Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_9.205.702ON1682168281540.0
YIL149C (MLP2)5.702ON1679168153150.0
Skud_9.195.702ON1680168350160.0
Suva_9.395.702ON1682168547580.0
TDEL0B021905.702ON1810142211641e-131
SAKL0E14916g5.702ON1779138610431e-115
Skud_11.3345.702ON1885158010391e-114
ZYRO0G06600g5.702ON1820138510141e-111
Smik_11.3585.702ON187813729671e-106
Kwal_55.196975.702ON176015019331e-101
Suva_11.3315.702ON189813969281e-101
YKR095W (MLP1)5.702ON187513828804e-95
Ecym_40185.702ON176913908464e-91
NCAS0A032005.702ON178818288261e-88
AFR286W5.702ON175814537474e-79
CAGL0G02497g5.702ON178016387431e-78
KLLA0A00594g5.702ON17489405912e-60
NDAI0F002905.702ON15547894703e-46
KAFR0D022205.702ON16746694453e-43
KAFR0H002105.702ON14549424131e-39
KNAG0L021405.702ON16084113451e-31
KLTH0E01056g5.702ON17715443092e-27
KNAG0C065905.702ON16515382895e-25
Kpol_1043.705.702ON13213352555e-21
TPHA0D046105.702ON11832292072e-15
NDAI0E050405.702ON19733341714e-11
TPHA0E002305.702ON12842521615e-10
TBLA0E017305.702ON1820341105e-04
Kpol_2001.755.702ON10062891088e-04
KLLA0F13420g8.443ON1336148930.044
NCAS0F030505.383ON145670821.0
Ecym_50207.21ON790304811.1
Kpol_1031.155.414ON92988811.1
KLTH0G13750g8.259ON139991792.0
Ecym_71018.604ON717310782.3
TBLA0B025803.330ON1133177792.4
NCAS0G002305.702ON173518783.1
KNAG0M012605.123ON76641764.8
AER045C4.238ON1292374765.1
KAFR0B057708.331ON256077748.8
YOR195W (SLK19)8.604ON821109739.2
TPHA0A011508.604ON818115739.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_9.20
         (1682 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...  3145   0.0  
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...  2051   0.0  
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...  1936   0.0  
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...  1837   0.0  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   452   e-131
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   406   e-115
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   404   e-114
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   395   e-111
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   377   e-106
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   363   e-101
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   362   e-101
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   343   4e-95
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   330   4e-91
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   322   1e-88
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   292   4e-79
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   290   1e-78
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   232   2e-60
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   185   3e-46
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   176   3e-43
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   163   1e-39
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   137   1e-31
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   123   2e-27
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   115   5e-25
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   102   5e-21
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    84   2e-15
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...    70   4e-11
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...    67   5e-10
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...    47   5e-04
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    46   8e-04
KLLA0F13420g Chr6 (1240135..1244145) [4011 bp, 1336 aa] {ON} uni...    40   0.044
NCAS0F03050 Chr6 (607255..611625) [4371 bp, 1456 aa] {ON} Anc_5....    36   1.0  
Ecym_5020 Chr5 complement(43098..45470) [2373 bp, 790 aa] {ON} s...    36   1.1  
Kpol_1031.15 s1031 (38596..41385) [2790 bp, 929 aa] {ON} (38596....    36   1.1  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...    35   2.0  
Ecym_7101 Chr7 (194579..196732) [2154 bp, 717 aa] {ON} similar t...    35   2.3  
TBLA0B02580 Chr2 (588481..591882) [3402 bp, 1133 aa] {ON} Anc_3....    35   2.4  
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...    35   3.1  
KNAG0M01260 Chr13 complement(231670..233970) [2301 bp, 766 aa] {...    34   4.8  
AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON} ...    34   5.1  
KAFR0B05770 Chr2 (1190270..1197952) [7683 bp, 2560 aa] {ON} Anc_...    33   8.8  
YOR195W Chr15 (712866..715331) [2466 bp, 821 aa] {ON}  SLK19Kine...    33   9.2  
TPHA0A01150 Chr1 complement(224257..226713) [2457 bp, 818 aa] {O...    33   9.3  

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score = 3145 bits (8154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1595/1682 (94%), Positives = 1595/1682 (94%)

Query: 1    MEDKISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRIX 60
            MEDKISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRI 
Sbjct: 1    MEDKISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRIS 60

Query: 61   XXXXXXXXXXXQKNIASKELSHLQDQLMQDRERCRRKIDALNKQLDSSRDAIKRLNDEKD 120
                       QKNIASKELSHLQDQLMQDRERCRRKIDALNKQLDSSRDAIKRLNDEKD
Sbjct: 61   KLSKLLNESSEQKNIASKELSHLQDQLMQDRERCRRKIDALNKQLDSSRDAIKRLNDEKD 120

Query: 121  AKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQLKYDTIVQE 180
            AKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQLKYDTIVQE
Sbjct: 121  AKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQLKYDTIVQE 180

Query: 181  KELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESALSYSQLLLDQ 240
            KELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESALSYSQLLLDQ
Sbjct: 181  KELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESALSYSQLLLDQ 240

Query: 241  NKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFERDHSSGEIG 300
            NKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFERDHSSGEIG
Sbjct: 241  NKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFERDHSSGEIG 300

Query: 301  KDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKATVDTNGASHTV 360
            KDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKATVDTNGASHTV
Sbjct: 301  KDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKATVDTNGASHTV 360

Query: 361  GKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKSLEHELKRST 420
            GKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKSLEHELKRST
Sbjct: 361  GKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKSLEHELKRST 420

Query: 421  ELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQVKVLLLNTSAIQKTTL 480
            ELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQVKVLLLNTSAIQKTTL
Sbjct: 421  ELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQVKVLLLNTSAIQKTTL 480

Query: 481  PLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINELQEKNVELLYCIRTLADKL 540
            PLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINELQEKNVELLYCIRTLADKL
Sbjct: 481  PLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINELQEKNVELLYCIRTLADKL 540

Query: 541  EFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINILLRERDSYKLLASSKENN 600
            EFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINILLRERDSYKLLASSKENN
Sbjct: 541  EFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINILLRERDSYKLLASSKENN 600

Query: 601  VNVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLRKELTTYKKLLCDKKIASQDFE 660
            VNVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLRKELTTYKKLLCDKKIASQDFE
Sbjct: 601  VNVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLRKELTTYKKLLCDKKIASQDFE 660

Query: 661  NFKMLAKEKESILETRVNNLKTDLEKQKLSVPSFVQDNKVRDSTELLQSRTKTEILMHEI 720
            NFKMLAKEKESILETRVNNLKTDLEKQKLSVPSFVQDNKVRDSTELLQSRTKTEILMHEI
Sbjct: 661  NFKMLAKEKESILETRVNNLKTDLEKQKLSVPSFVQDNKVRDSTELLQSRTKTEILMHEI 720

Query: 721  SSLKKETANSMVLKESLTRDLERCCKEKIQLQMKLKESEISLNEQKVNFDSKGIKYDARI 780
            SSLKKETANSMVLKESLTRDLERCCKEKIQLQMKLKESEISLNEQKVNFDSKGIKYDARI
Sbjct: 721  SSLKKETANSMVLKESLTRDLERCCKEKIQLQMKLKESEISLNEQKVNFDSKGIKYDARI 780

Query: 781  KQXXXXXXXXXXXXKSKAQEIXXXXXXXXXXXXWAQNTIDDTEEKLKSVLTELSRKEKTV 840
            KQ            KSKAQEI            WAQNTIDDTEEKLKSVLTELSRKEKTV
Sbjct: 781  KQLEESLERLRIELKSKAQEIKSLQSSKDSQLKWAQNTIDDTEEKLKSVLTELSRKEKTV 840

Query: 841  VTLSSKIENLDNELRENKLKYEFLNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEE 900
            VTLSSKIENLDNELRENKLKYEFLNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEE
Sbjct: 841  VTLSSKIENLDNELRENKLKYEFLNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEE 900

Query: 901  IISTNEKALKELNSQLASMKEDYDARIELECKEKLANXXXXXXXXXXXXXXXXXQPKLKE 960
            IISTNEKALKELNSQLASMKEDYDARIELECKEKLAN                 QPKLKE
Sbjct: 901  IISTNEKALKELNSQLASMKEDYDARIELECKEKLANEEELSLLRRELDEIRSLQPKLKE 960

Query: 961  GTVCLVKQSEKLRNQAEKIQEMKAKIDKMNWNVQVYKKEKTSQFQSIMKANKELSELVTR 1020
            GTVCLVKQSEKLRNQAEKIQEMKAKIDKMNWNVQVYKKEKTSQFQSIMKANKELSELVTR
Sbjct: 961  GTVCLVKQSEKLRNQAEKIQEMKAKIDKMNWNVQVYKKEKTSQFQSIMKANKELSELVTR 1020

Query: 1021 LEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSV 1080
            LEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSV
Sbjct: 1021 LEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSV 1080

Query: 1081 LIEKIGSVTEGSDGNEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQKNASLEKNI 1140
            LIEKIGSVTEGSDGNEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQKNASLEKNI
Sbjct: 1081 LIEKIGSVTEGSDGNEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQKNASLEKNI 1140

Query: 1141 NDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIYE 1200
            NDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIYE
Sbjct: 1141 NDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIYE 1200

Query: 1201 ELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIE 1260
            ELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIE
Sbjct: 1201 ELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIE 1260

Query: 1261 KLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRD 1320
            KLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRD
Sbjct: 1261 KLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRD 1320

Query: 1321 KLEQDLNSKNFKTVDLDTEPKEHTVQSGDLLRDQEKVASLPLIEEIESLKRELQVFKNAN 1380
            KLEQDLNSKNFKTVDLDTEPKEHTVQSGDLLRDQEKVASLPLIEEIESLKRELQVFKNAN
Sbjct: 1321 KLEQDLNSKNFKTVDLDTEPKEHTVQSGDLLRDQEKVASLPLIEEIESLKRELQVFKNAN 1380

Query: 1381 NSSDAFEKLRDNMXXXXXXXXXXRTKEFEKKLEEIVSKSKSTGKVADNSENIXXXXXXXX 1440
            NSSDAFEKLRDNM          RTKEFEKKLEEIVSKSKSTGKVADNSENI        
Sbjct: 1381 NSSDAFEKLRDNMEEEKNKIINERTKEFEKKLEEIVSKSKSTGKVADNSENIETLKKEWL 1440

Query: 1441 XXXXXXXXXXXXXXXXNLKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSLTFSC 1500
                            NLKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSLTFSC
Sbjct: 1441 KEYEEETIRRIREAEENLKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSLTFSC 1500

Query: 1501 DRKETNDDPDEDLWNSPSKGNSERPSVITDFMKQKNIKVQEQLKKAKNGVFFGDSRSSSM 1560
            DRKETNDDPDEDLWNSPSKGNSERPSVITDFMKQKNIKVQEQLKKAKNGVFFGDSRSSSM
Sbjct: 1501 DRKETNDDPDEDLWNSPSKGNSERPSVITDFMKQKNIKVQEQLKKAKNGVFFGDSRSSSM 1560

Query: 1561 NKENSALVKVNDDKAASTFSFGKPLFPSTTTSFQSFQNPFTQSTIDSNTGVSLPTFNIRT 1620
            NKENSALVKVNDDKAASTFSFGKPLFPSTTTSFQSFQNPFTQSTIDSNTGVSLPTFNIRT
Sbjct: 1561 NKENSALVKVNDDKAASTFSFGKPLFPSTTTSFQSFQNPFTQSTIDSNTGVSLPTFNIRT 1620

Query: 1621 DLLAGVATDTSKTDGLANNSPDEEEITEIGSTLKRPNEEDASSDPNTKKVKESPEDEPAS 1680
            DLLAGVATDTSKTDGLANNSPDEEEITEIGSTLKRPNEEDASSDPNTKKVKESPEDEPAS
Sbjct: 1621 DLLAGVATDTSKTDGLANNSPDEEEITEIGSTLKRPNEEDASSDPNTKKVKESPEDEPAS 1680

Query: 1681 KD 1682
            KD
Sbjct: 1681 KD 1682

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score = 2051 bits (5315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1100/1681 (65%), Positives = 1306/1681 (77%), Gaps = 5/1681 (0%)

Query: 1    MEDKISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRIX 60
            MEDKISEFL+VPFESLQG+ Y VLRKL+KKI  FE  EEEVT+LNVLVDEIKSQYYSRI 
Sbjct: 1    MEDKISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRIS 60

Query: 61   XXXXXXXXXXXQKNIASKELSHLQDQLMQDRERCRRKIDALNKQLDSSRDAIKRLNDEKD 120
                       QKN A +EL+ L+DQL ++R R RR+IDAL KQL  S +A++ +NDEK 
Sbjct: 61   KLKQLLDESSEQKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVNDEKR 120

Query: 121  AKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQLKYDTIVQE 180
             KEE  I QS+ Q  +S+ + L+KENKLLRRKLMEMENILQ CKSN++SLQLKYDT VQE
Sbjct: 121  VKEEYDIWQSRDQGNDSLNDDLNKENKLLRRKLMEMENILQRCKSNAISLQLKYDTSVQE 180

Query: 181  KELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESALSYSQLLLDQ 240
            KELMLQ+KK  EEKLSS++ KTL +E TK+S + NLEEKLYQ Q++ ES  +Y++ LL+Q
Sbjct: 181  KELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVFTYNKFLLNQ 240

Query: 241  NKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFERDHSSGEIG 300
            NKQLS SVEEK+LE+KNLKDTA +EK EFSKEMTLQK+MNDLL SQL S E+D S   I 
Sbjct: 241  NKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIE 300

Query: 301  KDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKATVDTNGASHTV 360
            K+DDN C++P+H +V DEL++TK++ +KS++ECQRLQNI+ D  +E++AT+ T+  S TV
Sbjct: 301  KNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKEEEATMTTSAVSPTV 360

Query: 361  GKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKSLEHELKRST 420
            GKLFSDIKVL++QLIKER+QKFQLQNQ+EDFILELEHKTPEL+SFKERTKSLEHELKRST
Sbjct: 361  GKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEHELKRST 420

Query: 421  ELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQVKVLLLNTSAIQKTTL 480
            ELLET+S+ KRK ERE+TSLRQKIN CEANIH LVKQRLDLARQVK+LLLNTSAIQ+T  
Sbjct: 421  ELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETAS 480

Query: 481  PLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINELQEKNVELLYCIRTLADKL 540
            PLS+D+LISLRKILES + VNEND+QAII+ERLVEF+N+NELQEKNVELL CIR LADKL
Sbjct: 481  PLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVNELQEKNVELLNCIRILADKL 540

Query: 541  EFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINILLRERDSYKLLASSKENN 600
            E +EGK+D TL +VE QTIKEAKDAIIELEN N KME+RINILLRERDSYKLLAS++EN 
Sbjct: 541  ENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDSYKLLASTEENK 600

Query: 601  VNVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLRKELTTYKKLLCDKKIASQDFE 660
             N N+    E + EKKI+ELEAELSSTKVE+SA+IQNLRKEL  YKK  C KK   +DFE
Sbjct: 601  ANTNSVTSMEAAREKKIRELEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFE 660

Query: 661  NFKMLAKEKESILETRVNNLKTDLEKQKLSVPSFVQDNKVRDSTELLQSRTKTEILMHEI 720
            NFK LAKEKE +LE  +++LK +LEKQK  VPS++   K R STEL QSR K + L +EI
Sbjct: 661  NFKGLAKEKERMLEEAIDHLKAELEKQKSWVPSYIHVEKERASTELSQSRIKIKSLEYEI 720

Query: 721  SSLKKETANSMVLKESLTRDLERCCKEKIQLQMKLKESEISLNEQKVNFDSKGIKYDARI 780
            S LKKETA+ +  KESLTRD E+CCKEK +LQM+LKESEIS NE K++F SK  +Y A+I
Sbjct: 721  SKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKI 780

Query: 781  KQXXXXXXXXXXXXKSKAQEIXXXXXXXXXXXXWAQNTIDDTEEKLKSVLTELSRKEKTV 840
            K+            +SK QEI            WAQNTIDDTE K+KS+LTELS KE T+
Sbjct: 781  KELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTI 840

Query: 841  VTLSSKIENLDNELRENKLKYEFLNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEE 900
              LSS+IENLD ELR+ K +Y+FL+  SDASTL+P LRKELEQ Q++LKDA+SQ++ YEE
Sbjct: 841  EKLSSEIENLDKELRKTKFQYKFLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEE 900

