives = 304/380 (80%), Gaps = 3/380 (0%)

Query: 3   LRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAA 62
           +R   +  F PP+RI IRAQLTALVS+VA++SLIILAVTTGVYFT NYK LRS RL IAA
Sbjct: 1   MRQSWRKAFKPPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAA 60

Query: 63  QLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNL 122
           +LKSSQIDQTLN          SRD LQ++L ++ AGNK+ +NW++S +VVQKFLSSS+L
Sbjct: 61  KLKSSQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDL 120

Query: 123 FYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNN 182
           FYVA++YD +F  V+NATNNGTGDLIP +VL  LFPLST+  LPSSL   GILTDPV+N 
Sbjct: 121 FYVARLYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNG 180

Query: 183 TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYN 242
           + YLMSMSLPI  NPSIIL+ SRVYGYITI+MSA+GLK+V+ + TALE SNV +ISA+YN
Sbjct: 181 SIYLMSMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYN 240

Query: 243 NQGKASGYHFIFPPYGTA-STLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLAL 301
           +QGK  G+HF+F       STL +  + I+N T++SSA   GK GS+K+T     + LA+
Sbjct: 241 DQGKVDGFHFVFEVENDDFSTLIE--YPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAI 298

Query: 302 GYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPI 361
           GYSPCSF L NWVA+V+QPE+VFLSP+TKL KII+GTV+AI VFV L+T PL+HWAV+PI
Sbjct: 299 GYSPCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPI 358

Query: 362 VRLQKATELITEGRGLRPST 381
           VRLQKATELI++GRGL+P++
Sbjct: 359 VRLQKATELISQGRGLKPTS 378

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
            YIL147C
          Length = 1214

 Score =  720 bits (1858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/768 (53%), Positives = 489/768 (63%), Gaps = 93/768 (12%)

Query: 503  ANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXXXXX 562
            + + E ++P YRRLF DELS+LT+TFNTM+DALDQHYALLE+RVRARTKQL         
Sbjct: 472  STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLEAAKIEAEA 531

Query: 563  XXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGXXXXXXXXXX 622
                KTVFIANISHELRTPLNGILGMTAISMEE D++ I++SLKLIFRSG          
Sbjct: 532  ANEAKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGELLLHILTEL 591

Query: 623  XXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDS 682
              FSKNVLQRTKLE+RDFCITDVALQIKSIFGKVAKDQ V+LSI L PN IRT+VLWGDS
Sbjct: 592  LTFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651

Query: 683  NRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDLSEKKQFKEVHVKRGTEITE-YS 741
            NRIIQIVMNLVSNALKFTP+DG V VRM LLGEYDK+ S+   +KEV VK GTE  E YS
Sbjct: 652  NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYS 711

Query: 742  EETNKCDIP--ISSNHRKHVDLESTTTSITSNRDTSIIQEEITKRNTAANENIYKRMNDA 799
            +   K +    I++   +  D E     +   ++  II       NT  + +I+ R  D 
Sbjct: 712  KILQKLNTEKLIATRSARSCDNEERHNELIGEKN-DIISNNHQSSNTTFDISIHNRTRD- 769

Query: 800  EKLXXXXXXXXXXXXXXXXXXAIFNSQFNKAPGSDEDEGGNLGKPIENPKTWVISIEVED 859
                                  +FN QF K  G  + +   LG  I+ PKTWVI IEVED
Sbjct: 770  ------DTLSLLSTSTSSYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVED 823

Query: 860  TGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMRLESKVGVGSK 919
            TGPGI P+LQESVF PFVQGDQ LSRQYGGTGLGLSICRQLA MMNGTM LESKVG GSK
Sbjct: 824  TGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSK 883

Query: 920  FTFTLPLPQTKEISFA---NMDFPFEDEFNPESRKNRRVKFNVAKSIKSRQSTSSIATPA 976
            FTFT+PL QT+EI      +++  F+DEFN  S+KNR+VKF +  S  +  + SS+ +  
Sbjct: 884  FTFTVPLTQTREIVIGEDEDINEFFDDEFNIYSKKNRKVKFAIPSSPGTTLANSSLKSRK 943

Query: 977  TNRSSLINDVLPEIGSKNENQIKRFENSNMKREGVNGIGRIEQKLQEKNVKPFICFSSAE 1036
            + + SL +  + EI + NE +   + + ++   G   I  I                S  
Sbjct: 944  S-KGSLNSSFVGEIQNVNEAEEDAYNSKDINSSGELKIRHI----------------STS 986

Query: 1037 SSEKKTVPPKHRSREESLGSVNLDRPFLQSTGTATSSRNVPTIQD-----------ND-- 1083
            +S   ++P             +LDRPFLQSTGTATS+  +P ++D           ND  
Sbjct: 987  TSNNNSIP-------------SLDRPFLQSTGTATSTMKIPVLKDFSNSATKDNVTNDEG 1033

Query: 1084 KNDTSIK-------------------------------ILVVEDNHVNQEVIKRMLNLEG 1112
            K+D S K                               ILV EDNHVNQEVIKRML LE 
Sbjct: 1034 KSDLSKKGNSGGTIIQEGVTQNNSSIIIDEEEEDEGIRILVTEDNHVNQEVIKRMLKLEK 1093

Query: 1113 IENIELACDGQEAFDKVKELTS-----KGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYK 1167
            + NI+LACDG+EA+ KVKE+TS     K   Y++IFMDVQMP++DGL STK+IR +L Y 
Sbjct: 1094 LSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKYT 1153

Query: 1168 SPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQ 1215
             PIVALTAFAD+SNIKECL+ GM+GFLSKPIKRPKLK IL EFC  Y 
Sbjct: 1154 KPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDILNEFCPGYH 1201

 Score =  493 bits (1268), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 238/388 (61%), Positives = 299/388 (77%), Gaps = 1/388 (0%)

Query: 8   KSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67
           +S   PP  IGIR QLTALV  VA VSLIILAV TG+YFT NYK++R DRL IAA+LKSS
Sbjct: 8   RSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSS 67

Query: 68  QIDQTLNXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNLFYVAK 127
           Q+DQTLN           RD LQ+++ ++ AGNKS+  W DS  VV+KFLSSS++F +++
Sbjct: 68  QVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISR 127

Query: 128 VYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNNTDYLM 187
           +YD++F  V+NATNNGTG+++P DVL  L PLS+  PLP+SL ++G+LTDPV+N+T YLM
Sbjct: 128 LYDANFNLVMNATNNGTGNVVPNDVLAKLLPLSSSDPLPASLGSSGMLTDPVLNSTTYLM 187

Query: 188 SMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYNNQGKA 247
           SMSLPI ANPSIILTDS+VYGYITIIMSAE L SV+NDTTALEKSNVAI+S  Y++   +
Sbjct: 188 SMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSAS 247

Query: 248 -SGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLALGYSPC 306
            + YHF+FPPYG    +    + ++N +F+  A  N K GS+ +T  F   ++A+GYSPC
Sbjct: 248 LTEYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSPC 307

Query: 307 SFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQK 366
           SF LV+WVA+VSQPESVFLSP+TKL +II GTV+AI VFV  +T PL+HWAV+PIVRLQK
Sbjct: 308 SFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQK 367

Query: 367 ATELITEGRGLRPSTPRTVSRASSFKRG 394
           ATELI EGRGLR S+ RT+SR  S K G
Sbjct: 368 ATELIAEGRGLRSSSNRTLSRNGSLKFG 395

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1155

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/740 (53%), Positives = 483/740 (65%), Gaps = 73/740 (9%)

Query: 490  DRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRAR 549
            D SS  S     S NL EA +P YRR F DELS+LT+TFNTMTD LD+HYALLE+RVRAR
Sbjct: 476  DSSSYTSERYIKSTNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRAR 535

Query: 550  TKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIF 609
            TKQL             KTVFIANISHELRTPLNGILGMTAI+M ETD+ K++NSLKLIF
Sbjct: 536  TKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIF 595

Query: 610  RSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLF 669
            RSG            FSKNVL+RTKLE+RDF + D+ALQIKSIFGK+AKDQ V+LSI+L 
Sbjct: 596  RSGELLLHILTELLTFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALT 655

Query: 670  PNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDLSEKKQFKEV 729
            PN IRT+VLWGDSNRIIQIVMNLVSNALKFTPVDG VDVR+KLLGEYD   SE   ++EV
Sbjct: 656  PNFIRTLVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEV 715

Query: 730  HVKRGTEITEYSE----ETNKCDIPI-SSNHRKHVDLESTTTSITSNRDTSIIQEEITKR 784
             V  G+E  +  E     T    +P  SS+   +   +  +TS T+      IQ E ++ 
Sbjct: 716  FVVPGSEANDDFEFNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVE-SET 774

Query: 785  NTAANEN-----IYKRMNDAEKLXXXXXXXXXXXXXXXXXXAIFNSQFNKAPGS-DEDEG 838
            +T  N+N     + +  ++  +                   AIF+SQF K   S D D  
Sbjct: 775  STEGNDNDESSIVLESKHEENEDEKEKMSILSTSTSSSYDDAIFHSQFKKVLSSTDSDTE 834

Query: 839  GNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICR 898
             N  + ++ PKTWVIS+EVEDTG GIDPSLQESVF PFVQGDQTLSRQYGGTGLGLSICR
Sbjct: 835  ENTFRDLKVPKTWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICR 894

Query: 899  QLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPESRKNRRVKFN 958
            QLA MM GTM+L+SKVGVGSKF FT+PL QTKEI F   +  FEDEFN  SRKNR+VKF 
Sbjct: 895  QLAKMMKGTMKLDSKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFK 954

Query: 959  VAKSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKREGVNGIGRIE 1018
            +  S KS Q+  S ++               I   ++N +   + SN     V  + R++
Sbjct: 955  INSSRKSVQTKKSKSS---------------IDGHSDNNVSERKASNSTENSVGNV-RVD 998

Query: 1019 QKLQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGSVNLDRPFLQSTGTATSSRNVPT 1078
                    +PF                                  LQSTGTATS+R++ +
Sbjct: 999  --------RPF----------------------------------LQSTGTATSTRSISS 1016

Query: 1079 IQDNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGN 1138
            +       T  ++LV EDN+VNQEVIKRML LEG+ ++++ACDGQEA++KV+E+   G +
Sbjct: 1017 VA---SEVTRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGES 1073

Query: 1139 YNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPI 1198
            Y+MIFMDVQMP+VDGLL+TKMIR DL YK PIVALTA+ADDSNIK CLESGM+GFL KPI
Sbjct: 1074 YSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFLPKPI 1133

Query: 1199 KRPKLKTILTEFCAAYQGKK 1218
            KRP LK I+ ++C+  + ++
Sbjct: 1134 KRPLLKKIIAQYCSKKEKQR 1153

 Score =  459 bits (1182), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 220/371 (59%), Positives = 282/371 (76%)

Query: 8   KSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67
           +  FTPPF +G+R QL  LV  + ++SL I+ VTTGVYFT+NYK++R++RL +AAQLKSS
Sbjct: 15  RERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSS 74

Query: 68  QIDQTLNXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNLFYVAK 127
           Q+DQ LN          +RD LQ +L +F AGN S DNW  +   ++KFL SS LF  A+
Sbjct: 75  QVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAAR 134

Query: 128 VYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNNTDYLM 187
           VYD+SF TV+N+TNNG+GD IPE+VL  LFPLS   PL SSL TTGI+TDPV N T+YL+
Sbjct: 135 VYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLL 194

Query: 188 SMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYNNQGKA 247
           SMSLP+  NPSIIL  + + GYIT+I SAE LK+V NDT AL+KS+V+I+SA++++    
Sbjct: 195 SMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSL 254

Query: 248 SGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLALGYSPCS 307
           +GYHF+FPP+GT+S  ++  F IKN TFI+ AF NGK GS+ +TN    +N+A+GYSP +
Sbjct: 255 TGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPT 314

Query: 308 FQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKA 367
           F+LVNWVAVV+QPE VFLSP  +L KII GTV AI VF+ LLT P+AHWAVQPIVRLQKA
Sbjct: 315 FKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKA 374

Query: 368 TELITEGRGLR 378
           TE+IT GR L+
Sbjct: 375 TEIITSGRDLK 385

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
            similar to Ashbya gossypii AFR284W
          Length = 1125

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/722 (55%), Positives = 476/722 (65%), Gaps = 93/722 (12%)

Query: 493  SNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQ 552
            S R    TTSAN  E R+P YRRLFSDELS+LT+TFN+MTD LD+HYALLEDRVRARTKQ
Sbjct: 469  SERVDAFTTSANWIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQ 528

Query: 553  LXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSG 612
            L             KT+FIANISHELRTPLNGILGMTAI+M E D+ K++NSLKLIFRSG
Sbjct: 529  LEAAKIQAESANEAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSG 588

Query: 613  XXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNL 672
                        FSKN+L+R KLE+R+F + DVALQ+KSIFGK+AKDQ V+ SI L PNL
Sbjct: 589  ELLLHILTELLTFSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNL 648

Query: 673  IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDLSEKKQFKEVHVK 732
            IR MVLWGDSNRIIQIVMNLVSNALKFTPVDG V +R+KLLGEYD++ SEK    EV +K
Sbjct: 649  IRKMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIK 708

Query: 733  RGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRDTSIIQEEITKRNTAANENI 792
            +GTEI   S+ET      I+         EST  +I +       QE   K + A N ++
Sbjct: 709  QGTEI---SDETKNVFDTITEEKYVSCSGESTDDTIETG------QEGAQKPDKADNISV 759

Query: 793  YKRMNDAEKLXXXXXXXXXXXXXXXXXXAIFNSQFNKAPGS-DEDEG--GNLGKPIENPK 849
                                        AIF+S+F K P   D DEG   ++GK  E  K
Sbjct: 760  ------------------VSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKS-EKKK 800

Query: 850  TWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMR 909
             WVISIEVEDTGPGIDPSLQESVF PFVQGDQTLSRQYGGTGLGLSICRQL+ MM GTM+
Sbjct: 801  VWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMK 860

Query: 910  LESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPESRKNRRVKFNVAKSIKSRQST 969
            L S+VGVGSKF FT+PL QT  +   + +  FEDEFN +S+ NRRVKF + K  KSRQS+
Sbjct: 861  LHSEVGVGSKFIFTVPLRQTGTVEDLDDEDLFEDEFNAQSKINRRVKFKLNKGGKSRQSS 920

Query: 970  SSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKREGVNGIGRIEQKLQEKNVKPF 1029
             S+               PEI             S +    +N +GR E +L   +V+  
Sbjct: 921  LSV---------------PEI-------------SGVPDSPLNSMGRSESELSVSSVR-- 950

Query: 1030 ICFSSAESSEKKTVPPKHRSREESLGSVNLDRPFLQSTGTATSSRNVPTIQDNDKNDTSI 1089
                                         +DRPFLQSTGTATS+R++PT+   + N    
Sbjct: 951  -----------------------------VDRPFLQSTGTATSTRSIPTVGSLESN---F 978

Query: 1090 KILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMP 1149
            K+LV EDN+VNQEVIKRML LEGI +IELACDG+EA +KV  LT++  +YN++FMDVQMP
Sbjct: 979  KVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMP 1038

Query: 1150 KVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTE 1209
            K+DGL++T+ IR++L Y  PIVALTAFADDSNIK CLESGM+GFLSKPIKR KL+ IL E
Sbjct: 1039 KMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLE 1098

Query: 1210 FC 1211
            +C
Sbjct: 1099 YC 1100

 Score =  337 bits (865), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 187/371 (50%), Positives = 258/371 (69%), Gaps = 1/371 (0%)

Query: 8   KSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67
           K  F PP++ G+  QLT LV I+AL SLIILAVTTGVYFT+NYK+LR+DRL +AAQL S+
Sbjct: 20  KHMFRPPYKAGLSTQLTILVCIIALCSLIILAVTTGVYFTTNYKSLRADRLTVAAQLTSA 79

Query: 68  QIDQTLNXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNLFYVAK 127
           QI+QTLN          SRD++Q++L S+  GN S+ N  ++  V+ KFL SSN  +   
Sbjct: 80  QINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTH 139

Query: 128 VYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNNTDYLM 187
           +YDS+F  VL+ + N TG++I +D+L  L PLS+++PLPSS+   G+L++PV N + + M
Sbjct: 140 LYDSAFNEVLSVSTNSTGNIIGDDLLRDLLPLSSNSPLPSSIIDDGMLSNPVFNGSSFFM 199

Query: 188 SMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYNNQGKA 247
           SMSLP+ A  SI+   S   GYIT++MSA+ + SV     AL  S V++++ +Y+     
Sbjct: 200 SMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENNIL 259

Query: 248 SGYHFIFPP-YGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLALGYSPC 306
           + Y  +FPP       L + VF I NN+F+ +AF N   GS+ +TN+F   N+A+GY+ C
Sbjct: 260 NSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAAC 319

Query: 307 SFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQK 366
           SF+LVNWVAVV+Q E+VFLSP+TKL KII GTVI I  F+ ++T  +A+WAV+PIVRLQK
Sbjct: 320 SFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQK 379

Query: 367 ATELITEGRGL 377
           ATELI  GRGL
Sbjct: 380 ATELIAAGRGL 390

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
            (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/731 (46%), Positives = 447/731 (61%), Gaps = 126/731 (17%)

Query: 485  RNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLED 544
            + N TD SS+ S  +    NL + ++P  RR   DELS+LTET+  MTDALD+H  LLE 
Sbjct: 431  KENITDYSSSNSSAIVMRKNLADFQVPASRRFVKDELSELTETYKLMTDALDEHSQLLEY 490

Query: 545  RVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNS 604
            RV+ RTKQL             KTVFIAN++HELRTPLNGILGMTAI+MEETD+ +I++S
Sbjct: 491  RVKERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSS 550

Query: 605  LKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRL 664
            LKLI+RSG            FSKNVL++TKLEK  FC+ D+ALQI+SIFGK++KDQ V+L
Sbjct: 551  LKLIYRSGELLLHILTELLTFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKL 610

Query: 665  SISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDLSEKK 724
            SI + PN +R+MVLWGD NRI+Q++MNLVSNALKFTPVDG + V +KLLGEYDKD S  +
Sbjct: 611  SIFILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAE 670

Query: 725  QFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRDTSIIQEEITKR 784
             +K+V++K   EI              +SN  K   L     ++ S++DT  + + I+ +
Sbjct: 671  NYKDVYMK---EIR-------------NSNGDKIKPL----MTLISSKDTMSVADNISNK 710

Query: 785  NTAANENIYKRMNDAEKLXXXXXXXXXXXXXXXXXXAIFNSQFNKAPGSD-EDEGGNLGK 843
            + A+         D E+                    I++++F    GS+ +D    +G 
Sbjct: 711  SVAS---------DTER---------------STNNTIYSNKFKN--GSNFQDTDDAIGV 744

Query: 844  PIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANM 903
            P++  + WVIS+EVEDTGPGI+PSLQ+SVF PFVQGDQTLSRQYGGTGLGLSICRQLAN+
Sbjct: 745  PLDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANL 804

Query: 904  MNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPESRKNRRVKFNVAKSI 963
            M+GTM+LES+VGVGSKF FT+PL QT+EI F   +  FEDEFN  S+KNR VKF      
Sbjct: 805  MHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNELVFEDEFNINSKKNREVKF------ 858

Query: 964  KSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKREGVNGIGRIEQKLQE 1023
                                 ++  E+   N              EG +G+         
Sbjct: 859  --------------------QEITDEVDQVN-------------IEGNSGV--------- 876