Query: 901  IISTNEKALKELNSQLASMKEDYDARIELECKEKLANXXXXXXXXXXXXXXXXXQPKLKE 960
            IIS+NE AL EL ++LA  KE+YDA+IELE KEK A                  QPKLKE
Sbjct: 901  IISSNENALIELKNELAKTKENYDAKIELEKKEKWAREEDLSRLRGELGEIRALQPKLKE 960

Query: 961  GTVCLVKQSEKLRNQAEKIQEMKAKIDKMNWNVQVYKKEKTSQFQSIMKANKELSELVTR 1020
            G +  V+QSEKLRN+ E+IQ+M  KI+KM+  VQ+ KK++ SQ+QS MK NK+LSELV R
Sbjct: 961  GALHFVQQSEKLRNEVERIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIR 1020

Query: 1021 LEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSV 1080
            LEK+A D Q EL K KSSL+  QDLLD HE+KWMEEKADYERELISNIEQTESLRVENSV
Sbjct: 1021 LEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSV 1080

Query: 1081 LIEKIGSVTEGSDGNEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQKNASLEKNI 1140
            LIEK+   T  ++G++D+LKLVS FSNLRHERNSLETKLTTCKR+LA VKQKN SLEK I
Sbjct: 1081 LIEKVDD-TAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTI 1139

Query: 1141 NDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIYE 1200
            NDLQ  Q  S+ E QCSAVIIDEF DITKE+ QVN+LKENNAILQKSLKNVTEKNREIY+
Sbjct: 1140 NDLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYK 1199

Query: 1201 ELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIE 1260
            +L  RQEE+S+L+ DLI+TKEQVS+N+NKIL+YESEM+QCKQRY DLS QQ++ QKK IE
Sbjct: 1200 QLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIE 1259

Query: 1261 KLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRD 1320
            KL +EISD K KL  AEN   +LENKFNRLKKQAHEKLDASKKQQ ALTNEL ELKA++D
Sbjct: 1260 KLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKD 1319

Query: 1321 KLEQDLNSKNFKTVDLDTEPKEHTVQSGDLLRDQEKVASLPLIEEIESLKRELQVFKNAN 1380
            KLEQDL+ +N K +DLDT+ K H +QS D+ RD EK     L+EEIESLK+ELQ+FK AN
Sbjct: 1320 KLEQDLHFENAKVIDLDTKLKAHELQSEDVSRDHEKDTYRTLMEEIESLKKELQIFKTAN 1379

Query: 1381 NSSDAFEKLRDNMXXXXXXXXXXRTKEFEKKLEEIVSKSKSTGKVADNSENIXXXXXXXX 1440
            +SSDAFEKL+ NM          RTKEFEKKL+E ++KS S+   A+ S++I        
Sbjct: 1380 SSSDAFEKLKVNMEKEKDRIIDERTKEFEKKLQETLNKSTSSE--AEYSKDIETLKKEWL 1437

Query: 1441 XXXXXXXXXXXXXXXXNLKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSLTFSC 1500
                            NLKKRIRLPSEERIQKIISKRKEELEEEF++KLKENA SLTF  
Sbjct: 1438 KEYEDETLRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEEEFRKKLKENAGSLTF-L 1496

Query: 1501 DRKETNDDPDEDLWNSPSKGNSERPSVITDFMKQKNIKVQEQLKKAKNGVFFGDSRSSSM 1560
            D K + +D +E+LWNSPSKGNSERPS +  F+ QKN+K QEQLK  KN V F DS+S   
Sbjct: 1497 DNKGSGEDAEEELWNSPSKGNSERPSAVAGFINQKNLKPQEQLKNVKNDVSFNDSQSMVT 1556

Query: 1561 NKENSAL-VKVNDDKAASTFSFGKPLFPSTTTSFQSFQNPFTQSTIDSNTGVSLPTFNIR 1619
            NKEN+ +      +KA  TFSFGKP F S T+S QSFQNPFT S  + NT   L T NI+
Sbjct: 1557 NKENNIVDSSAAGNKAIPTFSFGKPFFSSNTSSLQSFQNPFTASQSNINTNAPLRTLNIQ 1616

Query: 1620 TDLLAGVATDTSKTDGLANNSPDEEEITEIGSTLKRPNEEDASSDPNTKKVKESPEDEPA 1679
             ++    A + S    L NNS D  +ITEIGST KRP E   SSDP+TKKVKESP ++ A
Sbjct: 1617 PEVAVKAAINFSNVTDLTNNSTDGAKITEIGSTSKRPIESGTSSDPDTKKVKESPANDQA 1676

Query: 1680 S 1680
            S
Sbjct: 1677 S 1677

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score = 1936 bits (5016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1033/1683 (61%), Positives = 1272/1683 (75%), Gaps = 4/1683 (0%)

Query: 1    MEDKISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRIX 60
            MEDKISEFLHVP ESL+GI +S L++L+KKI  FE  E+EVT+LNV VDEIKSQYY+RI 
Sbjct: 1    MEDKISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRIS 60

Query: 61   XXXXXXXXXXXQKNIASKELSHLQDQLMQDRERCRRKIDALNKQLDSSRDAIKRLNDEKD 120
                       +K I SK ++ LQDQL ++R R  RKIDALNKQL++S + IK+L DE+ 
Sbjct: 61   KLTKLLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNKQLNASHETIKKLEDEEG 120

Query: 121  AKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQLKYDTIVQE 180
            AKEE+   Q   +N +S ++VLDKENKLL+RKL+EMENILQ+CKSN+VSLQ KYDT  QE
Sbjct: 121  AKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVCKSNAVSLQFKYDTASQE 180

Query: 181  KELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESALSYSQLLLDQ 240
            KEL LQNKKWTEE+LSS N K L DE TK S ++NLEEKL Q Q + ES  +Y++ LLDQ
Sbjct: 181  KELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENESVSTYNKFLLDQ 240

Query: 241  NKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFERDHSSGEIG 300
            NK+LSH VEEK+LEIKNLKDTA  EK+EFSKEMTLQK MNDLL SQL SFER HS     
Sbjct: 241  NKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTSFERGHSLRPKE 300

Query: 301  KDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKATVDTNGASHTV 360
            K DD LCK+P+H +V +EL++ K++ +KS++ECQ L+NI+SD ++E+  TV+TN A+ TV
Sbjct: 301  KGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSDCIEENGTTVNTNTAAPTV 360

Query: 361  GKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKSLEHELKRST 420
            GKLFS+IK L++QL+KERSQKFQ+QNQ++DF+LELEHKTP LVSFKERT+ LEHELK ST
Sbjct: 361  GKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFKERTELLEHELKCST 420

Query: 421  ELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQVKVLLLNTSAIQKTTL 480
            ELLET+S+AKRKDE++LTSL QKINS EANIH LV+QRLDLARQVK+LL N SAIQ TT 
Sbjct: 421  ELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLARQVKILLSNISAIQTTTS 480

Query: 481  PLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINELQEKNVELLYCIRTLADKL 540
            PLS D+L+SLRK+LES + VNE D+Q II+E+LVEF NI+ELQEKN+ELL CIR LADKL
Sbjct: 481  PLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKNIDELQEKNMELLDCIRILADKL 540

Query: 541  EFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINILLRERDSYKLLASSKENN 600
            E +EG+ D T+A++E QTIKEAK+AIIE+E+ N K+  R+NIL RERDSYKLLAS+ +N 
Sbjct: 541  ETNEGEADKTVAKIENQTIKEAKEAIIEMESINSKLALRVNILTRERDSYKLLASANDNK 600

Query: 601  VNVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLRKELTTYKKLLCDKKIASQDFE 660
             + + +  TE ++EKKI+EL+++LSST+VESSA+IQNL  +L TYKK   D KIA Q+FE
Sbjct: 601  THADTEGITEATYEKKIRELQSKLSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFE 660

Query: 661  NFKMLAKEKESILETRVNNLKTDLEKQKLSVPSFVQDNKVRDSTELLQSRTKTEILMHEI 720
            NFK+L  EKE++L+ R+N+LKT LEKQ+LS    VQD K  + T+L  S  K   L +EI
Sbjct: 661  NFKVLVAEKEAMLQERINHLKTQLEKQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYEI 720

Query: 721  SSLKKETANSMVLKESLTRDLERCCKEKIQLQMKLKESEISLNEQKVNFDSKGIKYDARI 780
            S+LKKE    + +KESLTRDLERCCKEK+QL +KL ESE S NEQ + F SK ++Y  RI
Sbjct: 721  SNLKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRI 780

Query: 781  KQXXXXXXXXXXXXKSKAQEIXXXXXXXXXXXXWAQNTIDDTEEKLKSVLTELSRKEKTV 840
            K             +SK QEI            WAQNTIDDTE+ LKSV  ELS KE T+
Sbjct: 781  KVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTI 840

Query: 841  VTLSSKIENLDNELRENKLKYEFLNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEE 900
              LS +IENL NELR  KL+Y+FL+NTSD +TL+P LRKEL+QTQ+ELKDAHSQ++ YEE
Sbjct: 841  GRLSLEIENLGNELRMTKLQYKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYEE 900

Query: 901  IISTNEKALKELNSQLASMKEDYDARIELECKEKLANXXXXXXXXXXXXXXXXXQPKLKE 960
            IISTNE  LKELN +L   KED + +I+LE KEK A                  QPKL+E
Sbjct: 901  IISTNENVLKELNGELKKAKEDCETKIQLENKEKGAKEEELSHLRKELDEIRCLQPKLRE 960

Query: 961  GTVCLVKQSEKLRNQAEKIQEMKAKIDKMNWNVQVYKKEKTSQFQSIMKANKELSELVTR 1020
            G   LV QSEK+ +QA++IQEMK KIDKM   ++ Y+KE++SQ+QS +K NK+LSE V R
Sbjct: 961  GASYLVLQSEKVGDQAQRIQEMKNKIDKMAAIIEAYQKEESSQYQSELKTNKDLSEWVMR 1020

Query: 1021 LEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSV 1080
            LEKEA D Q ELKK K SL+ TQ+LLD HEKKWMEEKADYERELISNIEQTESLRVENSV
Sbjct: 1021 LEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSV 1080

Query: 1081 LIEKIGSVTEGSDGNEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQKNASLEKNI 1140
            LIEKI   TEGS+ NE YL+LVS FSNLRHER+SLETKLTTCKRDLAL++QKNASLEK+I
Sbjct: 1081 LIEKIDGATEGSNSNEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSI 1140

Query: 1141 NDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIYE 1200
             DLQ      + ++QC AVIIDE+  I KEIAQVN+L+ENNAIL KSLKNVTEKN  IY+
Sbjct: 1141 GDLQRANTVPRNKVQCPAVIIDEYEKIIKEIAQVNILRENNAILHKSLKNVTEKNEAIYK 1200

Query: 1201 ELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIE 1260
            EL   QEE+S+L+  LI+TKEQVS+NANK+L YESE++QCKQRY DLS QQ+   K   E
Sbjct: 1201 ELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETE 1260

Query: 1261 KLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRD 1320
            KL++ I D + KLL+ +N   +LENKFNRLKKQAHEKLDASKKQQTALTNEL ELK  +D
Sbjct: 1261 KLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKD 1320

Query: 1321 KLEQDLNSKNFKTVDLDTEPKEHTVQSGDLLRDQEKVASLPLIEEIESLKRELQVFKNAN 1380
            KLE++L+++  K VDL+ + KEH +Q G++ +D + +A  P +EEIESLK+ELQVF+NAN
Sbjct: 1321 KLEENLHNEESKVVDLELKLKEHGLQVGEVSKDHDSIAFKPFVEEIESLKKELQVFRNAN 1380

Query: 1381 NSSDAFEKLRDNMXXXXXXXXXXRTKEFEKKLEEIVSKSKSTGKVADNSENIXXXXXXXX 1440
            ++SDAFEK+++NM          +TK+FEKKL++ V+KSKS     +NSE+I        
Sbjct: 1381 DASDAFEKIKNNMEEEKNKIIDEKTKDFEKKLQDAVNKSKSNESEVENSEHIEALKKEWL 1440

Query: 1441 XXXXXXXXXXXXXXXXNLKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSLTFSC 1500
                            NLKKRIRLPSEERIQKIISKRK ELE+EF+RKLKEN  SL FS 
Sbjct: 1441 KEYEEETVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLVFSG 1500

Query: 1501 DRKETNDDPDEDLWNSPSKGNSERPSVITDFMKQKNIKVQEQLKKAKNGVFFGDSRSSSM 1560
              +E  +D   +LWNSPSKG+SE+PSV+TD +KQKNIK+QEQLK  KN V F D R  S 
Sbjct: 1501 SNEEEAED---ELWNSPSKGSSEKPSVVTDLIKQKNIKLQEQLKNVKNAVTFNDKRPKSE 1557

Query: 1561 NKENSAL-VKVNDDKAASTFSFGKPLFPSTTTSFQSFQNPFTQSTIDSNTGVSLPTFNIR 1619
            NKEN+       D++  S FSFGKPLF S T+SFQSF NPFT S  + +T  SLPTFNI+
Sbjct: 1558 NKENNIPDSAAADNRVPSAFSFGKPLFSSNTSSFQSFHNPFTPSAANFSTDGSLPTFNIK 1617

Query: 1620 TDLLAGVATDTSKTDGLANNSPDEEEITEIGSTLKRPNEEDASSDPNTKKVKESPEDEPA 1679
            +   AG A +T KT   AN   +E ++ EIG+T KRP + D SSDP++KK KESPE++ A
Sbjct: 1618 SAFAAGTAGNTLKTSDPANVGINEAKVMEIGNTSKRPIQSDTSSDPDSKKFKESPENDLA 1677

Query: 1680 SKD 1682
             KD
Sbjct: 1678 PKD 1680

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score = 1837 bits (4758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 997/1685 (59%), Positives = 1264/1685 (75%), Gaps = 6/1685 (0%)

Query: 1    MEDKISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRIX 60
            MEDKISE+LHVP +SLQG+NYS+LR L K+ID FE  EEEVTRLNVL+DEIKSQYY+RI 
Sbjct: 1    MEDKISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRIS 60

Query: 61   XXXXXXXXXXXQKNIASKELSHLQDQLMQDRERCRRKIDALNKQLDSSRDAIKRLNDEKD 120
                       +KN++ KELS L + L  +R +C RKIDALNKQL++S++ I +LNDE+ 
Sbjct: 61   KLNELLGESSEEKNVSKKELSRLHNLLKNERSKCARKIDALNKQLNASKNTITKLNDERG 120

Query: 121  AKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQLKYDTIVQE 180
             KEE+ + +++HQN +  ++ L  ENKLLRRKL+EMENILQ CKSN++SL+LKYDT+VQE
Sbjct: 121  VKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSLKLKYDTVVQE 180

Query: 181  KELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESALSYSQLLLDQ 240
            KEL+L+NKKW EE+LS  + KTL D+ T+ S ++NLEE+L + Q D ES  + +Q LL Q
Sbjct: 181  KELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVSTNNQFLLAQ 240

Query: 241  NKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFERDHSSGEIG 300
            NKQLSHS+E+KILEIKNLKDT  IEK +FSKEMTLQK+MNDLL SQL SFE+++S     
Sbjct: 241  NKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFEKNYSLSARE 300

Query: 301  KDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKATVD-TNGASHT 359
            KD+D+ CK+  H NV D+L++TK+Q +KS+DECQRLQNI++D ++ED+A  D T+    +
Sbjct: 301  KDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAFDNTHNVDPS 360

Query: 360  VGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKSLEHELKRS 419
            V K+FSDIK L++QLIKER+QKFQLQNQME FI ELE KTPEL+SFKERT+SLE ELK S
Sbjct: 361  VNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESLEQELKNS 420

Query: 420  TELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQVKVLLLNTSAIQKTT 479
            T+LLETIS+AKRKDE+ELTSLRQKIN+CEANIH LVKQRLDLARQVK+LLLN SA+QK  
Sbjct: 421  TDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKA 480

Query: 480  LPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINELQEKNVELLYCIRTLADK 539
             PLS D+LISL+K+LESG   NE D+Q II+ERLVEFNN NELQEKN+ELL C+R LADK
Sbjct: 481  SPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNNTNELQEKNMELLNCVRVLADK 540

Query: 540  LEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINILLRERDSYKLLASSKEN 599
            LE HEGK+D +LA++E QTIKEAKDAIIELE+ N  +ESRI+IL RERDSYKLLAS+  N
Sbjct: 541  LENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRIDILSRERDSYKLLASANGN 600

Query: 600  NVNVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLRKELTTYKKLLCDKKIASQDF 659
             +  +A N TE ++ KKIKELE+ELS TKVE+SAV+Q L KEL T KK   + +IA Q+F
Sbjct: 601  KIYADAANKTEAANLKKIKELESELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEF 660

Query: 660  ENFKMLAKEKESILETRVNNLKTDLEKQKLSVPSFVQDNKVRDSTELLQSRTKTEILMHE 719
             NFK+LA EKE++L+TR+++LKT LEKQ+ S PS +  +   + TEL Q + KT+ LM E
Sbjct: 661  SNFKVLAIEKENLLQTRIDDLKTKLEKQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCE 720

Query: 720  ISSLKKETANSMVLKESLTRDLERCCKEKIQLQMKLKESEISLNEQKVNFDSKGIKYDAR 779
            IS+L K+  +   +KESLTRDLERCCKEK+QLQMKL ESE S NEQK+  DSK ++Y+ +
Sbjct: 721  ISNLSKKNTDLRCMKESLTRDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTK 780

Query: 780  IKQXXXXXXXXXXXXKSKAQEIXXXXXXXXXXXXWAQNTIDDTEEKLKSVLTELSRKEKT 839
            IK              SK QEI            WAQNTIDDTE+ +KS+ T+LS K+ T
Sbjct: 781  IKNLEKNCEELNNRLHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTT 840

Query: 840  VVTLSSKIENLDNELRENKLKYEFLNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYE 899
            +  LS ++++L+ EL++ KL+Y+ LNN+SDA+TL+ AL+KELE++Q++LKDAHSQ+  YE
Sbjct: 841  IRKLSLEMKDLEIELQKTKLQYKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYE 900

Query: 900  EIISTNEKALKELNSQLASMKEDYDARIELECKEKLANXXXXXXXXXXXXXXXXXQPKLK 959
            EIIST+E  LKELN QL   KE+   + +   +E  A                  QPKLK
Sbjct: 901  EIISTDENTLKELNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRGLQPKLK 960

Query: 960  EGTVCLVKQSEKLRNQAEKIQEMKAKIDKMNWNVQVYKKEKTSQFQSIMKANKELSELVT 1019
            EG + LV+QSEKL NQ ++IQ M  KIDKM   V+++++ +TSQ+Q+ +KANK+LS LV 
Sbjct: 961  EGALRLVQQSEKLGNQTQRIQAMNEKIDKMTTIVELHQEVETSQYQAKLKANKDLSALVL 1020

Query: 1020 RLEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENS 1079
            RLE E  D Q ELKK KSSLH TQ+LLD HE+KWMEEKADYERELISNIEQTESLRVENS
Sbjct: 1021 RLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENS 1080

Query: 1080 VLIEKIGSVTEGSDGNEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQKNASLEKN 1139
             L+EKI   T  ++G+++YLKLVS FS+LRHERN+LETKLTTCKRDLAL KQKNA+LEK+
Sbjct: 1081 ALVEKIDDGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKS 1140

Query: 1140 INDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIY 1199
            +ND+Q     S+ ++QCS  IIDEF DI KEIAQVN+LKENN ILQKSLK VTEKN  IY
Sbjct: 1141 VNDMQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIY 1200

Query: 1200 EELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTI 1259
            +E T  Q E+SQL+ DL +TKEQVSVNANK+L+YESE++Q KQRY +LS QQ+E  K   
Sbjct: 1201 KEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDET 1260

Query: 1260 EKLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVR 1319
            EKL +EISD KAKLL+A+N   +L +KFNRLKKQAHEKLDASKKQQTALTNE+ ELK ++
Sbjct: 1261 EKLFNEISDLKAKLLNAQNANADLNDKFNRLKKQAHEKLDASKKQQTALTNEVDELKDMK 1320

Query: 1320 DKLEQDLNSKNFKTVDLDTEPKEHTVQSGDLLRDQEKVASLPLIEEIESLKRELQVFKNA 1379
            ++LE+ L+S+  K ++L+ + K+H VQ+  + +DQE+  S PL+EEIE LKRELQVFK  
Sbjct: 1321 NELEESLHSEESKVLELEAKLKKHLVQAEGVSKDQEEDTSKPLMEEIELLKRELQVFKET 1380

Query: 1380 NNSSDAFEKLRDNMXXXXXXXXXXRTKEFEKKLEEIVSKSKSTGKVADNSENIXXXXXXX 1439
            ++SSD  EK+++ M          +T EFE+KLEE  +  K+TG   +N EN+       
Sbjct: 1381 SDSSDTIEKMKEIMEAEKNKIIEEKTTEFERKLEE--ATGKNTGATIENGENMEELKKQW 1438

Query: 1440 XXXXXXXXXXXXXXXXXNLKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSLTFS 1499
                             NLKKRIRLPSEERIQKIISKRKEELE+EFQRKLK N+ S T S
Sbjct: 1439 LKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLKANSGSFTLS 1498

Query: 1500 CDRKETNDDPDEDLWNSPSKGNSERPSVITDFMKQKNIKVQEQLKKAKNGVFFGDSRSSS 1559
             D+KE   + ++DLWNSPSKGNSE+PSV+T+ ++QKN+ +QEQLK  K G+   DSR +S
Sbjct: 1499 SDKKENEVNAEDDLWNSPSKGNSEKPSVVTNLIRQKNLILQEQLKNPKKGIISNDSRPTS 1558

Query: 1560 MNKENSALVKVN-DDKAASTFSFGKPLFPSTTTSFQSFQNPFTQSTIDSNTGVSLPTFNI 1618
             NKEN        ++KA   F+FGKPLFPS T+SFQSFQNPFT +    NTGVS P FNI
Sbjct: 1559 SNKENDIPGSTTAENKAPLAFNFGKPLFPSNTSSFQSFQNPFTPAATSFNTGVS-PVFNI 1617

Query: 1619 RTDLLAGVATDTSKTDGLANNSPDEEEITEIG-STLKRPNEEDASSDPNTKKVKESPEDE 1677
            +  L      DT KT GL +   +E +I EIG ++LKRP E + S D ++KKVKE+ +++
Sbjct: 1618 KPALAVDATVDTFKTPGLNDAGTNEAKIIEIGNNSLKRPIENEVSFDTDSKKVKENSDND 1677

Query: 1678 PASKD 1682
              S++
Sbjct: 1678 QVSEN 1682

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  452 bits (1164), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 416/1422 (29%), Positives = 730/1422 (51%), Gaps = 86/1422 (6%)

Query: 145  ENKLLRRKLMEMENILQICKSNSVSLQLKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLA 204
            +NK LR++LME +N +Q  K N +  + + + + Q+  ++ ++ +W E++++S   + + 
Sbjct: 166  DNKNLRQQLMETQNEVQTLKCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIK 225

Query: 205  DESTKASRIRNLEEKLYQAQADRESALSYSQLLLDQNKQLSHSVEEKILEIKNLKDTACI 264
                  + ++   +++ + + D +   S  + LL +N+++S  ++ K+ EIK L D    
Sbjct: 226  YRQENDTELQKSLQEVARLKNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNT 285

Query: 265  EKTEFSKEMTLQKSMNDLLSSQLASF-------ERDHSSGEIGKDDDNLCKDPDHNNVTD 317
            EK EFS+EM+L++ + DL   QL SF       E  H+S E     DNL +        D
Sbjct: 286  EKQEFSREMSLKQKLLDLQDEQLQSFKEELRLTEEKHNSTEA----DNL-QSTQQARFMD 340

Query: 318  ELMNTKVQFQKSQDECQRLQNIISDFVQEDKATVDTNG-ASHTVGKLFSDIKVLRKQLIK 376
            +L   + Q ++S  E  RLQ ++++ V  D    D +  A+ ++ KL+ DI VL+KQLIK
Sbjct: 341  DLAQVRQQLEESNHERLRLQAVVNE-VMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIK 399

Query: 377  ERSQKFQLQNQMEDFILELEHKTPELVSFKERTKSLEHELKRSTELLETISMAKRKDERE 436
            ER QK  LQ Q+E F++ELE+K P + S KER+ +LE EL     LLE  S  K +  RE
Sbjct: 400  ERHQKENLQRQIESFVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRE 459

Query: 437  LTSLRQKINSCEANIHLLVKQRLDLARQVKVLLLNTSAIQKTTLPLSKDDLISLRKILES 496
            L S   KI   E N H L++QR DLARQV+ LL N +    +  PL+ D++  ++KI+E+
Sbjct: 460  LESATGKIKQLEINTHTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIEN 519

Query: 497  GSDVNENDAQAIISERLVEFNNINELQEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEK 556
             +  NE+D+Q+II+ERLVEF +I  LQE+N ELL   RTLAD+LE  E   +  +  +E+
Sbjct: 520  ENPSNESDSQSIITERLVEFKDIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLER 579

Query: 557  QTIKEAKDAIIELENTNMKMESRINILLRERDSYK-LLASSKENNVNVNAKNFTEISHEK 615
            +TI EAK+AII L+  N ++ES+++ + +ERD+YK +L+ + ++  N+   +  + S E 
Sbjct: 580  KTIDEAKEAIITLQERNSEIESKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDSQEN 639

Query: 616  K--IKELEAELSSTKVESSAVIQNLRKELTTYKKLLCDKKIASQDFENFKMLAKEKESIL 673
            +  IK LE +LS+   E+S   + L +E+    +      I+ +   + + LA+++  +L
Sbjct: 640  QELIKSLEDKLSTLTTETSKNNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLL 699

Query: 674  ETRV---NNLKTDLEKQKLSVPSFVQDNKVRDS---TELLQSRTKTEILMHEISSLKKET 727
            ++ +    N   +L ++   + S +   + R+     + +  ++K  +L    ++L  E 
Sbjct: 700  QSTLEMTKNENAELIRRSHELQSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEK 759

Query: 728  ANSMVLKESLTRDLERCCKEKIQLQMKLKESEISLNEQKVNFDSKGIKYDARIKQXXXXX 787
            +      +SL R++++   E+  L + + + +   +E++         + A I Q     
Sbjct: 760  SLLQSSSDSLRREIQKISVERNSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQT 819

Query: 788  XXXXXXXKSKAQEIXXXXXXXXXXXXWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKI 847
                    SK  EI            W Q  ID+       +  EL+ K  TV  L  ++
Sbjct: 820  SELKTEISSKDNEIKASEDAKRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEV 879

Query: 848  ENLDNELRENKLK---YEFLNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEEIIST 904
             +L  ++ E+  +   Y+ LN+  +  T Q  LRK+LE+T +ELK A+SQ   +++I ST
Sbjct: 880  NDLKKKIEESDSRIASYKTLNDAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISST 939

Query: 905  NEKALKELNSQ-------LASMKEDYDA-RIELE-CKEKLANXXXXXXXXXXXXXXXXXQ 955
             E+ LK L+++       L S  E Y A +++LE C   L                   +
Sbjct: 940  AEETLKNLSNEFEERTEALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEE 999

Query: 956  PKLKEGTVCLVKQSEKLRNQAEKIQEMKAKIDKMNWNVQ-------VYKKEKTSQFQSIM 1008
             K +     ++K+   L +    + ++K + D+  + +Q        Y       ++  +
Sbjct: 1000 EKNE-----ILKKLVSLESSEHSLGQVKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEEL 1054

Query: 1009 KANKELSELVTRLEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNI 1068
            + + E+S+++++L  E    + E+++LK+S  + +++L+  EK W  +K + +  +    
Sbjct: 1055 QKHAEVSKIISQLRSEVQSGRSEIQQLKASEQQAKEVLENGEKSWYNQKTELDAHIDDLK 1114

Query: 1069 EQTESLRVENSVLIEKIGSVTEGSDGNEDYLKLVS--FFSNLRHERNSLETKLTTCKRDL 1126
             Q +++  +N +L  ++  +++     E+ L   S     +LR ER+ LETKLT  KR+ 
Sbjct: 1115 RQVDNISSQNKLLFSQVELLSKSEREFENKLLPGSSELLISLRRERDILETKLTVSKREE 1174

Query: 1127 ALVKQKNASLEKNINDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQK 1186
             L+ QK  +LE  + + +      Q      + I  +  DI +++ Q+NLL+E+N  L+ 
Sbjct: 1175 KLLHQKQVALEDELAEARKKLFKLQENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRN 1234

Query: 1187 SLKNVTEKNREIYEELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHD 1246
            ++    EKN ++  EL   Q ++  L S+L + ++ +     +I++   E D+ K+R HD
Sbjct: 1235 AVNAAQEKNSDLQSELNHLQSKILPLNSELSECRQSIEEKDQRIILLIDEADRWKERSHD 1294

Query: 1247 LSTQQREVQKKTIEKLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQT 1306
            +  +  ++  +   KL  EIS+ K +L       T+L ++F RLKKQAHEKL+ASK  Q 
Sbjct: 1295 ILRRHEKIDPEEYRKLEEEISNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQA 1354

Query: 1307 ALTNELKELKAVRDKLEQDLNSKNFKTVDL-------DTEP-----------------KE 1342
             L+ E+ EL+  + K+E+ L     K ++L       D+E                  KE
Sbjct: 1355 NLSAEVNELQGTKTKMEEILKETQTKVLNLEKLLTERDSESANNEDLRHELDDALERCKE 1414

Query: 1343 HTVQSGDLLRDQEKVASLPLIEEIESLKRELQVFKNANNS---------SDAFEKLRDNM 1393
              V+ G+ +   E + S  L EEI SLK ++++FK   N          S+  E ++   
Sbjct: 1415 IEVKLGETVGSSEGLTS-QLNEEINSLKEQVRIFKEKENDSTLEGSQGLSNVVESMKKAF 1473

Query: 1394 XXXXXXXXXXRTKEFEKKLEEIVSK-SKSTGKVAD--NSENIXXXXXXXXXXXXXXXXXX 1450
                      +T+E+ KK EE  +K S   G  A+  ++ ++                  
Sbjct: 1474 EEEKIKFIQEKTEEYNKKFEEEKAKLSSENGSPAEPVSAPDVNSLKKQWEEEYEAISQQR 1533

Query: 1451 XXXXXXNLKKRIRLPSEERIQKIISKRKEELEEEFQRKLKEN 1492
                  NLKKRIR+P+EERI+K++ KRK ELEEEFQR+LKEN
Sbjct: 1534 IQEAEENLKKRIRMPTEERIKKVLDKRKTELEEEFQRRLKEN 1575

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score =  406 bits (1043), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 399/1386 (28%), Positives = 712/1386 (51%), Gaps = 82/1386 (5%)

Query: 5    ISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRIXXXXX 64
            IS FL +    +  ++ +V+R+L  K + F   + +  + +V +DE+KS    R      
Sbjct: 21   ISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRSEAFKL 80

Query: 65   XXXXXXXQKNIASKELSHLQDQ---LMQDRERCRRKIDALNKQL-----------DSSRD 110
                         KE    +D+   L+ ++    ++++ L  QL            S +D
Sbjct: 81   QLEKINENTESLRKEKDAFEDEKFKLIDEKANASKEVNLLKSQLTELKQQNEIFRSSKQD 140

Query: 111  AIKRLNDEKDAKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSL 170
             ++ LN EK    E+   ++K      +QN      K LR++++E+EN +Q  KSN +  
Sbjct: 141  VVQLLN-EKIGDLEASQDEAKQ----LLQNT-----KTLRKQVLELENEVQTFKSNDLRG 190

Query: 171  QLKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESA 230
            + +   + QE  L+  N +W E++L+S + +  +      S ++    +L   +++ E  
Sbjct: 191  KAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNSIRSELEIE 250

Query: 231  LSYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASF 290
             S SQ L  +   LS  +++K+ E+K+L+D++ IEK EF++EMTL++ + DLL  Q+ SF
Sbjct: 251  RSSSQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESF 310

Query: 291  ERDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDK-- 348
            + +  S       ++   D +   + +EL+ TK + + S+ +  +L+  + + +  D   
Sbjct: 311  KTELESARNKSVSNSDHVDAEREKIIEELIETKKKLEISESKAVKLEETVDELLSTDGER 370