Query: 1024 KNVKPFICFS---SAESSEKKTVPPKHRSREESLGSVNLDRPFLQSTGTATSSRNVPTIQ 1080
              V+P  C     S ES  +  VP K  S +E   S+  D            +  +  ++
Sbjct: 877  -EVEPGKCTEPKKSTESESQAVVPSK--SSQEMGNSIKYD----------VKNFKLLIVE 923

Query: 1081 DNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYN 1140
            DN  N               Q V+ RML LEGIEN  +ACDGQEA +K+KE+ S+G  Y 
Sbjct: 924  DNKVN---------------QLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYG 968

Query: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200
            ++ MD+QMPKVDG+ +TK+IR++L Y  PIVALTAFADDSNI+ C +SGM+GFL+KPIKR
Sbjct: 969  LVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKR 1028

Query: 1201 PKLKTILTEFC 1211
             +LK ILTEFC
Sbjct: 1029 EQLKGILTEFC 1039

 Score =  426 bits (1094), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 202/374 (54%), Positives = 271/374 (72%)

Query: 3   LRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAA 62
           LR  + S +  P+++ +R QLT LV  VA++SL+ILA++TGVYFT NY++LR  +LYIAA
Sbjct: 2   LRACNVSIWKAPYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIAA 61

Query: 63  QLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNL 122
           +LKSSQIDQT+N           RD ++S+LT + AGN+SA+NW  +  V+  FL SS +
Sbjct: 62  RLKSSQIDQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVV 121

Query: 123 FYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNN 182
           F    +YDS F  +LN TNN T D IP+DVL  L PLS    LPS L TTG+LTDPV+N+
Sbjct: 122 FLTTTLYDSQFNLILNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLND 181

Query: 183 TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYN 242
           + YLMSMSLPI ANPS+ L+DSRV+GY+T++MSAE +++V NDTTALEKS VA+IS+   
Sbjct: 182 STYLMSMSLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNT 241

Query: 243 NQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLALG 302
           N      YHF+FPP+G +  +  + + ++N+TF+S AF + +GGS+ ++ S   K +A+G
Sbjct: 242 NGTSGQEYHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIG 301

Query: 303 YSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIV 362
           Y PCSF L NWV  VSQPE VF+S + KL KII GTVIAI VFV ++T PL+ W+VQPIV
Sbjct: 302 YWPCSFGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIV 361

Query: 363 RLQKATELITEGRG 376
           RLQKATE+I++  G
Sbjct: 362 RLQKATEVISKRDG 375

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1259

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/392 (70%), Positives = 324/392 (82%), Gaps = 2/392 (0%)

Query: 3   LRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAA 62
           +++P K    PPFRIGIRAQLTALVSIVA VSL+ILA+TTGVYFT+NYKNLRSDRLYIAA
Sbjct: 1   MKIPDKFVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAA 60

Query: 63  QLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNL 122
           QLKSSQIDQTLN          SRD LQ +LT++VAGNKS +NW DS S++QKFLSSSNL
Sbjct: 61  QLKSSQIDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNL 120

Query: 123 FYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNN 182
           F VAKVYD+SFTTVLN TNNGTGD IP+ +L  L PLST+ PL SSLETTGILTDPV+N+
Sbjct: 121 FSVAKVYDASFTTVLNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNS 180

Query: 183 TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYN 242
           + YLMSMSLPIFANPS+IL +SRVYGY+T++MSAEGL++VFNDTTALEKSNVAI+SA+YN
Sbjct: 181 STYLMSMSLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYN 240

Query: 243 NQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLALG 302
           N    + Y F+F P G  S +  S + + N +F+SSA R GKGGSLK T  F  KN+A+G
Sbjct: 241 NVSALTAYRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIG 300

Query: 303 YSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIV 362
           YSPC+F  VNWVAVVSQ ESVFLSP+TKLAKII GTV+AIGVFV ++T PLAHWAV+PIV
Sbjct: 301 YSPCTFSFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIV 360

Query: 363 RLQKATELITEGRGLRPSTP--RTVSRASSFK 392
           RLQKATELI+EGRGL+ + P  R+VSR +S K
Sbjct: 361 RLQKATELISEGRGLKSTNPDSRSVSRNNSLK 392

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
            YIL147C
          Length = 1140

 Score =  457 bits (1175), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 289/714 (40%), Positives = 397/714 (55%), Gaps = 69/714 (9%)

Query: 507  EARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXXXXXXXXX 566
            E ++P YR+LF DEL++LT+TFN M++ALD+HYALLE RV  RTKQL             
Sbjct: 482  EIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTKQLEAAKVQAEAANEA 541

Query: 567  KTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGXXXXXXXXXXXXFS 626
            KTVFIANISHELRTPLNGILGMT+ S+EE D+ KI++ LKLIFRSG            FS
Sbjct: 542  KTVFIANISHELRTPLNGILGMTSTSLEENDIKKIKDGLKLIFRSGELLLNILTELLTFS 601

Query: 627  KNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFP-NLIRTMVLWGDSNRI 685
            KNVL +TKLE R+F I ++  QIK+IF K+ + Q V+L I L P   +++++ +GDSNRI
Sbjct: 602  KNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRLLPKKFLKSLLFYGDSNRI 661

Query: 686  IQIVMNLVSNALKFTP-VDGTVDVRMKLLGEYDKDLSEKKQFKEVHVKRGTEITEYSEET 744
            +Q++MNL+SNA+KFTP V+G V+V M LLGEYD++ S+ + + +V +K  T+I   S E 
Sbjct: 662  LQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTESGEL 721

Query: 745  NK----CDIPISSNHRKHVDLESTTTSITSNRDTSIIQEEITKRNTAANENIYKRMNDAE 800
             K    C I   S    +    + +  I SN +  +     T   T  +     R N   
Sbjct: 722  IKSKIRCKIT-KSTTNMNTATTNNSARIESNTNQYLSPYSHTNTRTHTHPGADSRRNSNV 780

Query: 801  KLXXXXXXXXXXXXXXXXXXAIFNSQFNKAPGSDEDEGGNLGKPIENPKTWVISIEVEDT 860
                                 +FN    +    D ++   L + IE  K WVI  EV D 
Sbjct: 781  STVNNSSISLDSESSKMYDNLMFNRLIKREGDGDINDIKAL-EQIEGNKKWVIRFEVIDN 839

Query: 861  GPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMRLESKVGVGSKF 920
            GPGID +L +SVF PFVQGDQTLSRQYGGTGLGLSIC+QL  MM GT+ LES++G GSKF
Sbjct: 840  GPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKF 899

Query: 921  TFTLPLPQTKEISFANMDFPFEDEFNPESRKNRRVKFNVAKSIKSRQST----SSIATPA 976
             +T+PL Q       N D   +   N  S  +  +  +   SI S   T    +S+ + +
Sbjct: 900  IYTIPLLQVGGTKKDNDDNEEDHNDNTNSSVDIDIIEDTPVSITSSSQTHSDLNSLQSNS 959

Query: 977  TNRSSLINDVLPEIGSKNENQIKRFENSNMKREGVNGIGRIEQKLQEKNVKPFICFSSAE 1036
            TN   L +D   E  ++N++ +   + S +++  ++      QK++   +          
Sbjct: 960  TNEVGL-DDSFSE--AENDSTVASLDKSVLQKTRMDA-----QKVEANEIDDI------- 1004

Query: 1037 SSEKKTVPPKHRSREESLGSVNLDRPFLQSTGTATSSRNVPTIQDNDKNDTSIKILVVED 1096
                K +P K +                           V   +DN  N   IK ++   
Sbjct: 1005 DHCNKGIPSKLK---------------------------VLVAEDNLVNQEVIKRML--- 1034

Query: 1097 NHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLS 1156
                     ++ N+  IE   LA DG EAF+KVK+       Y++IFMD+QMPK+DGL S
Sbjct: 1035 ---------KLENISDIE---LAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPKMDGLES 1082

Query: 1157 TKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1210
            T  IR++L Y+  IVALTAFAD+SNIKEC ++GM+GF+ KPIKR  L T+L EF
Sbjct: 1083 TTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136

 Score =  363 bits (931), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 188/388 (48%), Positives = 256/388 (65%), Gaps = 12/388 (3%)

Query: 3   LRLPS--------KSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLR 54
           +RLPS        K    PP+R  +RAQLT LV IVA++SL  LA+ TGVYFT++YK+L 
Sbjct: 1   MRLPSWKIKLKMNKQTVKPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLN 60

Query: 55  SDRLYIAAQLKSSQIDQTLNXXXXXXXXXXSRDALQSSLTSFVAGNKSADNWVDSLSVVQ 114
            +RLYIA+QLKSSQIDQTLN          SR+ +Q+ + S   G  +A   ++S SV+ 
Sbjct: 61  VNRLYIASQLKSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLD 120

Query: 115 KFLSSSNLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLS-TDTPLPSSLETTG 173
           KF+ +S+LFY   +YD +  +++N+TNN +G  +   +L  L PLS T+T +P  +  TG
Sbjct: 121 KFVGTSDLFYYTMIYDKNLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTG 180

Query: 174 ILTDPVVNNTDYLMSMSLPI---FANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALE 230
           ILTDP++N+T YLMSMSLPI   ++  + I   S +YGY+T++MSAE LKSVFNDT  L 
Sbjct: 181 ILTDPILNSTKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLS 240

Query: 231 KSNVAIISALYNNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQ 290
            S  A++SA+Y N      +HF+FPP+    ++     +IKN TF   AF   K GS K+
Sbjct: 241 DSTTALLSAIYTNDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDKNKSGSKKK 300

Query: 291 TNSFGIKNLALGYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLT 350
                 KN A+GY+P +F L  WVAVV+ P+  F S + KL KII GTV+ I VFV L++
Sbjct: 301 VKLVNKKNYAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLIS 360

Query: 351 LPLAHWAVQPIVRLQKATELITEGRGLR 378
           LPL++WAVQPIVRLQ+A+ELIT+ RGLR
Sbjct: 361 LPLSYWAVQPIVRLQRASELITKRRGLR 388

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1187

 Score =  443 bits (1139), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 241/412 (58%), Positives = 286/412 (69%), Gaps = 46/412 (11%)

Query: 821  AIFNSQFNKAPGSDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGD 880
            AIFNSQF K P   EDE GNLG+ +   KTWV  IEV DTGPGID SLQESVF PFVQGD
Sbjct: 818  AIFNSQFKKTPDLYEDEDGNLGEELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGD 877

Query: 881  QTLSRQYGGTGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFP 940
            QTLSRQYGGTGLGLSICRQLA MMNGTM LES VG GSKF FT+PL QT+ I     + P
Sbjct: 878  QTLSRQYGGTGLGLSICRQLATMMNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHP 937

Query: 941  FEDEFNPESRKNRRVKFNVAKSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKR 1000
            +EDEFNP+S+ NR+VKFNVA+SI SR+S SS+ T  ++R + +                 
Sbjct: 938  YEDEFNPKSKMNRKVKFNVARSINSRRSRSSLITSNSSRIATV----------------- 980

Query: 1001 FENSNMKREGVNGIGRIEQKLQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGSVNLD 1060
                   RE      R+E +    +V      S++  +E  +  P      ES  ++NLD
Sbjct: 981  -------REE----SRLETRSNHSDV------STSNKNESASPQP------ESGSNLNLD 1017

Query: 1061 RPFLQSTGTATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELAC 1120
            RPFLQSTGTA SS NVPT+    K   ++ +LV EDNHVNQEVIKRML+LEG++NI+LAC
Sbjct: 1018 RPFLQSTGTAISSANVPTVATLGK---TLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLAC 1074

Query: 1121 DGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDS 1180
            DGQ+AFD VK L  +G  Y+MIFMDVQMPKVDGL +TKMIR DL Y+ PIVALTAFADDS
Sbjct: 1075 DGQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDS 1134

Query: 1181 NIKECLESGMNGFLSKPIKRPKLKTILTEFCAAY--QGKKI-TSEEPKKAKT 1229
            NIKECL++GM+GFLSKPIKRP+LKTIL E+C      G+   T EE K  K+
Sbjct: 1135 NIKECLDAGMDGFLSKPIKRPQLKTILLEYCPKVDSMGRATSTGEESKHTKS 1186

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 76/147 (51%), Gaps = 14/147 (9%)

Query: 1091 ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPK 1150
            +L+VED+ V+ ++  + L   G   +++  DG  A   +++       Y+++ MD+ MP 
Sbjct: 407  VLLVEDDSVSIQLCSKFLRKYGCT-VQVVTDGLSAISNLEKF-----RYDLVLMDIVMPN 460

Query: 1151 VDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTE- 1209
            +DG  +T ++R     ++PI+A+T   +D ++   L+ GMN  L+KP  R  L +IL   
Sbjct: 461  LDGATATSIVR-SFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRNDLHSILIRH 519

Query: 1210 ------FCAAYQGKKITSEEPKKAKTE 1230
                   C   +G  ITSE P    T+
Sbjct: 520  LKDRIPLCDQNRGSGITSESPNLPPTQ 546

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 84/165 (50%), Gaps = 34/165 (20%)

Query: 1074 RNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELT 1133
            R  P  +  DK    I +L+VEDN +NQ ++   L    I + E+A +G EA +K ++  
Sbjct: 534  RPSPIKRTRDKVFPKINVLIVEDNIINQAILVSFLKRHRI-SYEIAKNGAEAVEKWRQ-- 590

Query: 1134 SKGGNYNMIFMDVQMPKVDGLLSTKMIR-------------------RDLG-------YK 1167
               G  ++I MD+Q+P + GL +TK IR                   RD         ++
Sbjct: 591  ---GGIHLILMDLQLPLLSGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLDLDRSKFR 647

Query: 1168 SP--IVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1210
            SP  IVALTAF+  ++ +E L +G N +L+KP+    L + +TE+
Sbjct: 648  SPVIIVALTAFSSHADRREALVAGCNDYLTKPVNLDWLSSKITEW 692

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 83/164 (50%), Gaps = 34/164 (20%)

Query: 1075 NVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTS 1134
            +VP+ Q  D+    I +L+VEDN +NQ ++   L    I + E+A +G EA +K ++   
Sbjct: 495  SVPSNQTRDRVFPKINVLIVEDNIINQAILSSFLRKHKI-SYEIAKNGVEAVEKWRK--- 550

Query: 1135 KGGNYNMIFMDVQMPKVDGLLSTKMIR---RDLG-----------------------YKS 1168
              G  ++I MD+Q+P + G+ + K IR   R  G                       +++
Sbjct: 551  --GGIHLILMDLQLPLLSGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFRA 608

Query: 1169 P--IVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1210
            P  IVALTAF+  ++  E L +G N +L+KP+    L   +TE+
Sbjct: 609  PVIIVALTAFSSHADRNEALVAGCNDYLTKPVNLDWLSNKITEW 652

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 84/174 (48%), Gaps = 33/174 (18%)

Query: 1060 DRPFLQSTGTATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELA 1119
            D PFL+S     ++ ++      DK    I +LVVEDN +NQ ++   L    I + ++A
Sbjct: 394  DSPFLRSAMETFTTESI----TRDKVFPKISVLVVEDNMINQTILSSFLRKHKI-SYKVA 448

Query: 1120 CDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRR------------DLGYK 1167
             +G EA D+ KE     G  ++I MD++MP + G+ + K IRR              G  
Sbjct: 449  KNGIEAVDRWKE-----GGMHLILMDLEMPLLSGIDAAKEIRRLEKLNGIGSGKPSTGEH 503

Query: 1168 SP-----------IVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1210
            +P           IVALTA    S+  E L +G N +L+KP+    L   +TE+
Sbjct: 504  APAKRSTSKAPVIIVALTASNSQSDKTEALLAGCNDYLTKPVNLDWLTRKITEW 557

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 71/133 (53%), Gaps = 12/133 (9%)

Query: 1083 DKNDTSI-----KILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGG 1137
            D NDTS+      +L+VED+ V  ++  + L   G   +E+  DG  A   +++      
Sbjct: 323  DTNDTSVLKEGFHVLLVEDDAVCIQLCSKFLRKYGC-TVEVVTDGLSAISTLEKF----- 376

Query: 1138 NYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKP 1197
             Y+++ MD+ MP +DG  +T ++R      +PI+A+T   +D ++   L+ GMN  L+KP
Sbjct: 377  RYDLVLMDIVMPNLDGATATSIVR-SFDNHTPIIAMTGNIEDQDLITYLQHGMNDILAKP 435

Query: 1198 IKRPKLKTILTEF 1210
              +  L ++L  +
Sbjct: 436  FTKDDLHSMLIRY 448

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 68/120 (56%), Gaps = 7/120 (5%)

Query: 1091 ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPK 1150
            +L+VED+ V  ++  + L   G  ++E+  DG  A + V++       Y+++ MD+ MP 
Sbjct: 320  VLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIETVEKF-----QYDLVLMDIVMPN 373

Query: 1151 VDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1210
            +DG  +T +IR     ++PI+A+T   +D ++   L+ GMN  L+KP  +  L ++L  +
Sbjct: 374  LDGATATSVIR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLVRY 432

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 68/120 (56%), Gaps = 7/120 (5%)

Query: 1091 ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPK 1150
            +L+VED+ V  ++  + L   G  ++E+  DG  A + V++       Y+++ MD+ MP 
Sbjct: 331  VLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIETVEKF-----QYDLVLMDIVMPN 384

Query: 1151 VDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1210
            +DG  +T +IR     ++PI+A+T   +D ++   L+ GMN  L+KP  +  L ++L  +
Sbjct: 385  LDGATATSVIR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 443

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 68.6 bits (166), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 72/129 (55%), Gaps = 13/129 (10%)

Query: 1089 IKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L    I + ++A +G+EA D  KE     G  ++IFMD+Q+
Sbjct: 517  INVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIWKE-----GGLHLIFMDLQL 570

Query: 1149 PKVDGLLSTKMIR-----RDLGYKSP--IVALTAFADDSNIKECLESGMNGFLSKPIKRP 1201
            P + G+ + K IR     R     +P  IVALTA     + ++ L SG N +L+KP+   
Sbjct: 571  PVLSGIDAAKQIRDCEKKRTASQNAPVIIVALTASNSIEDKRKALISGCNDYLTKPVNLH 630

Query: 1202 KLKTILTEF 1210
             L   +TE+
Sbjct: 631  WLSKKITEW 639

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 68.6 bits (166), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 59/187 (31%), Positives = 89/187 (47%), Gaps = 34/187 (18%)

Query: 1051 EESLGSVNLDRPFLQSTGT-----ATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIK 1105
            EE +G V    P +Q  G+     A  S    +I   DK    I +LVVEDN +NQ ++ 
Sbjct: 364  EEEIGLVPPRDPIVQREGSPFILSAMESVTTESIT-RDKVFPKISVLVVEDNMINQAILS 422

Query: 1106 RMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRR--- 1162
              L    I + ++A +G EA D+ KE     G  ++I MD++MP + G+ + K IR+   
Sbjct: 423  SFLRKHKI-HYKVAKNGVEAVDRWKE-----GGMHLILMDLEMPLLSGIDAAKEIRKLEK 476

Query: 1163 -----------------DLGYKSP--IVALTAFADDSNIKECLESGMNGFLSKPIKRPKL 1203
                              L  K+P  IVALTA    ++  E L +G N +L+KP+    L
Sbjct: 477  QNGIGTGDPLGKHAELKGLTCKAPVIIVALTASNSQTDKTEALLAGCNDYLTKPVNLDWL 536

Query: 1204 KTILTEF 1210
               +TE+
Sbjct: 537  TRKITEW 543

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 68.2 bits (165), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 49/149 (32%), Positives = 75/149 (50%), Gaps = 33/149 (22%)