Query: 349  -----ATVDTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELV 403
                 + V  +  +  V KL  DI +L+K+LI+ER QK QLQ Q+E F+LELEHK P L 
Sbjct: 371  GAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVLN 430

Query: 404  SFKERTKSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLAR 463
            SFKERT+ LE EL     +LE  S  K + E ELTS++ KI   E  IH LV+QR DLA 
Sbjct: 431  SFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDLAH 490

Query: 464  QVKVLLLNTSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINELQ 523
            QV+ LL+  S    +  PL+ ++   ++KI+ S     E DAQ IISERLV F ++ ELQ
Sbjct: 491  QVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERLVRFESMVELQ 550

Query: 524  EKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINIL 583
            EKN+ELL  IR LADKLE  E +  +   EVE +T+KEAK+AI+ L+  N  +ES++ I+
Sbjct: 551  EKNMELLNSIRNLADKLEAEEKESKSKSKEVESETVKEAKEAILTLQEYNKSLESQLEII 610

Query: 584  LRERDSYKLLASSKENNVNVNAKNFTEISH----EKKIKELEAELSSTKVESSAVIQNLR 639
             +ERD++K+LAS K  +   +  N +E  H    E+KIKELE  LSS   ES+  I+ L 
Sbjct: 611  AKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKIKELENHLSSLTEESAKNIKLLN 670

Query: 640  KELTTYKKLLCDKKIASQDFENFKMLAKEKESILETRVNNLKT---DLEKQKLSVPSFV- 695
            +E+ +  +   D  +  +   + ++LA+++  ++   +   K    +L K+  S+   + 
Sbjct: 671  EEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSLQENIL 730

Query: 696  -QDNKVRDSTE-LLQSRTKTEILMHEISSLKKETANSMVLKESLTRDLERCCKEK----- 748
             QD+K + + E L+  +++   L  ++++ + E      ++E+L ++ E   +E+     
Sbjct: 731  KQDSKTQQTIESLISCKSQLSALQSQLNNSQSERDLLRSIQENLKKENESLSEERNNMRI 790

Query: 749  --IQLQMKLKESEISLNEQKVNFDSKGIKYDARIKQXXXXXXXXXXXXKSKAQEIXXXXX 806
               QLQ    E E  L E + NF  K  K +  +               +K++EI     
Sbjct: 791  LITQLQTLQTERESLLEETQKNFQGKTNKLETEL-------SDTLEKLDAKSKEISDYIS 843

Query: 807  XXXXXXXWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLK---YEF 863
                   W Q   D   E+L +   +LS K   +  L  K+E+L+N+L E++ +   +  
Sbjct: 844  TKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFNA 903

Query: 864  LNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQLASMKEDY 923
            LN +    +    LR+ELE+T+++L DA+SQV  Y+ +  ++E++   +   L   K +Y
Sbjct: 904  LNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEY 963

Query: 924  DARIELECKEK--------LANXXXXXXXXXXXXXXXXXQPKLKEGTVCLVKQSEKLRNQ 975
              +IE   KE+        +                   + ++ + T  L    E L+ +
Sbjct: 964  TEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNL----EDLKAK 1019

Query: 976  AEKIQEMKA----KIDKM--NWNVQV-YKKEKTSQFQSIMKANKELSELVTRLEKEATDS 1028
              ++  MKA    KI K+  + N Q  Y       ++  ++ + ++S+ ++ L  EA   
Sbjct: 1020 QSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKY 1079

Query: 1029 QMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIGSV 1088
            + E + L+++    +  L+  E  W ++ +DYE EL    ++ E L  ++ +L ++I  +
Sbjct: 1080 KSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFL 1139

Query: 1089 TEGSDGNEDYLKLVS-----FFSNLRHERNSLETKLTTCKRDLALVKQKNASLEKNINDL 1143
            ++G   + + L  +S       ++LR E++ LETKL    R+  +++QK   +E ++   
Sbjct: 1140 SKGKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGS 1199

Query: 1144 QIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIYEELT 1203
            +I+    Q     ++  + +  +I  ++ Q+NLL+E+N  L+   +   E++RE+  EL 
Sbjct: 1200 RIELSKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELD 1259

Query: 1204 IRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIEKLN 1263
                +V  L+S +   +  V     +I +   E ++ KQR  D+  +   +  +  +KL 
Sbjct: 1260 ALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLA 1319

Query: 1264 SEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRDKLE 1323
             ++S+ + ++    +   EL+ +F RLK+QAHEKL+A+K  Q+ LT++L +LKA ++KLE
Sbjct: 1320 DKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLE 1379

Query: 1324 QDLNSK 1329
             DL S+
Sbjct: 1380 NDLGSQ 1385

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 87/183 (47%), Gaps = 43/183 (23%)

Query: 1458 LKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSLTFSCD---------------- 1501
            LKKRIRLP+EE+I KI+ K++ ELE EF+  +++ A  +  S                  
Sbjct: 1567 LKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIAKSKSASNSNSTEVLEKHKQD 1626

Query: 1502 ----RKETNDDPDEDLWNSPSKG---NSERPSVITDFMKQKNIKVQEQLKKAKNGVFFGD 1554
                ++E     DED+     +      ++ S+ + F+++K  K++ Q+K   + +   D
Sbjct: 1627 LENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHDSAIPIND 1686

Query: 1555 SRSSSMNKENSA------LVKVNDDKAA-----------STFSFGKPLFPSTTTSFQSFQ 1597
            + S++  +          L  + +++AA           + F+FG P F  TT++  SFQ
Sbjct: 1687 NSSATPAESGPTTQDVKQLTPILNNQAAILPGKPLPFNPAHFAFGMP-FGQTTSN--SFQ 1743

Query: 1598 NPF 1600
            NPF
Sbjct: 1744 NPF 1746

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  404 bits (1039), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 440/1580 (27%), Positives = 777/1580 (49%), Gaps = 118/1580 (7%)

Query: 5    ISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRIXXXXX 64
            I+ F     E ++ I+  ++ +L +K+  F   + E  ++ V  DE+K+    +I     
Sbjct: 24   IASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDGLKT 83

Query: 65   XXXXXXXQ-------KNIASKELSHLQD---QLMQDRERCRRKIDALN---KQLDSSRDA 111
                   Q       +N  S +   LQ+   QL  + E  +RK++ L    K++ S++  
Sbjct: 84   EMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDLTEEKKEIQSNQQR 143

Query: 112  IKRLNDEKDAKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQ 171
              ++ DE+  KE  M +   ++  N  +N        LR  ++E+E   Q   +N ++ +
Sbjct: 144  TLKILDER-LKEVEMAKVENNRTNNECRN--------LRSTVVELETKQQTYITNDLNSR 194

Query: 172  LKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESAL 231
             + +   QE  L+  NK W E++LSS + + L+      + I  +  +L + + D +   
Sbjct: 195  SELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEK 254

Query: 232  SYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFE 291
            + + +L  +N +LS+S++EK+L++KNL D+   EK EFS E+ L++ + DLL +QL + +
Sbjct: 255  TNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVK 314

Query: 292  ------RDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQ 345
                  R   S  +  DD       + + + D L  TK +  + + EC RL +I      
Sbjct: 315  EELKSIRKSDSSNVTSDDSRKLISENESLLKD-LRLTKEKLAQCESECLRLSSI------ 367

Query: 346  EDKATVDTNGASHTV-GKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVS 404
                T +T   S T+  +  +D  +L+KQ IKE+  K QLQNQ+E FI+ELEHK P + S
Sbjct: 368  ----TEETGEESGTLTSRSSTDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINS 423

Query: 405  FKERTKSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQ 464
            FKERT  LE+EL  S  LLE  S  K    REL    +KI  CE +IH+L +QRLDL RQ
Sbjct: 424  FKERTDMLENELNNSALLLEHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQ 483

Query: 465  VKVLLLNTSAIQKTTLPLSKDDLISLRKILES-GSDVNENDAQAIISERLVEFNNINELQ 523
            V+ LL+  S    +  PL K+++  ++ IL++  S   E+D+Q I++ RLVEF N+ ELQ
Sbjct: 484  VQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVIELQ 543

Query: 524  EKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINIL 583
            EKN ELL   R LADKLE +E K    L ++E +TI EAK+AI+ L++  M +ES++  L
Sbjct: 544  EKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMSLESKVEEL 603

Query: 584  LRE----RDSYKLLASSKENNVNVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLR 639
             RE    + S    ASS  N+V +     T+   E ++++L+A +S    ES+  +  L 
Sbjct: 604  ERERETLKSSISKQASSFNNSV-IQQLTKTKRELESQVQDLQARISQITRESTQNMSLLN 662

Query: 640  KELTTYKKLLCDKKIASQDFENFKMLAKEKESILETRVNNLKTD---LEKQKLSVPSFV- 695
            KE+        D  I     ++ ++LA+E+  +L   ++  K +   L K+  S+ S + 
Sbjct: 663  KEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSIS 722

Query: 696  -QDNKVRDS-TELLQSRTKTEILMHEISSLKKETANSMVLKESLTRDLERCCKEKIQLQM 753
             QD+K  ++  E +  ++K  +    +S+LK E    +  ++SL ++L++   EK  L++
Sbjct: 723  KQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLRI 782

Query: 754  KLKESEISLNEQKVNFDSKGIKYDARIKQXXXXXXXXXXXXKSKAQEIXXXXXXXXXXXX 813
             + + +    E++   D        +I +              K Q I            
Sbjct: 783  MVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIE 842

Query: 814  WAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLKYEFLNNTSDASTL 873
            W QN I+  ++   SV+  ++ K+  +  L  K+++L+ E+ ENK++    N   D +  
Sbjct: 843  WYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYN-VMDETIN 901

Query: 874  QPALRKELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQLASMKEDY--------DA 925
              +LRKELE +++ L +A+SQ++ Y+++  +  ++L+E+NS+L    E +        D 
Sbjct: 902  DDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTDE 961

Query: 926  RIELECKEKLANXXXXXXXXXXXXXXXXXQPKLKEGTVCLVKQSEKLRNQAEKIQEMKAK 985
            +I LE K  L                   + K  E    +      L+N  ++I+ +K++
Sbjct: 962  KINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAI----LQNNNKEIETVKSE 1017

Query: 986  IDKMNWNVQ-------VYKKEKTSQFQSIMKANKELSELVTRLEKEATDSQMELKKLKSS 1038
             +     +Q       +Y     + ++  ++ + ++S+ ++ L ++    + ++K L  S
Sbjct: 1018 YESKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLS 1077

Query: 1039 LHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIGSVTEGSDGNEDY 1098
              + +++L  +EK W  +K     +L  +  + E L  +N +L  +I   T   +G  D 
Sbjct: 1078 RSELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDA 1137

Query: 1099 LKLVSF----FSNLRHERNSLETKLTTCKRDLALVKQKNASLEKNINDLQIDQPASQTEL 1154
                +        LR ER+ L+TK+T  +RD  +++QK   ++  + D +     S+ E 
Sbjct: 1138 RNGPTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVEN 1197

Query: 1155 QCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIYEELTIRQEEVSQLKS 1214
               + I+ + + I +++ Q+NLL+E+N  L+  L+N ++KN+E+  EL   +E ++ ++S
Sbjct: 1198 DERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIES 1257

Query: 1215 DLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIEKLNSEISDFKAKLL 1274
            +L   K  +     +I + + E+ + K+R  D+  + +++     EKL SE+   KA+L 
Sbjct: 1258 ELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLE 1317

Query: 1275 DAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRDKLEQDLNSKNFKTV 1334
            D     TE E +FNRL++QA EKL  SK  Q  LT +L ELK  +  LE+ LN  N +  
Sbjct: 1318 DKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLNDANTRIQ 1377

Query: 1335 DLDTEP-----------------------------KEHTVQSGDLLRD-QEKVASLPLIE 1364
            +L+ E                              +E+ +     +R   E++A+L   E
Sbjct: 1378 ELEGEKVAEDNNRSEMIKRSQEDAEKSSRELEEKLEENAISYSSTVRKLNEEIATLK--E 1435

Query: 1365 EIE---SLKRELQVFKNANNS--SDAFEKLRDNMXXXXXXXXXXRTKEFEKKLEEIVSKS 1419
            EIE    ++++LQ      +   S+  E ++ +           +T+E  KK++E   + 
Sbjct: 1436 EIEKQGQIQKQLQTAAGHRDEDLSNIVESMKKSFEEDKIKFIEEKTREVNKKIQEAQERL 1495

Query: 1420 KSTGKVADNSENIXXXXXXXXXXXXXXXXXXXXXXXXNLKKRIRLPSEERIQKIISKRKE 1479
                 V     NI                         LKKRIRLP+EE+I KII ++KE
Sbjct: 1496 NQPSSV-----NIDEMKKQWEAEHEEEVAERVREAEEALKKRIRLPTEEKISKIIERKKE 1550

Query: 1480 ELEEEFQRKLKENASSLTFS 1499
            +LE+EF  KL+E   S++ S
Sbjct: 1551 DLEKEFNEKLEEKVKSISGS 1570

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  395 bits (1014), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 400/1385 (28%), Positives = 722/1385 (52%), Gaps = 90/1385 (6%)

Query: 4    KISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRIXXXX 63
            K+S F  VP + L  I+  +L  L  K+ +F   + +  RLNV +DEIK+    R     
Sbjct: 25   KLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEIKTVSSKREEGLK 84

Query: 64   XXXXXXXXQKNIASKELSHLQDQLMQ---DRERCRRKIDALNKQL---DSSRDAIKRLND 117
                      +    E S  Q++  Q   D+++ + ++++L ++L   D  R+ +K+   
Sbjct: 85   NEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSDLDQERETLKQDKR 144

Query: 118  EKDAKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQLKYDTI 177
            E  A  E  I++ +     S +++ D  +K LR++++E+E  +Q  KS  +  Q +  TI
Sbjct: 145  EVVAVLEEKIKELESFRTESRKSLDD--SKRLRQQVLELETTVQNLKSKELRDQSEIQTI 202

Query: 178  VQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESALSYSQLL 237
             Q   ++ +N +W EE+++S   + ++        +  L  +    + + +   S +Q++
Sbjct: 203  TQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQLEKSRNQVI 262

Query: 238  LDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFERDHSSG 297
              +N++L+ S++EK++E+K+L D+   EK EF+ EM++++ + DLL +Q+ S + + ++ 
Sbjct: 263  TTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSLQGELNAS 322

Query: 298  EIGKDDDNLCKDPDHNN----VTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKATVDT 353
             + KD+  L    + N     +  EL+  K  F++S+ E  RL+ ++ + +  D +  D 
Sbjct: 323  -LDKDNVELLASGERNTENEKLIQELITLKENFEESERERLRLEALVQELIPGDDSQDDI 381

Query: 354  NGASHTVG-----KLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKER 408
            N  S  +          D+ +L+K+LIKER QK +LQ Q+E FI+ELE+K P + SFKER
Sbjct: 382  NNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFIVELEYKIPVINSFKER 441

Query: 409  TKSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQVKVL 468
            T  LE EL     LL+  S  K K ERE  +L +K+   E++IH L +QR DLA QV+ L
Sbjct: 442  TSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQRTDLAHQVQFL 501

Query: 469  LLNTSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINELQEKNVE 528
            L+N S    +   LS +++  +++I+ +    +E+D+Q +ISERLVEFNNI  LQEKN+E
Sbjct: 502  LMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLVEFNNIATLQEKNME 561

Query: 529  LLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINILLRERD 588
            LL  +R LA+KLE  E   +  +   E  TIKEAK+AI+ L++ N  +ES++ IL +E D
Sbjct: 562  LLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANLESKVEILTKECD 621

Query: 589  SYKLLAS---SKENN---VNVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLRKEL 642
            ++K + S   S +N     N    N    S E+K++ LEA L+S  VESS   + L  E+
Sbjct: 622  AFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTVESSQNNKMLNNEI 681

Query: 643  TTYKKLLCDKKIASQDFENFKMLAKEKESILE-----TRVNNLKTDLEKQKLSVPSFVQD 697
                +      I  +   + K L +E+  +++     TR  N +     Q L      QD
Sbjct: 682  HELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKRSQNLQSIFDRQD 741

Query: 698  NKVRDST-ELLQSRTKTEILMHEISSLKKE---------TANSMVLKESLTRDLERCCKE 747
            ++  ++  EL+   +K  +L  ++++L+ E         T+    LK S  R+  R    
Sbjct: 742  SRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKLSEERNSLRIMVS 801

Query: 748  KIQ-LQMK----LKESEISLNEQKVNFDS-KGIKYDARIKQXXXXXXXXXXXXKSKAQEI 801
            ++Q LQ +    LKE + +  E   N DS +  K DAR +              +K +E 
Sbjct: 802  QLQTLQSEREKFLKEIQTTYKE---NLDSLEQEKADARAR------------LDAKTKEA 846

Query: 802  XXXXXXXXXXXXWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLK- 860
                        W Q+ +D    + + +  EL  K   V  L S++  L+ ++ E++ + 
Sbjct: 847  EDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARI 906

Query: 861  --YEFLNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQLAS 918
              Y+ L+ +   ++ + +LRKELE+T++ L D ++++  Y+ ++ST E++L +L    AS
Sbjct: 907  QSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNLLSTTEESLSQLTQDYAS 966

Query: 919  MKEDYDARIELECKEKLANXXXXXXXXXXXXXXXXXQPKLKEGTVCLVKQSEKLRNQAEK 978
             K++   ++E    EK                      KL+E      K +E  +N  +K
Sbjct: 967  GKQELQLQVETLQNEK-------SQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQK 1019

Query: 979  ---IQEMKAKID---KMNWNVQVYK----KEKTSQFQSIMKANKE--------LSELVTR 1020
                 E ++K     K  ++ Q+ K     E+ + F +  + N E        +S+ ++ 
Sbjct: 1020 KIATLETESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISE 1079

Query: 1021 LEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSV 1080
            L +++   ++ + +LK+S  + + +L+ +EK W  +K +YER+L ++ +  E L  +NS+
Sbjct: 1080 LREQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSL 1139

Query: 1081 LIEKIGSVT-EGSDG-NEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQKNASLEK 1138
            L ++I   + + SDG N +  ++    +NLR ER+ L TKLT  +R+   ++   AS+E 
Sbjct: 1140 LYDQIELFSKDNSDGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVEN 1199

Query: 1139 NINDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREI 1198
             ++  +      Q E+   + +I +   I +++ Q+NLL+E+N  L+ + +   +KNRE+
Sbjct: 1200 ELDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITLRNAAEEENKKNREL 1259

Query: 1199 YEELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKT 1258
             EEL   +E +  L+S+L      V     ++ +Y+ E ++ K+R  ++  +   +  + 
Sbjct: 1260 QEELNQLRERILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPED 1319

Query: 1259 IEKLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAV 1318
             ++L  ++S  + KL +      EL+++FNRLKKQAHEKL++SK  QT L+N+L EL+  
Sbjct: 1320 HKELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREA 1379

Query: 1319 RDKLE 1323
            + +LE
Sbjct: 1380 KSELE 1384

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  377 bits (967), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 381/1372 (27%), Positives = 704/1372 (51%), Gaps = 59/1372 (4%)

Query: 5    ISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRIXXXXX 64
            I+ F    FE ++ IN  +++ L  K+  F   + E  ++ V  DE+K+    +I     
Sbjct: 24   IASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLKK 83

Query: 65   XXXXXXXQKNIASKELSHLQDQLMQDR----------ERCRRKIDAL---NKQLDSSRDA 111
                   Q +   KE     D+L  ++          E  +R+ D L    K+L  ++  
Sbjct: 84   EMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADDLIEEKKELQCNQQR 143

Query: 112  IKRLNDEKDAKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQ 171
              ++ DE+  KE  + R        S  N  D E K LR  ++++E   Q   ++ ++ +
Sbjct: 144  TLKILDER-LKELEIAR--------SDNNRSDNECKRLRSTIIDLETKQQDLITSDLNSR 194

Query: 172  LKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESAL 231
             + +   QE  ++     W E++L S N + L+        I  +  +L   ++D +   
Sbjct: 195  AELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEK 254

Query: 232  SYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASF- 290
            + + +L  +N +LS S++EK+LEIK+L D    EK EFS E+ L++ + DLL SQL +  
Sbjct: 255  TKNDVLTQKNDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQLNAVK 314

Query: 291  -ERDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKA 349
             E D + G +   +D+     +  ++  EL  TK +  + + EC RL +II +  +E  +
Sbjct: 315  EELDSTRG-LETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLSSIIGETDEESGS 373

Query: 350  TVDTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERT 409
            +   + +         D  +L+KQLIKE+  K  LQNQ+E FILELEHK P + SFKERT
Sbjct: 374  STSRSSS---------DFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERT 424

Query: 410  KSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQVKVLL 469
             +LE+EL  +  LLE  S  K    REL++  +K+  CE +I  L+KQRLDL RQV+ LL
Sbjct: 425  DTLENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLL 484

Query: 470  LNTSAIQKTTLPLSKDDLISLRKILESGSD-VNENDAQAIISERLVEFNNINELQEKNVE 528
            +  S  + +  PL K++++ ++ IL++ SD   E D+Q I++ERLVEF +I ELQEKN E
Sbjct: 485  ITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTE 544

Query: 529  LLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINILLRERD 588
            LL  +R LAD+LE +E +   +L ++E +TI EAK+AI+ L+    ++ES++  L +E +
Sbjct: 545  LLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQLESKVEELEKECE 604

Query: 589  SYKLLASSKEN---NVNVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLRKELTTY 645
            + K L S++E    N  +   N T+ + E +I++L++ +S    ES+  +  L KE+   
Sbjct: 605  NSKALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKEIQDL 664

Query: 646  KKLLCDKKIASQDFENFKMLAKEKESILETRVNNLKTD---LEKQKLSVPSFV--QDNKV 700
                 D  I     ++ ++LA+E+  +L   ++  K +   L K+   + S +  QD+K 
Sbjct: 665  YDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKT 724

Query: 701  RDS-TELLQSRTKTEILMHEISSLKKETANSMVLKESLTRDLERCCKEKIQLQMKLKESE 759
            +++  E +  ++K  I   E+ +LK+E    +  +++L +++++   EK  L++ + + +
Sbjct: 725  QETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQLQ 784

Query: 760  ISLNEQKVNFDSKGIKYDARIKQXXXXXXXXXXXXKSKAQEIXXXXXXXXXXXXWAQNTI 819
                E++   D     Y  +I +              K Q I            W QN I
Sbjct: 785  TLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKI 844

Query: 820  DDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLKYEFLNNTSDASTLQPALRK 879
            +  ++  +S++  ++ K+  +  L  K+++L+ E+ ENK++    N   D +    +LRK
Sbjct: 845  EVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYN-VIDGTINDDSLRK 903

Query: 880  ELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQLASMKEDYDARIELECKEKLANXX 939
            ELE++++ L DA+SQ++ Y+E+  TN K+LK+++S+     +D+  RI+    EK +   
Sbjct: 904  ELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSLEE 963

Query: 940  XXXXXXXX----XXXXXXXQPKLKEGTVCLVKQSEKLRNQAEKIQEMKAKIDKMNWNVQ- 994
                                  +KE      K+   L+N  ++++ +K++ +     +Q 
Sbjct: 964  KISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKIQK 1023

Query: 995  ------VYKKEKTSQFQSIMKANKELSELVTRLEKEATDSQMELKKLKSSLHKTQDLLDT 1048
                  +Y     + ++  ++ + ++S+ ++ L ++    ++++  L  S ++ +  L  
Sbjct: 1024 DLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLESTLKE 1083

Query: 1049 HEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIGSVTEGSDG---NEDYLKLVSFF 1105
            +E+ W  ++     +L S+  + E L  +N +L ++I   T    G     D   L S  
Sbjct: 1084 NERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALNSIL 1143

Query: 1106 SNLRHERNSLETKLTTCKRDLALVKQKNASLEKNINDLQIDQPASQTELQCSAVIIDEFN 1165
             +LR ER+ L+TK+T  +RD  +++QK + ++  + + +     S+ E +    II +  
Sbjct: 1144 LSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTIIQQHE 1203

Query: 1166 DITKEIAQVNLLKENNAILQKSLKNVTEKNREIYEELTIRQEEVSQLKSDLIKTKEQVSV 1225
            DI +++ Q+NLL+E+N  L+  L+N  E+ R +  EL   +++++ ++S+L   K  +  
Sbjct: 1204 DIMEKLNQLNLLRESNITLRNELENNNEEKRVLQSELDKLKQDIAPIESELAALKYSMQE 1263

Query: 1226 NANKILIYESEMDQCKQRYHDLSTQQREVQKKTIEKLNSEISDFKAKLLDAENTKTELEN 1285
               ++ + + E+ + K+R  D+  + R++     EKL  EI   K KL +      E E 
Sbjct: 1264 KEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAEAEE 1323

Query: 1286 KFNRLKKQAHEKLDASKKQQTALTNELKELKAVRDKLEQDLNSKNFKTVDLD 1337
            +FNRL++QA E+L  SK     LT ++ +LK  + KLE+ L+  N K  +L+
Sbjct: 1324 RFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKSLDDANTKIEELE 1375

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  363 bits (933), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 403/1501 (26%), Positives = 750/1501 (49%), Gaps = 127/1501 (8%)

Query: 2    EDKISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRIXX 61
            ED ++ FL +  E+L  ++ +V  ++  KI  F+  + E  + +V +DE++S        
Sbjct: 18   EDAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSS------- 70

Query: 62   XXXXXXXXXXQKNIASKELSHLQDQ---LMQDRERCRR---KIDALNKQLDSSRDAIKRL 115
                          +S +L   +DQ   L+Q+ E  R    +++    Q D+ R      
Sbjct: 71   --------------SSHKLGACKDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSIND 116

Query: 116  NDEKDAKEESMIRQSK--HQNVNSVQNVLD-----------------KENKLLRRKLMEM 156
            +D   A+ E++ +Q +    N N V  +L+                 +E + LR++ +E+
Sbjct: 117  SDTLRARNEALEQQKQVLEANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLEL 176

Query: 157  ENILQICKSNSVSLQLKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNL 216
            E   ++ KS  +  +  +  + Q+  L+  N +W E +L+  N++  A      S + ++
Sbjct: 177  EGQARVYKSEELKHKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASV 236

Query: 217  EEKLYQAQADRESALSYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQ 276
             ++L   + D ++A    + L +QN Q    +E +   +K L D     K EF++EM+L+
Sbjct: 237  SQRLETCEGDLQAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLK 296

Query: 277  KSMNDLLSSQLASFERDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRL 336
            + + +LL  Q+++ + +       +   +       + + DEL++   Q ++S+ + Q+L
Sbjct: 297  QRLVELLEGQVSALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKL 356

Query: 337  QNIISDFVQEDKATVDTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELE 396
            +  +   +  D+ T+     S ++  L++DI +L+KQ+I ER QK  LQNQ+E F++ELE
Sbjct: 357  EQTVEQLLSADEKTI---SGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELE 413

Query: 397  HKTPELVSFKERTKSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVK 456
            +K P L SFK+R   LE EL  +  +L++IS  K +   +L   + +I   E+ I  L +
Sbjct: 414  NKVPMLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQ 473

Query: 457  QRLDLARQVKVLLLNTSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEF 516
            QR DLARQV+ LL+  +    +  PLS ++   ++K++   +   + DAQ IISERLVEF
Sbjct: 474  QRSDLARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEF 533

Query: 517  NNINELQEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKM 576
             NI ELQ KN +LL+ +R LA++LE  E K  +    +E  TI EAK+AI+ L++   ++
Sbjct: 534  KNIVELQAKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQEL 593

Query: 577  ESRINILLRERDSYKLLASSKEN--------NVNVNAKNFTEISHEKKIKELEAELSSTK 628
            E+RI+++ RERD+YK + S   +        +VN  A   +++    KI+ELE  LS+ K
Sbjct: 594  ETRIDVITRERDAYKAIQSQTSHEGSNGGLRDVNAKASENSDL----KIRELEELLSAAK 649

Query: 629  VESSAVIQNLRKELTTYKKLLCDKKIASQDFENFKMLAKE-----KESILETRVNNLKTD 683
             E+ A ++ L  E     +   +  +  +  ++ ++LA+E     K S+L T+  N   +
Sbjct: 650  REAEANVKLLMTENQELARSKSELVVNVEKEKSSRLLAEERLKISKSSLLLTKQEN--EE 707

Query: 684  LEKQKLSVPSFV--QDNKVRDS-TELLQSRTKTEILMHEI-SSLKKE---TANSMVLKES 736
            L K+ L + + +  QD + +++ +EL+  +++   L  E+ +S+ KE     +   LKE+
Sbjct: 708  LNKRGLVLENNLAKQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKET 767

Query: 737  ---LTRDLERCCKEKIQLQMKLKESEISLNEQKVNFDSKGIKYDARIKQXXXXXXXXXXX 793
               LT++         QLQ   KE +  L +   NF  K    +A I Q           
Sbjct: 768  NEQLTKERNELTILVTQLQTLQKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQ---- 823

Query: 794  XKSKAQEIXXXXXXXXXXXXWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNE 853
               KA E+            W Q  ID   E LKS  ++L+ K + +  L S+   L ++
Sbjct: 824  ---KATELSDFMSTSDSRSRWYQEKIDALNECLKSTTSDLNSKTQMIQELQSQQSLLTSK 880

Query: 854  LRENKLK---YEFLNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEEIISTNEKALK 910
            LR+ + K   Y  LN T D  T   ALR ELE+T++ LKDA SQV  Y+ + ++ ++ L 
Sbjct: 881  LRDAETKSQSYSVLNQTDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLT 940

Query: 911  ELNSQLASMKEDYDARIELECKEK--LANXXXXXXXXXXXXXXXXXQPK-----LK-EGT 962
             + + L   K+D+   +E   KE+  L+N                   K     LK E  
Sbjct: 941  AMTTALEHSKQDHTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHN 1000

Query: 963  VCLVKQSEKLRNQAEKIQEMKAK----IDKMNWNV---QVYKKEKTSQFQSIMKANKELS 1015
             C     E++++    +  MK +    + K+  ++    +Y  +    ++  ++ + ++S
Sbjct: 1001 KC----EEEVKSNKTALASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHADVS 1056

Query: 1016 ELVTRLEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLR 1075
            + +++L +EA   + ++  L++S+ + +  L+ +E  W  +K +YE +   + ++ E L 
Sbjct: 1057 KTISQLREEAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIEDLS 1116

Query: 1076 VENSVLIEKIGSVTEGSDGNEDYLKLVS--FFSNLRHERNSLETKLTTCKRDLALVKQKN 1133
             +N +L ++I      S    D LK  +    S L+ E + L+TKL   KRD + +KQK 
Sbjct: 1117 TQNRLLFDQISLKDTDSIPINDELKSEARELISTLKRECDILQTKLELAKRDESNLKQKL 1176

Query: 1134 ASLEKNINDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTE 1193
               E+ ++  + +   SQ      +++I+E + I +++ QVNLL+E+N  L+  L+  ++
Sbjct: 1177 EFTEQELSVAKSEIRKSQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQ 1236

Query: 1194 KNREIYEELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQRE 1253
            +N+++   +   QE +  L++D++  +  V     +I +   E+++ KQR  D+  +   
Sbjct: 1237 RNQDLERNVEELQEALKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYER 1296

Query: 1254 VQKKTIEKLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELK 1313
            V  +  +KL  E+S  +A+       ++ELE++F RLKKQA E+LD ++  Q  L  EL 
Sbjct: 1297 VDPEEHKKLAEELSQARAEAAANAQQRSELEDRFQRLKKQARERLDNARTTQNTLNAELT 1356

Query: 1314 ELKAVRDKLEQDLNSKNFKTVDLDTEPK---EHTVQSGDLLRDQEKVASLPLIEEIESLK 1370
            E +  +  LE  L+ +  KT  L    K   E+ +++    RDQ + A    ++++E  +
Sbjct: 1357 EARESQKALEDALDKEREKTRSLQESIKATEENEIENSSATRDQLQDA----LQKLEDAQ 1412

Query: 1371 RELQVFKNANNSSDAFEKLRDNMXXXXXXXXXXRTKEFEKKLEEIVSKSKSTGKVADNSE 1430
              +     A   S   + LR+ +          RT++  K+LEE ++K+++  +V + ++
Sbjct: 1413 ARINEMSTA--PSQEEQTLREEL---------ERTRQHVKQLEEHLAKTQNEVRVLEEAK 1461

Query: 1431 N 1431
            N
Sbjct: 1462 N 1462

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  362 bits (928), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 389/1396 (27%), Positives = 710/1396 (50%), Gaps = 102/1396 (7%)