Query: 1089 IKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L    I + ++A +G+EA DK KE     GN ++IFMD+Q+
Sbjct: 463  INVLIVEDNVINQAILGSFLRKNKI-SYKIAKNGKEAVDKWKE-----GNLHLIFMDLQL 516

Query: 1149 PKVDGLLSTKMIR-----RDLGYKSP----------------------IVALTAFADDSN 1181
            P + G+ + K IR     R +  +S                       IVALTA     +
Sbjct: 517  PVLSGIEAAKKIRELEKERGIANQSERVSTPGSLSSINMNGSTNSPVIIVALTASNSQED 576

Query: 1182 IKECLESGMNGFLSKPIKRPKLKTILTEF 1210
             +E L SG N +L+KP+    L   +TE+
Sbjct: 577  KREALISGCNDYLTKPVNLLWLSKKITEW 605

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 67/120 (55%), Gaps = 7/120 (5%)

Query: 1091 ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPK 1150
            +L+VED+ ++ ++  + L   G   +E+  DG  A   +++       Y+++ MD+ MP 
Sbjct: 355  VLLVEDDAISIQLCSKFLRKYGC-TVEVVTDGLSAISTLEKF-----RYDLVLMDIVMPN 408

Query: 1151 VDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1210
            +DG  +T +IR     ++PI+A+T   +D ++   L+ GMN  L+KP  R  L ++L  +
Sbjct: 409  LDGATATSIIRS-FDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDLHSMLIRY 467

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 66/120 (55%), Gaps = 7/120 (5%)

Query: 1091 ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPK 1150
            +L+VED+ ++ ++  + L   G   +++  DG  A       T +   Y+++ MD+ MP 
Sbjct: 405  VLLVEDDAISIQLCSKFLRKYGC-TVQVVTDGLSAI-----TTLENSRYDLVLMDIVMPN 458

Query: 1151 VDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1210
            +DG  +T +IR     ++PI+A+T   DD ++   L+ GMN  L+KP  R  L ++L  +
Sbjct: 459  LDGATATSIIR-SFDNQTPIIAMTGNIDDGDLITYLQHGMNDILAKPFTRDDLHSMLIRY 517

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 66.2 bits (160), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 74/143 (51%), Gaps = 28/143 (19%)

Query: 1089 IKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQM 1148
            I +L+VEDN +NQ +++  L    I + ++A +GQEA D+ KE     G  ++IFMD+Q+
Sbjct: 501  ITVLIVEDNVINQAILRSFLKKHKI-SYKVAKNGQEAVDRWKE-----GGIDLIFMDLQL 554

Query: 1149 PKVDGLLSTKMIRRDLGY-------------------KSP--IVALTAFADDSNIKECLE 1187
            P   G+ + K I RDL                     K+P  IVA TA    ++ +E L 
Sbjct: 555  PVFSGMDAAKKI-RDLEKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRADKREALL 613

Query: 1188 SGMNGFLSKPIKRPKLKTILTEF 1210
            SG N +L+KP+    L   + E+
Sbjct: 614  SGCNDYLTKPVNLHWLSKKINEW 636

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 67/122 (54%), Gaps = 7/122 (5%)

Query: 1089 IKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQM 1148
              +L+VED+ V+  +  + L   G   +E+  DG  A   +++       Y+++ MD+ M
Sbjct: 381  FHVLLVEDDAVSIRLCSKFLRKYGC-TVEVVTDGLSAISTLEKF-----RYDLVLMDIVM 434

Query: 1149 PKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILT 1208
            P +DG  +T +IR +   ++PI+A+T   +D ++   L+ GMN  L+KP  +  L ++L 
Sbjct: 435  PNLDGATATSIIR-NFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 493

Query: 1209 EF 1210
             +
Sbjct: 494  RY 495

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 70/128 (54%), Gaps = 13/128 (10%)

Query: 1089 IKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L    I + ++A +G+EA +       K G  ++IFMD+Q+
Sbjct: 475  INVLIVEDNVINQAILGGFLRKHKI-SYKVAKNGKEAVE-----MWKNGGLHLIFMDLQL 528

Query: 1149 PKVDGLLSTKMIRRDLGYKSP------IVALTAFADDSNIKECLESGMNGFLSKPIKRPK 1202
            P + G+ + K I RD   + P      IVALTA     + +  L SG N +L+KP+    
Sbjct: 529  PVLSGIDAAKQI-RDFEKERPSCAPVIIVALTASNSAEDKRNALVSGCNDYLTKPVNLHW 587

Query: 1203 LKTILTEF 1210
            L   +TE+
Sbjct: 588  LSKKITEW 595

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 67/120 (55%), Gaps = 7/120 (5%)

Query: 1091 ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPK 1150
            +L+VED+ V  ++  + L   G  ++E+  DG  A   +++       Y+++ MD+ MP 
Sbjct: 309  VLLVEDDSVCIQLCSKFLLKYGC-SVEVVTDGLSAISTLEKF-----RYDLVLMDIVMPN 362

Query: 1151 VDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1210
            +DG  +T ++R     ++PI+A+T   +D ++   LE GMN  L+KP  +  L ++L  +
Sbjct: 363  LDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLEHGMNDILAKPFTKDDLHSMLIRY 421

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 65.5 bits (158), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 80/156 (51%), Gaps = 18/156 (11%)

Query: 1066 STGTATSSRNVPTIQD------NDKNDT-----SIKILVVEDNHVNQEVIKRMLNLEGIE 1114
            S  T+T S  +P + D      N +N+T        +L+VED+ V+ ++  + L   G  
Sbjct: 343  SPATSTVSLQLPNLPDQNSLTPNAQNNTVTLRKGFHVLLVEDDAVSIQLCSKFLRKYGCT 402

Query: 1115 NIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALT 1174
             +++  DG  A   +++       Y+++ MD+ MP +DG  +T ++R     ++PI+A+T
Sbjct: 403  -VQVVSDGLSAISTLEKYR-----YDLVLMDIVMPNLDGATATSIVR-SFDNETPIIAMT 455

Query: 1175 AFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1210
                + ++   L+ GMN  L+KP  R  L +IL  +
Sbjct: 456  GNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 491

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 65.5 bits (158), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 75/154 (48%), Gaps = 32/154 (20%)

Query: 1083 DKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMI 1142
            DK    I +L+VEDN +NQ ++   L    I   ++A +GQEA D  +E     G  ++I
Sbjct: 559  DKVFPKINVLIVEDNVINQTILSSFLRKHKI-FYKVAKNGQEAIDVWRE-----GGIHLI 612

Query: 1143 FMDVQMPKVDGLLSTKMIR---RDLGY------KSP-----------------IVALTAF 1176
            FMD+Q+P + G+ + K IR   R+ G       K+P                 IVA TA 
Sbjct: 613  FMDLQLPVLSGIDAAKKIRELEREHGIGIQKSRKTPHIESNKINKDQINAPVIIVAFTAS 672

Query: 1177 ADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1210
               S+ KE L SG N +L+KP+    L   + E+
Sbjct: 673  KSQSDKKEALISGCNDYLTKPVNLHWLSNKINEW 706

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 65.1 bits (157), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 65/122 (53%), Gaps = 7/122 (5%)

Query: 1089 IKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQM 1148
              +L+VED+ V  ++  + L   G   +E+  DG  A   +++       Y+++ MD+ M
Sbjct: 376  FHVLLVEDDAVCIQLCSKFLRKYGC-TVEVVTDGLAAISTLEKF-----RYDLVLMDIVM 429

Query: 1149 PKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILT 1208
            P +DG  +T ++R      +PI+A+T   +D ++   L+ GMN  L+KP  +  L ++L 
Sbjct: 430  PNLDGATATSIVRS-FDIHTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 488

Query: 1209 EF 1210
             +
Sbjct: 489  RY 490

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 85/163 (52%), Gaps = 17/163 (10%)

Query: 1055 GSVNLDRPFLQSTGTATSS---RNVPTIQDNDKNDTSIK-------ILVVEDNHVNQEVI 1104
            G + L    + +TG + SS    +V   Q+N ++ T+ +       +L+VED+ V+ ++ 
Sbjct: 380  GILPLQEENINTTGHSVSSISKSDVDIKQENSQSPTATEELRKGYHVLLVEDDAVSIQLC 439

Query: 1105 KRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDL 1164
             + L   G   +E+  DG  A   ++        Y+++ MD+ MP +DG  +T +IR + 
Sbjct: 440  SKFLRKSGC-TVEVVTDGLAAISILEAF-----RYDLVLMDIVMPNLDGATATSIIR-NF 492

Query: 1165 GYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTIL 1207
              ++PI+A+T   +D ++   L+ GM   L+KP  R  L ++L
Sbjct: 493  DKETPIIAMTGNIEDQDLITYLQHGMTDILAKPFTRDDLLSML 535

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 66/120 (55%), Gaps = 7/120 (5%)

Query: 1091 ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPK 1150
            +L+VED+ +  ++  + L   G   +E+  DG  A   +++       Y+++ MD+ MP 
Sbjct: 307  VLLVEDDSICIQLCSKFLMKYGC-TVEVVTDGLSAISTLEKF-----RYDLVLMDIVMPN 360

Query: 1151 VDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1210
            +DG  +T ++R     ++PI+A+T   +D ++   L+ GMN  L+KP  +  L ++L  +
Sbjct: 361  LDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 419

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 66/120 (55%), Gaps = 7/120 (5%)

Query: 1091 ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPK 1150
            +L+VED+ V  ++  + L   G  ++E+  DG  A       T +   ++++ MD+ MP 
Sbjct: 331  VLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIS-----TLEKQRFDLVLMDIVMPN 384

Query: 1151 VDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1210
            +DG  +T ++R     ++PI+A+T   DD ++   L+ GMN  L+KP  +  L ++L  +
Sbjct: 385  LDGATATSIVRS-FDNETPIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 443

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 74/141 (52%), Gaps = 25/141 (17%)

Query: 1089 IKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L    I + ++A +G+EA D  KE     G  ++IFMD+Q+
Sbjct: 545  INVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIWKE-----GGLHLIFMDLQL 598

Query: 1149 PKVDGLLSTKMIR---RDLGY--------------KSP--IVALTAFADDSNIKECLESG 1189
            P + G+ + + IR   ++ G               K+P  IVALTA     + +  L SG
Sbjct: 599  PVLSGIEAARQIRAFEKENGIGIQEHSNSLKKNKTKAPVIIVALTASNSQDDKRNALISG 658

Query: 1190 MNGFLSKPIKRPKLKTILTEF 1210
             N +L+KP+    L   +TE+
Sbjct: 659  CNDYLTKPVNLHWLSKKITEW 679

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 63.5 bits (153), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 76/158 (48%), Gaps = 37/158 (23%)

Query: 1089 IKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L    I + ++A +G+EA DK KE     G  ++IFMD+Q+
Sbjct: 511  INVLIVEDNVINQTILASFLRKHKI-SYKVAKNGREAVDKWKE-----GGLHLIFMDLQL 564

Query: 1149 PKVDGLLSTKMIRRDLGYK----------------------------SP--IVALTAFAD 1178
            P + G+ + K IR    +K                            +P  IVA TA   
Sbjct: 565  PVLSGIDAAKEIREYEKHKGIGIQKASSTTSTTNLEDTKKIDKNSTGAPVIIVAFTASNS 624

Query: 1179 DSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQG 1216
             ++ +E L SG N +L+KP+    L   +TE+    QG
Sbjct: 625  LTDKREALISGCNDYLTKPVNLHWLSKKITEW-GCMQG 661

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 66/122 (54%), Gaps = 7/122 (5%)

Query: 1089 IKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQM 1148
              +L+VED+ V+ ++  + L   G   +++  DG  A   +++       Y+++ MD+ M
Sbjct: 379  FHVLLVEDDAVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKFR-----YDLVLMDIVM 432

Query: 1149 PKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILT 1208
            P +DG  +T ++R     ++PI+A+T    + ++   L+ GMN  L+KP  R  L +IL 
Sbjct: 433  PNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILI 491

Query: 1209 EF 1210
             +
Sbjct: 492  RY 493

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 76/145 (52%), Gaps = 9/145 (6%)

Query: 1068 GTATSSRNVPTIQDNDKND--TSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEA 1125
            G+A  +     I D D N+      +L+VED+ V+ ++  + L   G   +++  DG  A
Sbjct: 359  GSADINSKNDDIGDVDSNELKKGFHVLLVEDDDVSIQLCSKFLRKYGC-TVQVVTDGLAA 417

Query: 1126 FDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKEC 1185
               +++       ++++ MD+ MP +DG  +T +IR +   ++PI+A+T   +  ++   
Sbjct: 418  ISILEKF-----RFDLVLMDIVMPNLDGATATSIIR-NFDNRTPIIAMTGSIEHQDLITY 471

Query: 1186 LESGMNGFLSKPIKRPKLKTILTEF 1210
            L+ GMN  L+KP  R  L +IL  +
Sbjct: 472  LQHGMNDILAKPFTRKDLYSILIRY 496

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 66/122 (54%), Gaps = 7/122 (5%)

Query: 1089 IKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQM 1148
              +L+VED+ V+ ++  + L   G   +++  DG  A   +++       Y+++ MD+ M
Sbjct: 378  FHVLLVEDDAVSIQLCSKFLRKYGC-TVQVVTDGLSAISTLEKF-----RYDLVLMDIVM 431

Query: 1149 PKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILT 1208
            P +DG  +T ++R     ++PI+A+T    + ++   L+ GMN  L+KP  R  L +IL 
Sbjct: 432  PNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILI 490

Query: 1209 EF 1210
             +
Sbjct: 491  RY 492

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 81/156 (51%), Gaps = 18/156 (11%)

Query: 1066 STGTATSSRNVPTIQDNDK-------NDTSIK----ILVVEDNHVNQEVIKRMLNLEGIE 1114
            S  T+T S  +P++ D +        N  +++    +L+VED+ V+ ++  + L   G  
Sbjct: 345  SPATSTVSLQLPSLPDENSLTPNAQANTVTLRKGFHVLLVEDDVVSIQLCSKFLRKYGCT 404

Query: 1115 NIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALT 1174
             +++  DG  A   +++       Y+++ MD+ MP +DG  +T ++R     ++PI+A+T
Sbjct: 405  -VQVVTDGLSAISTLEKFR-----YDLVLMDIVMPNLDGATATSIVR-SFDNETPIIAMT 457

Query: 1175 AFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1210
                + ++   L+ GMN  L+KP  R  L +IL  +
Sbjct: 458  GNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 493

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 76/151 (50%), Gaps = 34/151 (22%)

Query: 1088 SIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQ 1147
            +I +L+VEDN +NQ ++   L    I +  +A +G+EA +K KE     G  ++IFMD+Q
Sbjct: 470  NITVLIVEDNVINQTILASFLRKHKI-SYRIAKNGREAVEKWKE-----GGIHLIFMDLQ 523

Query: 1148 MPKVDGLLSTKMIR-----RDLGYKSP-----------------------IVALTAFADD 1179
            +P + G+ + K IR     + +G ++P                       +VA TA    
Sbjct: 524  LPVMSGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVESVEKPVLGAPVIMVAFTASNSL 583

Query: 1180 SNIKECLESGMNGFLSKPIKRPKLKTILTEF 1210
            ++ +E L SG N +L+KP+    L   +TE+
Sbjct: 584  TDKREALVSGCNDYLTKPVNLHWLSKKITEW 614

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 72/149 (48%), Gaps = 33/149 (22%)

Query: 1089 IKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L    I + +LA +GQEA +  KE     G  ++IFMD+Q+
Sbjct: 486  INVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE-----GGLHLIFMDLQL 539

Query: 1149 PKVDGLLSTKMIR-----------RDLGYKSP----------------IVALTAFADDSN 1181
            P + G+ + K IR           + L    P                IVALTA     +
Sbjct: 540  PVLSGIEAAKQIRDFEKQNGIGIQKSLNNSYPNHEKLPCKKFSQAPVIIVALTASNSQMD 599

Query: 1182 IKECLESGMNGFLSKPIKRPKLKTILTEF 1210
             ++ L SG N +L+KP+    L   +TE+
Sbjct: 600  KRKALVSGCNDYLTKPVNLHWLSKKITEW 628

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 92/183 (50%), Gaps = 25/183 (13%)

Query: 1045 PKHRSREESLGSVNLDRPF-LQSTGTATSSRNVPT-IQDNDKN-----------DTSIK- 1090
            P+    E +LG  N D P  +       S  ++P  I +ND+N           DT +K 
Sbjct: 290  PQSVHNEINLGE-NSDDPLPIHKANKTPSISDLPNPILENDENINTIDGDLAQGDTILKK 348

Query: 1091 ---ILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQ 1147
               +L+VED+ V+ ++  + L   G   +++  DG  A   +++       ++++ MD+ 
Sbjct: 349  GFNVLLVEDDEVSIQLCSKFLIKYGC-TVQVVTDGLAAISTLEKY-----RFDLVLMDIV 402

Query: 1148 MPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTIL 1207
            MP +DG  +T +IR +   ++PI+A+T   +  ++   L+ GMN  L+KP  R  L ++L
Sbjct: 403  MPNLDGATATSIIR-NFDNETPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRRDLYSML 461

Query: 1208 TEF 1210
            T +
Sbjct: 462  TRY 464

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 62.0 bits (149), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 74/149 (49%), Gaps = 33/149 (22%)

Query: 1089 IKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L    I + +LA +GQEA +  KE     G  ++IFMD+Q+
Sbjct: 503  INVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE-----GGLHLIFMDLQL 556

Query: 1149 PKVDGLLSTKMIR-----RDLG-YKSP---------------------IVALTAFADDSN 1181
            P + G+ + K IR       +G  K+P                     IVALTA     +
Sbjct: 557  PVLSGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFEKSASKRFSQAPVIIVALTASNSQMD 616

Query: 1182 IKECLESGMNGFLSKPIKRPKLKTILTEF 1210
             ++ L SG N +L+KP+    L   +TE+
Sbjct: 617  KRKALLSGCNDYLTKPVNLHWLSKKITEW 645

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 61.6 bits (148), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 74/149 (49%), Gaps = 33/149 (22%)

Query: 1089 IKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L    I + +LA +GQEA +  KE     G  ++IFMD+Q+
Sbjct: 504  INVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE-----GGLHLIFMDLQL 557

Query: 1149 PKVDGLLSTKMIR-----RDLGY--------------------KSP--IVALTAFADDSN 1181
            P + G+ + K IR       +G                     ++P  IVALTA     +
Sbjct: 558  PVLSGIEAAKQIRDFEKQNGIGIQKSLNNSHSNLEKGTSKRFSQAPVIIVALTASNSQMD 617

Query: 1182 IKECLESGMNGFLSKPIKRPKLKTILTEF 1210
             ++ L SG N +L+KP+    L   +TE+
Sbjct: 618  KRKALLSGCNDYLTKPVNLHWLSKKITEW 646

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 74/149 (49%), Gaps = 33/149 (22%)

Query: 1089 IKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L    I + +LA +GQEA +  KE     G  ++IFMD+Q+
Sbjct: 493  INVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE-----GGLHLIFMDLQL 546

Query: 1149 PKVDGLLSTKMIRR--------------------DLGY-----KSP--IVALTAFADDSN 1181
            P + G+ + K IR                     D G      ++P  IVALTA     +
Sbjct: 547  PVLSGIEAAKQIRDFEKQNGIGIQKGLNNSHSNFDKGTSKKFSQAPVIIVALTASNSQMD 606