Query: 5    ISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRIXXXXX 64
            I+ F     E ++ I+  ++  L  K+  F   + E  ++ V +DE+K+    +I     
Sbjct: 24   IASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINSLKT 83

Query: 65   XXXXXXXQ-------KNIAS-------KELSHLQDQLMQDRERCRRKIDALN---KQLDS 107
                   Q       +N  S       +E +HL ++L    E  +RK+  L+   K++ S
Sbjct: 84   EMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNEL----ESIKRKLSDLSEEKKEIQS 139

Query: 108  SRDAIKRLNDEKDAKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNS 167
            S+    ++ DE+  KE  M++        +  N  D E K LR  ++E+E   Q   SN 
Sbjct: 140  SQQRTLKILDER-LKELEMVK--------AASNHSDSECKKLRSTILELETKQQTYISND 190

Query: 168  VSLQLKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADR 227
            ++ + + +   QE  L+  NK W E++LSS N + L+      + I  +   L + + D 
Sbjct: 191  LNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDF 250

Query: 228  ESALSYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQL 287
            +   + + +L  +N +LS  ++EK+L+IK L D++  EK +FS E+TL++ + DLL SQL
Sbjct: 251  QLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQL 310

Query: 288  ASFE------RDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIIS 341
             + +      R+ +  ++  DD       +   + D L  TK +  + ++EC RL +I  
Sbjct: 311  NAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKD-LQLTKHKLVQCENECLRLSSITE 369

Query: 342  DFVQEDKA-TVDTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTP 400
            +  +ED   T  +NG          D  +L+KQLIKE+  K  LQNQ+E FI+ELEHK P
Sbjct: 370  EAGKEDGILTSKSNG----------DFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVP 419

Query: 401  ELVSFKERTKSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLD 460
             + SFKERT +LE+EL  +  LLE  S  K    +EL    +K+   +  IH+L KQRLD
Sbjct: 420  IINSFKERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLD 479

Query: 461  LARQVKVLLLNTSAIQKTTLPLSKDDLISLRKILESG-SDVNENDAQAIISERLVEFNNI 519
            L RQ++ LL+  S    +  PL K+++  ++ IL++  S   E+D+Q I++ERLVEF +I
Sbjct: 480  LCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDI 539

Query: 520  NELQEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESR 579
             +LQEKN ELL   R LADKLE +E K    L  +E +TI EAK+AI+ L++  +++ES+
Sbjct: 540  IQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESK 599

Query: 580  INILLRERDSYKLLASSKENNVNVNA-KNFTEISHE--KKIKELEAELSSTKVESSAVIQ 636
            I+ L +ER+ +K     +E + N +  +  TE   E   + ++L+A +S    ES+  + 
Sbjct: 600  IHELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMS 659

Query: 637  NLRKELTTYKKLLCDKKIASQDFENFKMLAKEKESILETRVNNLKTD---LEKQKLSVPS 693
             L KEL           I     ++ ++LA+E+  +L   ++  K +   L K+ +++ +
Sbjct: 660  LLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQN 719

Query: 694  FV--QDNKVRDS-TELLQSRTKTEILMHEISSLKKETANSMVLKESLTRDLERCCKEKI- 749
             +  QD+K +++  + +  ++K   +  E+S+LK E    + L+++L ++L     EK  
Sbjct: 720  AISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIELEKNLKQELSELSSEKTS 779

Query: 750  ------QLQMKLKESEISLNEQKVNFDSKGIKYDARIKQXXXXXXXXXXXXKSKAQEIXX 803
                  QLQ   KE E  L+E K +  +K       I                K Q I  
Sbjct: 780  LHIMVTQLQTLQKERENLLDETKKSCQNK-------IDALQNAQNELKTEAIRKDQYIKQ 832

Query: 804  XXXXXXXXXXWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLKYEF 863
                      W QN I+   +  +SV++ L+ K+  V     +I++L+ E+ ENK++   
Sbjct: 833  LEEDNDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHT 892

Query: 864  LNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQLASMKEDY 923
             N   D S    +LR+ELE++++ L DA+SQ++ Y+++  T +K+L+E++SQL    + +
Sbjct: 893  YN-VLDESINDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAF 951

Query: 924  --------DARIELE-----CKEKLANXXXXXXXXXXXXXXXXXQPKLKEGTVCLVKQSE 970
                    D +  LE      +E+++N                 +    +  + +++ + 
Sbjct: 952  SNQIQNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMEKEKAE---FKKKISILQNNN 1008

Query: 971  KLRNQAEKIQ-EMKAKIDKMNWNVQ---VYKKEKTSQFQSIMKANKELSELVTRLEKEAT 1026
            K   + E ++ E ++K+ K+  ++    +Y     + ++  ++ + ++S+ ++ L ++  
Sbjct: 1009 K---EIEAVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLH 1065

Query: 1027 DSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIG 1086
              + +++ L  +  + +  L  +E  W  +K     +L  +  + E L  +N +L ++I 
Sbjct: 1066 TYKGQVETLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIE 1125

Query: 1087 SVTEGSDGNEDYLKLVSFFSN-----LRHERNSLETKLTTCKRDLALVKQKNASLEKNIN 1141
              T   +   D  K  S  +N     LR ER+ L+TK+   +RD  +++QK + ++  + 
Sbjct: 1126 LYTTTGNKPTDA-KSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQ 1184

Query: 1142 DLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIYEE 1201
            + +     S+ E +  + II + +++ +++ Q+NLL+E+N  L+  L +   KN+E+  E
Sbjct: 1185 EARTKLCNSKVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSE 1244

Query: 1202 LTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIEK 1261
            L   +  ++ ++S+L   K  +     +I + + E+ + K+R  D+  + +++     EK
Sbjct: 1245 LERLRGNIAPIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEK 1304

Query: 1262 LNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRDK 1321
            L +EI   KA+L D      + E KFNRL++QA EKL ASK  Q +   +L ELK  +  
Sbjct: 1305 LETEIESLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLA 1364

Query: 1322 LEQDLNSKNFKTVDLD 1337
            LE+ LN+ N +  +L+
Sbjct: 1365 LEKSLNNANARIQELE 1380

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  343 bits (880), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 385/1382 (27%), Positives = 698/1382 (50%), Gaps = 77/1382 (5%)

Query: 5    ISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRIXXXXX 64
            I+ F     E ++  +  V++ L  K+  F   + E  ++ V  DE+K+    +I     
Sbjct: 24   IASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDGLKT 83

Query: 65   XXXXXXXQKNIASKE----------LSHLQDQLMQDRERCRRKIDALN---KQLDSSRDA 111
                   + +   KE          + + + +L  + E  +RK+D L    K+  S++  
Sbjct: 84   EMENVIRENDKIRKERNDTFVKFESVENEKMKLSSELEFVKRKLDDLTEEKKETQSNQQR 143

Query: 112  IKRLNDEKDAKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQ 171
              ++ DE+  KE  ++R   +++        + E K LR  +M++E   Q   +N ++ +
Sbjct: 144  TLKILDER-LKEIELVRVENNRS--------NSECKKLRSTIMDLETKQQGYITNDLNSR 194

Query: 172  LKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESAL 231
             + +   QE  L+  N  W E++L S N + L+        I ++  +L + + D +   
Sbjct: 195  TELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQMER 254

Query: 232  SYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFE 291
            + + +L  +N +LS S++EK+LEIK L D+   EK EFS EM+L++ + DLL SQL + +
Sbjct: 255  TNNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVK 314

Query: 292  ------RDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQ 345
                  R+ ++ ++  DD    + P++ ++  EL  TK +  + + EC RL +I      
Sbjct: 315  EELNSIRELNTAKVIADDSK-KQTPENEDLLKELQLTKEKLAQCEKECLRLSSIT----- 368

Query: 346  EDKATVDTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSF 405
             D+A  D    S    K  SD   L+KQLIKER  K  LQNQ+E FI+ELEHK P + SF
Sbjct: 369  -DEADEDNENLS---AKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIINSF 424

Query: 406  KERTKSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQV 465
            KERT  LE+EL  +  LLE  S  K    +EL +  QK+  CE ++  L KQRLDL RQ+
Sbjct: 425  KERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQI 484

Query: 466  KVLLLNTSAIQKTTLPLSKDDLISLRKIL-ESGSDVNENDAQAIISERLVEFNNINELQE 524
            + LL+  S    +  PL K+++  ++ I+ E  S + E+D+Q +++ERLVEF NI +LQE
Sbjct: 485  QYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNIIQLQE 544

Query: 525  KNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINILL 584
            KN ELL  +R LADKLE  E K   +L ++E +T+ EAK+AII L++  M +ESRI  L 
Sbjct: 545  KNAELLKVVRNLADKLESKEKKSKQSLQKIESETVNEAKEAIITLKSEKMDLESRIEELQ 604

Query: 585  RERDSYKLLASSKENNV-NVNAKNFTEISH--EKKIKELEAELSSTKVESSAVIQNLRKE 641
            +E +  K    +++ +  NV  K  TE     E ++++L+  +S    ES+  +  L KE
Sbjct: 605  KELEELKTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSLLNKE 664

Query: 642  LTTYKKLLCDKKIASQDFENFKMLAKEKESILETRVNNLKTDLEKQK-----LSVPSFVQ 696
            +        D  I     ++ ++LA+E+  +L   ++  K + ++ +     L      Q
Sbjct: 665  IQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTILKQ 724

Query: 697  DNKVRDS-TELLQSRTKTEILMHEISSLKKETANSMVLKESLTRDLERCCKEK------- 748
            D+K  ++  E +  ++K  I+  E+ +LK+E    + L+++L ++L +   EK       
Sbjct: 725  DSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKLSPEKDSLRIMV 784

Query: 749  IQLQMKLKESEISLNEQKVNFDSKGIKYDARIKQXXXXXXXXXXXXKSKAQEIXXXXXXX 808
             QLQ   KE E  L E + +   K       I +              K   I       
Sbjct: 785  TQLQTLQKEREDLLEETRKSCQKK-------IDELEDALSELKKETSQKDHHIKQLEEDN 837

Query: 809  XXXXXWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLKYEFLNNTS 868
                 W QN I+  ++  +SV+T +  K+  +  L  K+++L+ E+ E+K++    N   
Sbjct: 838  NSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYN-VM 896

Query: 869  DASTLQPALRKELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQLASMKEDYDARIE 928
            D +    +LRKELE++++ L DA+SQ++ Y+++  T  ++L++ NS+L    +D+  +I+
Sbjct: 897  DETINDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIK 956

Query: 929  LECKEKLANXXXXXXXXXXXXXXXXXQPKLKEGT----VCLVKQSEKLRNQAEKIQEMKA 984
                EK +                      K+G         K+   L+N  ++++ +K+
Sbjct: 957  NLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKS 1016

Query: 985  KIDKMNWNVQ-------VYKKEKTSQFQSIMKANKELSELVTRLEKEATDSQMELKKLKS 1037
            + +     +Q       +Y     + ++  ++ + ++S+ ++ L ++    + ++K L  
Sbjct: 1017 EYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNL 1076

Query: 1038 SLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIGSVTEGS---DG 1094
            S  + ++ L  +EK W  +K     +L  +  + E L  +N +L ++I   T      + 
Sbjct: 1077 SRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNN 1136

Query: 1095 NEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQKNASLEKNINDLQIDQPASQTEL 1154
            + +   L +    LR ER+ L+TK+T  +RD  +++QK + ++  + D +     S+ E 
Sbjct: 1137 STNGPGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEK 1196

Query: 1155 QCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIYEELTIRQEEVSQLKS 1214
            +  + II + +DI +++ Q+NLL+E+N  L+  L+N   K +E+  EL   ++ V+ ++S
Sbjct: 1197 ENHSSIIQQHDDIMEKLNQLNLLRESNITLRNELENNNNKKKELQSELDKLKQNVAPIES 1256

Query: 1215 DLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIEKLNSEISDFKAKLL 1274
            +L   K  +     ++ + + E+ + K+R  D+  +  ++     EKL SEI + K +L 
Sbjct: 1257 ELTALKYSMQEKEQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEKLESEIENLKEELE 1316

Query: 1275 DAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRDKLEQDLNSKNFKTV 1334
            + E    E E KFNRL++QA E+L  SK  Q +LT ++  L+  ++ LE  L+  N +  
Sbjct: 1317 NKERQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIE 1376

Query: 1335 DL 1336
            +L
Sbjct: 1377 EL 1378

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  330 bits (846), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 365/1390 (26%), Positives = 676/1390 (48%), Gaps = 95/1390 (6%)

Query: 4    KISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRIXXXX 63
            K++ FL V    +Q ++ S++   F K + F   + +  RL++ +D +K  +  +I    
Sbjct: 17   KVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTF- 75

Query: 64   XXXXXXXXQKNIASKELSHLQDQLMQDRERCRRKIDALNKQLDSSRDAIKRLNDEKDAKE 123
                     K    K LS +  +  + ++    K+  +N++   S + +K  +  ++AK+
Sbjct: 76   ---------KEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQ 126

Query: 124  ESMIRQSKHQNVNSV--------------QNVLDKENKLLRRKLMEMENILQICKSNSVS 169
               I  S  Q+V  +               + L   NK LR+  +++E I+Q  KS  + 
Sbjct: 127  GMEIIASAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELR 186

Query: 170  LQLKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRES 229
             + +   + QE  L+  N  W  ++L S N +  +      S ++N  E++   ++  E 
Sbjct: 187  EKSEIQRLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEF 246

Query: 230  ALSYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLAS 289
            A + +  L  +  +LS+ ++EK++E K L D    EK EF++EM+L++ + DLL SQ++S
Sbjct: 247  ARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSS 306

Query: 290  FERDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDK- 348
             + D  +     + + +   P+ + + DEL++TK   + +Q E  +L+  +++ +  +  
Sbjct: 307  MKSDLENAYQSANQNGMST-PEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGK 365

Query: 349  ---ATVDTNGAS-------HTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHK 398
               A +++N +         TV KL  DI +L+KQL++ER QK +LQNQ+E F++ELEHK
Sbjct: 366  NGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHK 425

Query: 399  TPELVSFKERTKSLEHELKRSTELLETISMAKRKDER--ELTSLRQKINSCEANIHLLVK 456
             P L SFKERT  LE EL   T LLE  S AK++D++  EL   + KIN+ E+ +  L+ 
Sbjct: 426  IPILNSFKERTDMLERELNDVTLLLE--STAKQRDQKTIELNQYKNKINNYESQVCSLIV 483

Query: 457  QRLDLARQVKVLLLNTSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEF 516
            QR DLA QV+ LL+  S       PL++ ++  +++I+ S  +  ++D Q IISERLV+F
Sbjct: 484  QRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQF 543

Query: 517  NNINELQEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKM 576
             ++ ELQ KN ELL  IR LADKLE  E K    L  VE QT+KEAK+AI+ L+    ++
Sbjct: 544  KSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRL 603

Query: 577  ESRINILLRERDSYKLLASSKENNVNVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQ 636
            E ++ I+ +ERD++KL  S+ +   +  +  +     ++ I ELE  L +   +S   I+
Sbjct: 604  EDQLKIVSKERDAFKLANSANKQGDSAPSSTYQSKKLDEHIMELEKRLKNLAEQSQDNIK 663

Query: 637  NLRKELTTYKKLLCDKKIASQDFENFKMLAKEKESILET--------------RVNNLKT 682
             L  E+    K   +  +  +   + K+LA+E+  ++++              R ++L+ 
Sbjct: 664  LLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQR 723

Query: 683  DLEKQKLSVPSFVQDNKVRDSTELLQSRTKTEILMHEISSLKKETANSMVLKESLTRDLE 742
             L KQ     S + D  +   ++L    +K  IL  E   L+K  A      E+LT++  
Sbjct: 724  VLLKQDEKTQSTI-DEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKE-- 780

Query: 743  RCCKEKI---QLQMKLKESEISLNEQKVNFDSKGIKYDARIKQXXXXXXXXXXXXKSKAQ 799
                 KI   QLQ   +E +I L E + N       Y   I++              + +
Sbjct: 781  -NTTSKILVSQLQTLQRERDILLEEAQTN-------YRKNIEKLESDLHETREHLVRRTR 832

Query: 800  EIXXXXXXXXXXXXWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKL 859
            E             W Q  +D   E+L +    L  K  ++ TL    ++L  +L E +L
Sbjct: 833  EYEEQRVSDTSQYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAEL 892