Query: 1182 IKECLESGMNGFLSKPIKRPKLKTILTEF 1210
             ++ L SG N +L+KP+    L   +TE+
Sbjct: 607  KRKALLSGCNDYLTKPVNLHWLSKKITEW 635

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 67/122 (54%), Gaps = 7/122 (5%)

Query: 1089 IKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQM 1148
              +L+VED+ +  ++  + L ++    +E+  DG  A   +++       ++++ MD+ M
Sbjct: 302  FHVLLVEDDSICIQLCSKFL-MKYACTVEVVTDGLSAISTLEKF-----RFDLVLMDIVM 355

Query: 1149 PKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILT 1208
            P +DG  +T ++R     ++PI+A+T   +D ++   L+ GMN  L+KP  +  L ++L 
Sbjct: 356  PNLDGATATSIVR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 414

Query: 1209 EF 1210
             +
Sbjct: 415  RY 416

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 60.1 bits (144), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 75/145 (51%), Gaps = 29/145 (20%)

Query: 1089 IKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L    I + ++A +G+EA D  KE     G  ++IFMD+Q+
Sbjct: 670  INVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIWKE-----GGLHLIFMDLQL 723

Query: 1149 PKVDGLLSTKMIR-----RDLGY----------------KSP--IVALTAFADDSNIKEC 1185
            P + G+ + + IR     + +G                 ++P  IVALTA     + ++ 
Sbjct: 724  PVLSGIEAARQIRDFEKEKGIGIQENNLKQKIIPASNINQAPVIIVALTASNSLDDKRKA 783

Query: 1186 LESGMNGFLSKPIKRPKLKTILTEF 1210
            L SG N +L+KP+    L   +TE+
Sbjct: 784  LLSGCNDYLTKPVNLHWLSKKITEW 808

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 64/122 (52%), Gaps = 7/122 (5%)

Query: 1089 IKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQM 1148
              +L+VED+ V  ++  + L   G   + +  DG  A   ++        ++++ MD+ M
Sbjct: 416  FHVLLVEDDEVCIQLCSKFLRKYGC-TVRVVTDGLTAISVLEN-----HRFDLVLMDIVM 469

Query: 1149 PKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILT 1208
            P +DG  +T ++R    Y +PI+A+T   +D ++   L+ GMN  L+KP  +  L ++L 
Sbjct: 470  PNLDGATATSIVRNFDNY-TPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKRDLHSMLV 528

Query: 1209 EF 1210
             +
Sbjct: 529  RY 530

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 6/73 (8%)

Query: 1089 IKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L   GI + ++A DG EA +K KE     G+ ++I MD+Q+
Sbjct: 394  INVLIVEDNAINQAILALFLRKNGI-SYKVAKDGVEAIEKWKE-----GDSHLILMDLQL 447

Query: 1149 PKVDGLLSTKMIR 1161
            P + GL +TK IR
Sbjct: 448  PLLSGLEATKKIR 460

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 56.2 bits (134), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 75/158 (47%), Gaps = 37/158 (23%)

Query: 1089 IKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQM 1148
            I IL+VEDN +NQ ++   L    I   ++A +G+EA DK KE     G  ++IFMD+Q+
Sbjct: 565  INILIVEDNVINQTILGSFLRKNKIF-YKVAKNGREAVDKWKE-----GGIHLIFMDLQL 618

Query: 1149 PKVDGLLSTKMIRR-----DLGYK-----------------------SP--IVALTAFAD 1178
            P + G  + K IR+      +G +                       +P  IVA TA   
Sbjct: 619  PVLSGTDAAKEIRQYEKKIGIGIQKKQSSSSDLSLSESFLNTKSSACAPVIIVAFTASNS 678

Query: 1179 DSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQG 1216
             ++ +  L +G N +L+KP+    L   +TE+    QG
Sbjct: 679  LADKRAALIAGCNDYLTKPVNLHWLSKKITEW-GCMQG 715

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 46/73 (63%), Gaps = 6/73 (8%)

Query: 1089 IKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L    I + ++A +G+EA DK K+     G  ++I +D+Q+
Sbjct: 462  INVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGREAVDKWKQ-----GGIHLILLDLQL 515

Query: 1149 PKVDGLLSTKMIR 1161
            P + G+ +TK IR
Sbjct: 516  PILSGIEATKEIR 528

>KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 421

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 42/93 (45%), Gaps = 15/93 (16%)

Query: 853 ISIEVEDTGPGIDPSLQESVF-HPFV-----QGDQTLS---------RQYGGTGLGLSIC 897
           + I + D G GIDP +++ VF + F      + D  +S         +   G G GL +C
Sbjct: 325 LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMC 384

Query: 898 RQLANMMNGTMRLESKVGVGSKFTFTLPLPQTK 930
           +    + NGT+ ++S  G G+     L  P  +
Sbjct: 385 KAYLELFNGTLDIQSLWGWGTDVYIRLHGPSDR 417

>SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 412

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 39/93 (41%), Gaps = 15/93 (16%)

Query: 853 ISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYG---------------GTGLGLSIC 897
           + I + D G GI P +++ +F       Q  ++  G               G G GL +C
Sbjct: 317 LEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMC 376

Query: 898 RQLANMMNGTMRLESKVGVGSKFTFTLPLPQTK 930
           +    M +G++ ++S  G G+     L  P+ K
Sbjct: 377 KAYLEMFDGSLDIQSLYGWGTDVYIKLKGPENK 409

>Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042C -
           Hypothetical ORF [contig 197] FULL
          Length = 414

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 38/93 (40%), Gaps = 15/93 (16%)

Query: 853 ISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYG---------------GTGLGLSIC 897
           + I + D G GI P +++ +F        T ++  G               G G GL +C
Sbjct: 319 LKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVIPGADVCNVSGMGFGLPMC 378

Query: 898 RQLANMMNGTMRLESKVGVGSKFTFTLPLPQTK 930
           +    M NGT+ ++S  G G+     L  P  K
Sbjct: 379 KAYMEMFNGTLDIQSLWGWGTDAYIYLKGPDPK 411

>Ecym_4378 Chr4 (798444..799775) [1332 bp, 443 aa] {ON} similar to
           Ashbya gossypii ADL116C
          Length = 443

 Score = 35.8 bits (81), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 48/118 (40%), Gaps = 27/118 (22%)

Query: 831 PGSDEDEGGNLGKPIENPKTWV-----ISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSR 885
           PG+D  E     KPIE   T V     + + + D G GI P +++ +F       +  ++
Sbjct: 325 PGNDVAE-----KPIE--VTIVRSHEDLEVRIRDFGGGIPPDVEDKMFDYSYSTSEKDAK 377

Query: 886 QYG---------------GTGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQ 928
             G               G G GL +C+    M NG + ++S  G G+     L  P+
Sbjct: 378 DTGMSAYIIPGQDVSNVSGMGFGLPLCKAYLEMFNGQLDIQSLWGWGTDVYIKLKGPK 435

>CAGL0L00869g Chr12 complement(107233..108492) [1260 bp, 419 aa]
           {ON} similar to uniprot|P40530 Saccharomyces cerevisiae
           YIL042c
          Length = 419

 Score = 35.8 bits (81), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 39/93 (41%), Gaps = 15/93 (16%)

Query: 853 ISIEVEDTGPGIDPSLQESVF---HPFVQGDQTLSRQ------------YGGTGLGLSIC 897
           + I + D G GI P+++  +F   +  V+ D+  S                G G GL +C
Sbjct: 319 LEIRIRDFGGGIPPNVESHIFEYSYTTVESDKKESGASAYVIPGEDINIVSGMGFGLPMC 378

Query: 898 RQLANMMNGTMRLESKVGVGSKFTFTLPLPQTK 930
           +    M +G + ++S  G G+     L  P  K
Sbjct: 379 KAYIEMFDGKLDIQSLWGWGTDVYIKLKGPTKK 411

>TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.222
           YIL042C
          Length = 394

 Score = 35.4 bits (80), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 15/81 (18%)

Query: 853 ISIEVEDTGPGIDPSLQESVFH-------------PFVQGDQTLSR--QYGGTGLGLSIC 897
           +SI V D G GI P  +  +               P  Q +Q  +   +  G G GL +C
Sbjct: 301 LSIRVRDHGGGIPPEREPFILDYAYTSEVNKHEGDPATQVNQVNADVPRVAGLGFGLPLC 360

Query: 898 RQLANMMNGTMRLESKVGVGS 918
           R  A +  G++ ++S  G+G+
Sbjct: 361 RMYAELFGGSLSIQSLWGLGT 381

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4.385
            YJR147W
          Length = 791

 Score = 35.8 bits (81), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 59/128 (46%), Gaps = 19/128 (14%)

Query: 1086 DTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKE-LTSKGGNYNMIFM 1144
            D    IL+++ + +  E  K +L     E   +  D  + + K KE + +K   Y+++ +
Sbjct: 489  DKGFHILIIDADPMFIERCKTVL-----EQYRITVDIMQDWPKTKEKILNKC--YDLVII 541

Query: 1145 DVQM-----PKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIK 1199
            D  +     P ++ +LS+      + Y  PI+ +T+  +D  +   L+ G+N  L KP  
Sbjct: 542  DAHVKFLNVPILESMLSS------IQYHPPIILMTSSLNDQQLIFYLQHGINSILEKPFH 595

Query: 1200 RPKLKTIL 1207
              KL   L
Sbjct: 596  SHKLLKFL 603

>KLLA0F14256g Chr6 (1321231..1324131) [2901 bp, 966 aa] {ON} similar
            to uniprot|P12954 Saccharomyces cerevisiae YJL092W HPR5
            DNA helicase and DNA-dependent ATPase involved in DNA
            repair required for proper timing of commitment to
            meiotic recombination and the transition from Meiosis I
            to Meiosis II potential Cdc28p substrate
          Length = 966

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 40/69 (57%), Gaps = 8/69 (11%)