Query: 860  K---YEFLNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQL 916
            +   Y  L N  D +     LRK LE+  + L DA+SQ+  Y+ +   +E++  E++  L
Sbjct: 893  RTQSYSVLANADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKAL 952

Query: 917  ASMKEDYDARIELECKEK--------LANXXXXXXXXXXXXXXXXXQPKLKEGTVCLVKQ 968
               + +Y   I L  +E+        L N                 Q +  E    L+K+
Sbjct: 953  EESQANYRKNIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSE----LIKK 1008

Query: 969  SEKLRNQAEKIQEMKA----KIDKMNWNV---QVYKKEKTSQFQSIMKANKELSELVTRL 1021
               L+     + E+K+    KI K+  ++     Y  +    ++  ++ + ++++ ++ L
Sbjct: 1009 LSILQGSQRSLDELKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLL 1068

Query: 1022 EKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSVL 1081
             +E+   + E++  K S  + +  L+ +E+ W ++ AD E +L    ++TE L  +N +L
Sbjct: 1069 REESQKYKSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLL 1128

Query: 1082 IEKIGSVTEGSDGNEDYLKLVS-----FFSNLRHERNSLETKLTTCKRDLALVKQKNASL 1136
             +++  +++ +  + +    +S         LR ER+ LETKL    R+  +++Q+    
Sbjct: 1129 YDQVELLSKATSSDSEAAASMSAESRELIMTLRRERDILETKLDVSIREEKILRQRLGLA 1188

Query: 1137 EKNINDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNR 1196
            +  + +++++   +Q     S    +    I +++ Q+NLL+E+N  L+   K   E+++
Sbjct: 1189 KTELENVRLEFSKTQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQ 1248

Query: 1197 EIYEELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQK 1256
                E+   QE++  L+S L      +S    +I + + E  + KQR  D+  +   +  
Sbjct: 1249 HFQNEIAKLQEQLQPLESQLKSLTITISERDQQISLLKEESSRWKQRSQDILHKYERIDP 1308

Query: 1257 KTIEKLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELK 1316
               +KL  E+++ K +L        E + +F +L+KQA+E+LD  K  +  + +E + + 
Sbjct: 1309 VEHQKLADEVTELKNELEKKSLENLESQERFRKLRKQANERLDEFKAAKAKVESEFEAVS 1368

Query: 1317 AVRDKLEQDL 1326
              + +LE +L
Sbjct: 1369 IAKAQLEAEL 1378

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 100/213 (46%), Gaps = 39/213 (18%)

Query: 1458 LKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSL------TFSCDRKETNDDPDE 1511
            LKKRIRLPSEERI ++I +R+  L++EF+ +++  A  L      +F  D  +   +  E
Sbjct: 1562 LKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELFKENPESFVGDTAKLIKEHQE 1621

Query: 1512 DLWNSPSKGNSE----RPSVITDFMKQKNIKVQEQLKKAKNGVFFGDSRSSSMNKENSAL 1567
            ++    +K + +    R     +  +Q  +KV  +L ++K     G     ++N    + 
Sbjct: 1622 EMDKLEAKFDEQLALVRKKAFEEGKQQLVMKV--KLLESKIAKLEGQPNKINLNNSVPSK 1679

Query: 1568 VKVNDDKAAST--------------FSFGKPLFPSTTTSFQSFQNPFTQSTIDSNTGVSL 1613
            + ++++  +S                +FGK +     TSF SF+     S +DS   ++ 
Sbjct: 1680 IPIDNNNNSSPQGAQPIAIKPSPFQVAFGKAM---ENTSFGSFKG----SLLDSKQFIA- 1731

Query: 1614 PTFNIRTDLLAG-VATDTSKT---DGLANNSPD 1642
             T +  T  L G V T+T+K    D LA  SP+
Sbjct: 1732 NTADTSTSTLTGNVGTNTNKRQSEDELA-QSPE 1763

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  322 bits (826), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 452/1828 (24%), Positives = 869/1828 (47%), Gaps = 211/1828 (11%)

Query: 5    ISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRIXXXXX 64
            I  FL VP E L  I  S+L  L  K++ F   + +  +  V ++E++     RI     
Sbjct: 16   IGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEELQKTSQGRINDLRT 75

Query: 65   XXXXXXXQKNIASK-----------------ELSHLQDQLMQDRERCRRKIDALNKQLDS 107
                   Q   AS+                 +LS  +D L  + +  + K D L KQ   
Sbjct: 76   QLEDLIEQNASASEEKKKIEKELSDEKKESFQLSSTRDNLRAELKEIQEKFDNLQKQ--- 132

Query: 108  SRDAIKRLNDE--KDAKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKS 165
            ++D IK L+ +  ++  E+ +  +  +Q   S     D E+++   + ++  + L     
Sbjct: 133  NQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEI---QSLKYNDSLTETTM 189

Query: 166  NSVSLQLKYDTIVQEK-ELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQ 224
            N +S  LK  + ++E+ E  L+NK   ++K+S Y +   A+  T   +I  LE      +
Sbjct: 190  NKLSQDLKSISEIKERLETELENK---DKKMSEYYSNCQAEIQTLRKKISTLENNCSIIK 246

Query: 225  ADRESALSYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLS 284
            ++ ++       L  +N+ +S ++ EK  +++ L +    EK E  KE++L++ M D+L 
Sbjct: 247  SENDA-------LKKENRIVSSNLHEKSSKVQELTNLYNTEKEESQKELSLKQEMIDVLQ 299

Query: 285  SQLASFERDHSSGEIGKDDDNLCKDPDHNNVTDE-----LMNTKVQFQKSQDECQRLQNI 339
            +Q+   + D++   I      + ++ +  N+  E     L+ T+ Q  K   E +  +NI
Sbjct: 300  TQVQKLQDDYTR--ILNTKQPIVQNDEERNLEVEELKQKLIETETQLNK---ELEERRNI 354

Query: 340  ISDFVQEDKATVDTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKT 399
                +Q + +T+              D+  ++K+LI+ER QK +LQNQ+E FI+ELE K 
Sbjct: 355  T---MQTESSTLSNQQQE--------DLDTIKKELIQERYQKEKLQNQVEIFIVELEKKV 403

Query: 400  PELVSFKERTKSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRL 459
            P + SFK+RT  LE EL  +T LLE +   K +   EL +LRQ   S +     L KQR 
Sbjct: 404  PTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRN 463

Query: 460  DLARQVKVLLLNTSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNI 519
            DLA Q++ +L++TS    +  PLS +++  ++ IL++ S+   +D+Q +ISERLV F NI
Sbjct: 464  DLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILDNESNEESSDSQQVISERLVTFQNI 523

Query: 520  NELQEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESR 579
             ELQ+KN++LL  +R LA KLE  E  + +T   VE+Q I EAK+AII L++ N K+E +
Sbjct: 524  VELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDK 583

Query: 580  INILLRERDSYKLLASS----KENNVNVNAKNFTEISHEKKIKELEAELSSTKVESSAVI 635
            I  L  E D YK L       +  ++ +N +N T++     IKELE  L++++ ES+   
Sbjct: 584  IKTLNDELDCYKSLPKPDTKVETEHLRLNEEN-TDL-----IKELETRLATSREESNKTF 637

Query: 636  QNLRKELTTYKKLL------CDKKIASQDF--ENFKMLAKEKESILETRVNNLKTDLEKQ 687
             +L  E+   ++        C  + AS++   +  K++   + S+  ++V N +     +
Sbjct: 638  ASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLI---QNSLSLSKVENEQLQKRLE 694

Query: 688  KLSVPSFVQDNKVRDS-TELLQSRTKTEILMHEISSLKKETANSMVLKESLTRDLERCCK 746
             L   +  QD + +++  E +  +       +E++ ++ +   S   ++SL  D+    K
Sbjct: 695  ILQDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSK 754

Query: 747  EKIQLQMKLKESEISLNEQKVNFDSKGIKYDARIKQXXXXXXXXXXXXKSKAQEIXXXXX 806
            E+ +L+  + + +    E++  F+S  +    R+              K+K +EI     
Sbjct: 755  ERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELES 814

Query: 807  XXXXXXXWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLK---YEF 863
                   W QN ID  +EK  +   EL  K   +  L+ +I+ L  +L+ ++ +   Y+ 
Sbjct: 815  NRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKV 874

Query: 864  LNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQLASMKEDY 923
            LNN+ +  T    L+ ELE++++ L +A++++  Y++  S  E+ L+   + +   K+++
Sbjct: 875  LNNSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKEF 934

Query: 924  DARIE---------LECKEKLA------NXXXXXXXXXXXXXXXXXQPKLKEGTVCLVKQ 968
              +IE         L+ K  L+      N                   KL E    L+ Q
Sbjct: 935  IRKIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNE----LLAQ 990

Query: 969  S---EKLRNQAE-KIQEMKAKIDKMNWNVQVYKKEKTSQFQSIMKANKELSELVTRLEKE 1024
            +   E++ NQ E K+  ++  +++       Y     + ++  ++ + EL++ +++L ++
Sbjct: 991  NHNIEEVSNQYELKLSTLQNDLEQQ----ASYANIAQNNYEQELQKHAELAKTISQLRED 1046

Query: 1025 ATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSVLIEK 1084
            A   + ++  ++++    ++LL  +EK W E++  YE ++ +  ++ E L  +N +L ++
Sbjct: 1047 AHTYRKKMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQ 1106

Query: 1085 IGSVTEGSDG---------NEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQKNAS 1135
            +  +++  +          NED         +LR +R+ L+T+L+  + +   ++ K +S
Sbjct: 1107 VDLLSKSENSYNQQSSATPNED------LVLSLRSDRDILQTRLSVTEEEGKALRLKLSS 1160

Query: 1136 LEKNINDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKN 1195
            +   + + +      + + + + + ++E ++I  ++ Q+NLL+E+N  L+    +  EK 
Sbjct: 1161 VNTELTNTRAKLTEIRQQYENTKISVEEHDNIMNQLNQLNLLRESNITLRNEANDSREKA 1220

Query: 1196 REIYEELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQ 1255
            +++ E+L   +E+V  L+++  + KE +  N  ++  Y+ E ++ KQR  D+ T+ +++ 
Sbjct: 1221 KQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKID 1280

Query: 1256 KKTIEKLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKEL 1315
                EKL +EI+  K  L D +    EL ++FNR+KKQAHE+L++SK  Q  L +++K+L
Sbjct: 1281 PVEHEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQL 1340

Query: 1316 KAVRDKLEQDLNSKNFKTVDLDTEPKEHTVQSGDL--LRDQEKVASLP------------ 1361
            +     ++  L ++     + + + ++   QS D+  LR Q + A L             
Sbjct: 1341 EDENAHIQSLLETERGNIQNTEEKFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNASV 1400

Query: 1362 ---------LIEEIESLKRELQVFKNANNS----------SDAFEKLRDNMXXXXXXXXX 1402
                     L + I+SL  EL   K + N+          S+  E+++ +          
Sbjct: 1401 KSSDEISSHLNDVIDSLNNELTHLKESKNNEATVTGQPDLSNVVEEMKKSFEEEKIKFVQ 1460

Query: 1403 XRTKEFEKKLEEIVSKSKSTGKVADNS-----ENIXXXXXXXXXXXXXXXXXXXXXXXXN 1457
             +T EF++KL E V + ++      N      ++I                        N
Sbjct: 1461 DQTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEEN 1520

Query: 1458 LKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSL-------TFSCD-----RKET 1505
            LK+RIRLP+EE+I  +I K+K ELE+E+  K+ + A  L       TF  D     +KE 
Sbjct: 1521 LKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLSSEENKTFIEDLKNDIKKEL 1580

Query: 1506 NDDPDEDLWNSPSKG---NSERPSVITDFMKQKNIKVQEQLKKA------KNGV------ 1550
              + D++L N+ +K      ++  + T F+++K  K++ QL+ +      KN V      
Sbjct: 1581 ERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGSNAANENKNDVEVLLKT 1640

Query: 1551 -----FFGDSRSSSMNKENSALVKVND---DKAASTFSFGKPLFPST----TTSFQSFQN 1598
                      +  +++K   + +++ +       +T +  +   PS+    + S   F +
Sbjct: 1641 PSDENNVPSKQEETLSKPQLSKIQIANPLLSTGGTTLALNQSRAPSSLQNGSDSSNPFTS 1700

Query: 1599 PFTQSTIDSN-TGVSLPTFNIRTDLLAGVATDT-SKTDGLANNSPDEEEITEIG---STL 1653
            PF Q+  D+N   V+ P F +R      ++  T S+      N+  E  ++  G    + 
Sbjct: 1701 PFQQTKNDANIPAVTQPAFLLREPSEPNMSVSTISRQSTSETNTESELPVSSEGLATPSS 1760

Query: 1654 KRPNEEDA-----SSDPNTKKVKESPED 1676
            KRP +ED       ++   KK K  PE+
Sbjct: 1761 KRPAQEDTEEEKLDAETPKKKSKTEPEN 1788

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  292 bits (747), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 372/1453 (25%), Positives = 674/1453 (46%), Gaps = 150/1453 (10%)

Query: 16   LQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKS----------QYYSRIXXXXXX 65
            +Q +   ++R L+ +   F   E E TRL V +   +S          +   ++      
Sbjct: 32   VQQLGEQLVRTLWGREQAFRQLEAENTRLKVSIGAAESACEHGVEALRERQQQLAAEAGA 91

Query: 66   XXXXXXQKNIASKELS-HLQDQLMQDRERCRRKIDALNKQLDSSRDAIKRLNDEK----D 120
                  +   A +     + +++ Q  E   R++ A     DS+R  + RL +EK    D
Sbjct: 92   QQRGQGEAGSAGRAGGPSVPERVQQQLEETERRVAAG----DSARRDLARLLEEKISDLD 147

Query: 121  AKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQLKYDTIVQE 180
            A ++ + R         V  V    NK LRR  ME+E  +Q  +S S+  Q +   + QE
Sbjct: 148  ASQQELER---------VLGV----NKELRRHEMELEFTVQSQRSQSLREQAEIQRLQQE 194

Query: 181  KELMLQNKKWT-------EEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESALSY 233
              L+  N +WT        ++L+SY  KT  +       I++ + +L   + + E   + 
Sbjct: 195  LALVRSNAEWTTGQLNEKNQQLNSYREKTNGE-------IQSTQVELNIVKNELEVEHAN 247

Query: 234  SQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFERD 293
               L  +N +LS  +++ + E K L D+   EK EF++EM L++ + +LL+ Q+A+ ++D
Sbjct: 248  VAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQD 307

Query: 294  -HSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQED----- 347
               + ++ K+      D +   + ++L +TK + + SQ    RL++ I + ++ D     
Sbjct: 308  LEKAYDVAKNGG--MSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSG 365

Query: 348  ------KATVDTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPE 401
                   A V +     T+  ++ D+  LRKQL++ER  K +LQ Q+E F++ELEHK P 
Sbjct: 366  GRNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPV 425

Query: 402  LVSFKERTKSLEHELKRSTELLETISMAKRKDER--ELTSLRQKINSCEANIHLLVKQRL 459
            L SFK+R + LE +L   T LLE  + A+ +DE+  ++   + K+   E  +  LV+QR 
Sbjct: 426  LNSFKKRIEELEKQLNGVTLLLE--ATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRS 483

Query: 460  DLARQVKVLLLNTSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNI 519
            DLARQV+ LL++ S    ++ PL+ +++  ++K+         +D QAIIS RLVEF ++
Sbjct: 484  DLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSV 543

Query: 520  NELQEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESR 579
             ELQ+KN ELL  IR LA KLE  E K  + +  +E+ T+ EAK+AI+ L+     +E +
Sbjct: 544  VELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQ 603

Query: 580  INILLRERDSYKLLASSKENN-----VNVNAKNFTEISHEKKIKELEAELSSTKVESSAV 634
            +  +  ERDS+KLL S  +NN     V   A    E++    I  LEA L +   ES   
Sbjct: 604  LETVTTERDSFKLLVSEGKNNSLPNPVGAAALQPQEVAD--GIAHLEARLKAMAEESEQH 661

Query: 635  IQNLRKELTTYKKLLCDKKIASQDFENFKMLAKEKESILETRVNNLK---TDLEKQKLSV 691
             + L +E+    K      I  +   + + LA EK S+++  +  +K    DL+ +  S+
Sbjct: 662  AKMLNEEIKALYKSNSQLAIELERERSSRELADEKLSLIQKSLELVKGENADLQNRAGSL 721