Query: 1070 ATSSRNVPTIQDNDKNDTSIKIL--VVEDNHVNQEVI----KRMLNLEGIENIELACDGQ 1123
            +T+ R + +  D D+   S+++L  + E N +N + I    KR +NL  +E ++L C+  
Sbjct: 441  STTIRKIKSAFDKDRCRNSLEVLKELCESNDLNNQKISAALKRFINL--VEKLKLKCEEY 498

Query: 1124 EAFDKVKEL 1132
            + +D +KEL
Sbjct: 499  DTYDGLKEL 507

>Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON}
            YFL033C (REAL)
          Length = 1758

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 56/111 (50%), Gaps = 8/111 (7%)

Query: 1104 IKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRD 1163
            I R    + +EN+        A D++    + G ++++I   +++PK+  +   +++R+ 
Sbjct: 1633 IHRYRVAKDLENLGCTVVSVGAGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLRQT 1692

Query: 1164 LGYKS--PIVALTAFADDSNIKECLESGM-NGFLSKPIKRPKLKTILTEFC 1211
             G  S  PIVA+T +      +E + S + +  L KP+   +LK ++ ++ 
Sbjct: 1693 NGANSTTPIVAITNY-----FQEAITSKVFDDVLEKPVNLDELKKLVAKYA 1738

>YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}
            RIM15Glucose-repressible protein kinase involved in
            signal transduction during cell proliferation in response
            to nutrients, specifically the establishment of
            stationary phase; identified as a regulator of IME2;
            substrate of Pho80p-Pho85p kinase
          Length = 1770

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/110 (20%), Positives = 54/110 (49%), Gaps = 6/110 (5%)

Query: 1104 IKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRD 1163
            I R    + +EN+        A D++    + G ++++I   +++PK+  +   +++++ 
Sbjct: 1645 IHRYRVTKDLENLGCTVVSVGAGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLKQT 1704

Query: 1164 LGYKS--PIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFC 1211
             G  S  PIVA+T +  ++      +      L KP+K  +LK ++ ++ 
Sbjct: 1705 NGANSTTPIVAITNYFQEAATSRVFDD----VLEKPVKLDELKKLVAKYA 1750

>Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556)
            [4554 bp, 1517 aa] {ON}
            (101912..102910,102960..102968,103011..106556) [4554 nt,
            1518 aa]
          Length = 1517

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 53/113 (46%), Gaps = 12/113 (10%)

Query: 1104 IKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRD 1163
            I R     G+E++        A D++    + G  +++I   +++PK+  +   K+++  
Sbjct: 1394 IHRYCTTSGLESLGCTVVAVGAGDELVRRATSGVKFDLIITALRIPKLGAVDIVKLLKHT 1453

Query: 1164 LGYKS--PIVALTAFADDSNIKECLESGMNGF---LSKPIKRPKLKTILTEFC 1211
             G  S  PIVA T + +++       S  N F   L KPI    L+ +++++ 
Sbjct: 1454 NGINSTTPIVAATCYFEEA-------SNTNVFSDVLEKPISIQTLRKLISKYA 1499

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
            YMR001C (REAL)
          Length = 705

 Score = 33.5 bits (75), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 1154 LLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR------PKLKTIL 1207
            LLS   I + + + + +  +  F DDSN+   LE   NG L + +KR      P+++   
Sbjct: 126  LLSEIQIHKSMAHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLSEPEVRFFT 185

Query: 1208 TEFCAA 1213
            T+ C A
Sbjct: 186  TQICGA 191

>Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON}
            YFL033C (REAL)
          Length = 1760

 Score = 33.1 bits (74), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 24/111 (21%), Positives = 56/111 (50%), Gaps = 8/111 (7%)

Query: 1104 IKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRD 1163
            I R    + +EN+        A D++    + G ++++I   +++PK+  +   +++++ 
Sbjct: 1635 IHRYRVTKDLENLGCTVVSVGAGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLKQT 1694

Query: 1164 LGYKS--PIVALTAFADDSNIKECLESGM-NGFLSKPIKRPKLKTILTEFC 1211
             G  S  PIVA+T +      +E + S + +  L KP+   +LK ++ ++ 
Sbjct: 1695 NGANSTTPIVAITNY-----FQEAITSKVFDDVLEKPVNLDELKKLVAKYA 1740

>KLTH0A03718g Chr1 complement(321327..322751) [1425 bp, 474 aa] {ON}
            similar to uniprot|P40533 Saccharomyces cerevisiae
            YIL039W Hypothetical ORF
          Length = 474

 Score = 33.1 bits (74), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 36/82 (43%), Gaps = 3/82 (3%)

Query: 1062 PFLQSTGTATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNL---EGIENIEL 1118
            PF +  G  T         D+   +   + L+   NH++++V KR+LNL    G   I L
Sbjct: 316  PFYKKEGLCTDGELFRYYPDDYPREPYKQNLLRSQNHLSEDVTKRVLNLIFDNGKPGIIL 375

Query: 1119 ACDGQEAFDKVKELTSKGGNYN 1140
                 E  + V    SK G++N
Sbjct: 376  TGHDHEGCETVYNKDSKTGDWN 397

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
            CDC5Polo-like kinase with multiple functions in mitosis
            and cytokinesis through substrate phosphorylation, also
            functions in adaptation to DNA damage during meiosis; has
            similarity to Xenopus Plx1 and S. pombe Plo1p; possible
            Cdc28p substrate
          Length = 705

 Score = 33.1 bits (74), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 1154 LLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR------PKLKTIL 1207
            LLS   I + + + + +  +  F DDSN+   LE   NG L + +KR      P+++   
Sbjct: 126  LLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFT 185

Query: 1208 TEFCAA 1213
            T+ C A
Sbjct: 186  TQICGA 191

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
            YMR001C (REAL)
          Length = 705

 Score = 33.1 bits (74), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 1154 LLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR------PKLKTIL 1207
            LLS   I + + + + +  +  F DDSN+   LE   NG L + +KR      P+++   
Sbjct: 126  LLSEIQIHKSMAHPNIVQFVDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFT 185

Query: 1208 TEFCAA 1213
            T+ C A
Sbjct: 186  TQICGA 191

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
            YMR001C (REAL)
          Length = 705

 Score = 32.7 bits (73), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 1154 LLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR------PKLKTIL 1207
            LLS   I + + + + +  +  F DDSN+   LE   NG L + +KR      P+++   
Sbjct: 126  LLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFT 185

Query: 1208 TEFCAA 1213
            T+ C A
Sbjct: 186  TQICGA 191

>Kpol_1072.42 s1072 complement(94079..95632) [1554 bp, 517 aa] {ON}
           complement(94079..95632) [1554 nt, 518 aa]
          Length = 517

 Score = 32.7 bits (73), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 7/66 (10%)

Query: 110 LSVVQKFLSSSNLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFP-----LSTDTP 164
           L + +KFL +  + Y+ ++    F T+L  +N    D I ED+L+ +FP     ++    
Sbjct: 210 LDIARKFLKTHGVLYL-ELKTQHFITILENSNEAI-DFIKEDILNQIFPPDLININDKNM 267

Query: 165 LPSSLE 170
           +PS +E
Sbjct: 268 IPSEIE 273

>Kwal_23.4139 s23 complement(587353..589359) [2007 bp, 668 aa] {ON}
           YDL074C (BRE1) - putative coiled-coil protein with
           RING-finger and myosin-like domains [contig 0] FULL
          Length = 668

 Score = 32.7 bits (73), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 8/86 (9%)

Query: 472 GSLNHDLLAPNSLRNNDTDRSSNRSHILTT-SANLTEAR---LPDYRRLFSDE---LSDL 524
            S NH  + P    N+D +    +  +LT  +A +T+A    L  ++++  D+    S L
Sbjct: 277 ASNNHQGVEPQYSPNSDREALQRKIQVLTKENAEITQANDSYLSKFQQMIQDKEIFTSKL 336

Query: 525 TETFNTMTDALDQHYALLE-DRVRAR 549
           +  F T  DAL +H A+LE D VR R
Sbjct: 337 STEFQTAQDALKKHNAMLEKDLVRIR 362

>Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON}
            YFL033C (REAL)
          Length = 1753

 Score = 32.7 bits (73), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 23/111 (20%), Positives = 55/111 (49%), Gaps = 8/111 (7%)

Query: 1104 IKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRD 1163
            I R    + +EN+        A D++    + G ++++I   +++PK+  +   +++++ 
Sbjct: 1628 IHRYRVAKDLENLGCTVVSVGAGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLKQT 1687

Query: 1164 LGYKS--PIVALTAFADDSNIKECLES-GMNGFLSKPIKRPKLKTILTEFC 1211
             G  S  PIV++T +      +E + S   +  L KP+   +LK ++ ++ 
Sbjct: 1688 NGVNSTTPIVSITNY-----FQEAIASKAFDDVLEKPVNLDELKRLVAKYA 1733

>Suva_2.710 Chr2 (1247622..1248884) [1263 bp, 421 aa] {ON} YDR528W
            (REAL)
          Length = 421

 Score = 32.0 bits (71), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 39/70 (55%), Gaps = 3/70 (4%)

Query: 1038 SEKKTVPPKHRSREESLGSVNLDRPFLQSTGTAT---SSRNVPTIQDNDKNDTSIKILVV 1094
            S++ + PP++R R +   +++ D  FL+   +A    S+ + PT +D+ +N    K++  
Sbjct: 12   SKEFSTPPRNRHRHKRSFAISGDFEFLKQPTSAPALPSACDSPTFEDSSRNANGAKLMAF 71

Query: 1095 EDNHVNQEVI 1104
             D+H +  +I
Sbjct: 72   NDSHNDSALI 81

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 121,910,881
Number of extensions: 5338265
Number of successful extensions: 17271
Number of sequences better than 10.0: 152
Number of HSP's gapped: 17908
Number of HSP's successfully gapped: 182
Length of query: 1230
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1109
Effective length of database: 39,606,813
Effective search space: 43923955617
Effective search space used: 43923955617
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)