Query: 692  PSFV--QDNK--------VRDSTELLQSRTKTEILMHEISSLKKETANSMVLKESLTRDL 741
             + +  QD +        V   +EL    ++  IL  E   L+K  A+     ESL +D 
Sbjct: 722  QALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKDN 781

Query: 742  ERCCKEKIQLQMKLKESEISLNEQKVNFDSKGIKYDARIKQXXXXXXXXXXXXKSKAQEI 801
                   +QL+   KE +  + E +        +Y+ RI++            + K +E 
Sbjct: 782  NDSQLLILQLKTAQKERDSLIEETRK-------RYETRIEELDGELSATKQQLERKQREY 834

Query: 802  XXXXXXXXXXXXWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLKY 861
                        W Q+ +D  +E+L S    L  K   +  L +++ +  ++L    + +
Sbjct: 835  DELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDH 894

Query: 862  E--FLNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQLASM 919
            +   L   SD ++   +L K+L++   +L  A+S++  Y+   +  E+     N+   + 
Sbjct: 895  QQSSLVLESDHASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQDNK 954

Query: 920  KEDYDARIELECKEKLANXXXXXXXXXXXXXXXXXQPKLKEGTVC-----LVKQSEKLRN 974
                 A I LE   +L                   +   +E T       L ++   L  
Sbjct: 955  DGSKQAAISLEA--ELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVT 1012

Query: 975  QAEKIQEMKA----KIDKMNWNVQ---VYKKEKTSQFQSIMKANKELSELVTRLEKEATD 1027
              ++I+E KA    KI ++  +++       E  +++Q+ ++   E+SE +  L K +  
Sbjct: 1013 DKQRIEEAKADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSES 1072

Query: 1028 SQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIGS 1087
             + E+ K KS+  + + +L+ +E+ W ++KAD E  L    ++ E L  +N +L ++I  
Sbjct: 1073 YKSEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIEL 1132

Query: 1088 VTE------------GSDGNEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQKNAS 1135
            ++              SD  E           LR ER+ LETK+   KR+  +++Q+   
Sbjct: 1133 LSRSPSSSLEPDTKISSDARE-------LIVTLRRERDILETKIDVSKREEKMLRQRLEL 1185

Query: 1136 LEKNINDLQIDQPASQTELQCSAVIIDEFND-------ITKEIAQVNLLKENNAILQKSL 1188
             +  +++L       + +L  S  ++ E  D       + +++ Q+NLL+E+N  L+   
Sbjct: 1186 TKSELDNL-------RAQLSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNES 1238

Query: 1189 KNVTEKNREIYEELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLS 1248
            + V+E N  +  E+   QE+V  ++  +      ++    K+ + + E D+ KQR  D+ 
Sbjct: 1239 EKVSEHNEFLQNEILSLQEKVQPMEEQIKSLTATLTEKEQKLALLKEESDRWKQRSQDIL 1298

Query: 1249 TQQREVQKKTIEKLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTAL 1308
             +   +  +   KL SEI   KA+L        + + +F +L+KQA+E+LD  K  +  +
Sbjct: 1299 HKYERIDPEEYRKLASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKV 1358

Query: 1309 TNELKELKAVRDKLEQDLNSKNFKTVDLDTEPKEHTVQSGDLLRDQEKVASLPLIEEIES 1368
             +EL+   + + +LE  L+    K   L+T+  E      D           P+  E+E 
Sbjct: 1359 ESELELALSGKSQLEAKLSEAREKITSLETQLTERPASEDD----------NPVSHELEE 1408

Query: 1369 LKRELQVFKNANN 1381
             K +LQ  +N  N
Sbjct: 1409 TKTKLQDAENTIN 1421

 Score = 44.7 bits (104), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 32/41 (78%), Gaps = 2/41 (4%)

Query: 1458 LKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSLTF 1498
            LKKRIRLPSEERI ++I ++++ LE+EF  K+  NA++L  
Sbjct: 1558 LKKRIRLPSEERINQVIERKQKALEQEFTTKV--NATALAL 1596

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  290 bits (743), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 408/1638 (24%), Positives = 773/1638 (47%), Gaps = 158/1638 (9%)

Query: 2    EDKISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIK---SQYYSR 58
            E +I+ FL+V   +++ +   +   +  K + F   + +  R NVL++E K   S  Y +
Sbjct: 6    ESEIATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEK 65

Query: 59   IXXXXXXXXXXXXQKNIASKELSHLQDQL-------MQDRERCRRKIDALNKQLDSSRDA 111
            +            +    +K LS     L       + +  + +   + L   +D + + 
Sbjct: 66   LKEELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNNIDRANER 125

Query: 112  IKRLNDEKDAK--EESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVS 169
             K LN   D K  E   IR  K +        L  + K L  K++E+E   Q  +S+ ++
Sbjct: 126  YKELNGSYDEKVTELEHIRDEKKE--------LQTQIKTLNDKILELELKCQEYQSSELN 177

Query: 170  LQLKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRES 229
             + + +   QE  L+ +N++W E++L++ N   +         + +    + + ++D + 
Sbjct: 178  RKSELERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDLKI 237

Query: 230  ALSYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLAS 289
              S  ++L  +  + +  ++  ++E K+LKD   +EK EF KE++++  +  L  +Q+ S
Sbjct: 238  EKSSKEILSKKLDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKS 297

Query: 290  FE------------RDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQ 337
             E             + +S E+ K            ++ +EL   + + Q  +++C RL+
Sbjct: 298  LESTLQQKFKTAEANEENSSEVVK------------SLKEELSLAERKLQDMEEKCVRLE 345

Query: 338  NIISDFVQEDKATVDTNG----------------------ASHTVGKLFSDIKVLRKQLI 375
            +I+ D    D  ++ T G                      +S ++ ++  DIK+L++QL+
Sbjct: 346  SIL-DHDSND-VSLQTKGRKRTYSNDSNSNSSDELGSFDDSSISLSRMQGDIKILKRQLV 403

Query: 376  KERSQKFQLQNQMEDFILELEHKTPELVSFKERTKSLEHELKRSTELLETISMAKRKDER 435
            +E+ QK +LQNQ+E F++ELEHK P + SF+ERT  LE EL  +  LLE  +        
Sbjct: 404  QEKRQKEKLQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTN 463

Query: 436  ELTSLRQKINSCEANIHLLVKQRLDLARQVKVLLLNTSAIQKTTLPLSKDDLISLRKILE 495
            EL SL++KI+   + + +L++QR DLA Q++ LL+N S I      L++D++  ++ ++ 
Sbjct: 464  ELQSLKKKISDDNSQLEILLRQRTDLAHQLQYLLINISIINDNDHLLNEDEIKFIKNLVS 523

Query: 496  SGSDVNENDAQAIISERLVEFNNINELQEKNVELLYCIRTLADKLEFHEGKKDTT---LA 552
            + +  + ND+Q +ISE L++F +I +LQEKN+EL+  +RTLA +LE +E KK +T     
Sbjct: 524  NDNMASTNDSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTV 583

Query: 553  EVEKQTIKEAKDAIIELENTNMKMESRINILLRERDSYKLLASSKENNVNVNAKNFTEIS 612
            + + +   EAK+AI+ LE  N  +E  + I+ +ERD++KLL  S++   N  + N     
Sbjct: 584  DEDNEIFAEAKEAILTLEKVNENLEKNLQIVTKERDAFKLLV-SEDRERNFKSSNSVHKY 642

Query: 613  HEKK------IKELEAELSSTKVESSAVIQNLRKELTTYKKLLCDKKIASQDFENFKMLA 666
            HE K      +K+LE  L+    +S+A  + L +EL    K +    +  + + + K LA
Sbjct: 643  HELKSYNETVVKDLENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLA 702

Query: 667  KEKESILETRVNNLKTDLEKQKLSVP----SFVQDNKVRDST--ELLQSRTKTEILMHEI 720
            +E+  I +  +  L  + E+ ++       S +Q +K    T    +++ +K   L   +
Sbjct: 703  EERLKITQNSMELLSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSV 762

Query: 721  SSLKKETANSMVLKE---SLTRDLERCCKEKIQLQMKLKESEISLNEQKVNFDSKGIKYD 777
             +L+ E     +LK+   SL  +L    +EK +L++ + + +   +E++   +     + 
Sbjct: 763  RNLETEVT---LLKDREISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFK 819

Query: 778  ARIKQXXXXXXXXXXXXKSKAQEIXXXXXXXXXXXXWAQNTIDDTEEKLKSVLTELSRKE 837
             RI +              +  EI            W Q  ID+  ++ + +  +L  K 
Sbjct: 820  KRISEVNYINEKLDKQLSERVHEIDKIEKERNAQYEWYQKKIDEASQQQQQIQGQLQTKN 879

Query: 838  KTVVTLSSKIENLDNELRENKLK---YEFLNNTSDASTLQPALRKELEQTQLELKDAHSQ 894
              +  L  + + L+ EL   +++   YE +N  +  +  +  + KELE+T++EL DA+SQ
Sbjct: 880  DELERLHLQNKTLEKELEGAQIRIHTYETINQNNSENQEENDVIKELEKTKIELADAYSQ 939

Query: 895  VRTYEEIISTNEKALKELNSQLASMKEDY-DA-------RIELECKEKLANXXXXXXXXX 946
            +  ++ +   +E ALKELN+   +   DY DA       + E+E + ++           
Sbjct: 940  LEEFKNLSQNSEDALKELNASFNAKDRDYRDAIKTLTEEKTEIEGRFEILKQQLENIKNE 999

Query: 947  XXXXXXXXQPKLKEGTVCLVKQSEKLRNQAEKIQEMKA----KIDKMNWNVQ---VYKKE 999
                    + + K  T  +     +L+  A+ I+E+K     K+ K+  +++   VY   
Sbjct: 1000 LTVQSEEAESERKRLTQTIA----ELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANN 1055

Query: 1000 KTSQFQSIMKANKELSELVTRLEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKAD 1059
                ++  ++ + ++S+ ++ L ++    + + K L + L   QD +  +EK    E+ +
Sbjct: 1056 AQKNYEQELQRHADVSKTISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDE 1115

Query: 1060 YEREL------ISNIEQTESLRVENSVLIEKIGSVTEGSDGNEDYLKLVSFFSNLRHERN 1113
            Y  ++      I +I +   L      L+ +  SV E S  +E         S LR ER+
Sbjct: 1116 YRIQIDLAQQRIDDITKQNQLLYNQIDLLNRAESVNENSSDDEANGSTALVLS-LRRERD 1174

Query: 1114 SLETKLTTCKRDLALVKQKNASLEKNINDLQIDQPASQTELQCSAVIIDEFNDITKEIAQ 1173
             L+TK+   + +   ++QK   ++  + + +      ++E    + +I+ +  I  ++ Q
Sbjct: 1175 ILDTKINVIETEKNSLQQKLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQ 1234

Query: 1174 VNLLKENNAILQKSLKNVTEKNREIYEELTIRQEEVSQLKSDLIKTKEQVSVNANKILIY 1233
            +NLL+E+N  L+  LK   ++  +I ++L I + E+  L+S+L      +     KI   
Sbjct: 1235 LNLLRESNVTLRNELKQALDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASA 1294

Query: 1234 ESEMDQCKQRYHDLSTQQREVQKKTIEKLNSEISDFKAKLLDAENTKT-ELENKFNRLKK 1292
              E  + K R  ++  + ++V      KL   +++ K +LLD +  +T EL ++FNRLKK
Sbjct: 1295 NDESQRWKTRLEEMIEKHQKVNVDDYTKLEETLNETK-QLLDNKVQETNELNDRFNRLKK 1353

Query: 1293 QAHEKLDASKKQQTALTNELKELKAVRDKLEQDLNSKNFKTVDLDTEPKEHTVQSGDL-- 1350
            QAHEKL+ SK+ Q++L  ++  L + +D + + L+ K  +  +L +E      +  DL  
Sbjct: 1354 QAHEKLNTSKELQSSLQEQISNLISEKDDIRKQLDVKTEENSELLSELNNFREKQNDLET 1413

Query: 1351 LRDQ---------------------EKVASLPLIEEIESLKRELQVFKN--ANNSSDAFE 1387
            LR++                       +AS    +EIE L++ +   K   A NS+DA E
Sbjct: 1414 LREELNKEISKSEELEVKLQNEIESSSLASRNTNKEIEELQKVIDDLKTQLAANSTDADE 1473

Query: 1388 KLRDNMXXXXXXXXXXRTK-------EFEKKLEEIVSKSKSTGKVADNSE-----NIXXX 1435
            +   N+          +TK       EF K+L E   K ++  +  +  +     ++   
Sbjct: 1474 QTNRNVEAIKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQENEKPDTELNVDVEAL 1533

Query: 1436 XXXXXXXXXXXXXXXXXXXXXNLKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASS 1495
                                 NLKKRIRLPSEE+I KII KR+ ELE EF +K+++ A  
Sbjct: 1534 RKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKARD 1593

Query: 1496 LTFSCDRKETNDDPDEDL 1513
            L  +    E N++  E L
Sbjct: 1594 LLMNDHSNEFNNELKEAL 1611

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
           similar to uniprot|Q02455 Saccharomyces cerevisiae
           YKR095W MLP1 Myosin-like protein associated with the
           nuclear envelope connects the nuclear pore complex with
           the nuclear interior involved in the Tel1p pathway that
           controls telomere length involved in the retention of
           unspliced mRNAs in the nucleus
          Length = 1748

 Score =  232 bits (591), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 253/940 (26%), Positives = 453/940 (48%), Gaps = 69/940 (7%)

Query: 4   KISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRIXXXX 63
           ++++FL V  + +Q IN  VL ++ +K+++    + E  R+   +D++KSQ  +++    
Sbjct: 9   RVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESFK 68

Query: 64  XXXXXXXXQKNIASKELSHLQDQ---LMQDRERCRRKIDALNKQLDSSRDAIKRLNDEKD 120
                          E  H +++   L++   +  ++I  L ++++  R   +  +  K 
Sbjct: 69  IHISQLAKALEDGKDERLHFEEEKRRLIEGNSQVTKRIIELEQEIEVERQQKELADASKQ 128

Query: 121 AKEESMIRQ-----SKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQLKYD 175
              ES+  +     S    +N  Q      NK LR+K++  E  LQ  ++  + L+ K +
Sbjct: 129 DIAESLNEKIEELSSTKAKLNEAQGA----NKELRQKVVNTETELQTQQA--LELRSKSE 182

Query: 176 TIVQEKELML--QNKKWTEEKLSSYNNKTLADESTKASRIRNLEE---KLYQAQADRESA 230
            +  E+E+ L  +N  W   +L   N KT+     + S I  L++   K+   +++ E A
Sbjct: 183 ILRMEQEITLLRENNDWLTNQL---NTKTVQLNEFRESTISELQDSQLKVSNMESELEIA 239

Query: 231 LSYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASF 290
            + +Q L      L   +E+K+ E K +KD     K E +KEM+L++ M D L   + S 
Sbjct: 240 RTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESL 299

Query: 291 ERDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQ----E 346
           +++  + +   D      + + + + +EL   K +   S+  C +L+  I +       E
Sbjct: 300 KKEMDATKNNMDSSYFT-EKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLE 358

Query: 347 DKATVDTNGASH----TVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPEL 402
           D    +T  +S      + KL+ D+ +L+KQL+ E+ QK +L+ Q+E F++ELEHK P L
Sbjct: 359 DSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVL 418

Query: 403 VSFKERTKSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLA 462
            SFKER++ LE EL   T LLE+    + +   +L  L+  + S E  I  L KQR+DLA
Sbjct: 419 NSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLA 478

Query: 463 RQVKVLLLNTSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINEL 522
            Q++ LL+N S   +   PLS ++L  ++ +  S      +D Q II++RLVEF ++ EL
Sbjct: 479 HQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVEL 538

Query: 523 QEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINI 582
           Q+KN ELL  IR LAD+LE  E +  + +  +E +T++EAK+ I+ L +    +E+++ I
Sbjct: 539 QQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVI 598

Query: 583 LLRERDSYKLLASSKENNVNV-NAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLRKE 641
           L +ERD+YK L+ +  +  N   A  +    ++ K+K+LE  L++   E+    +    E
Sbjct: 599 LSKERDAYKALSVNASSGTNTPKAITYPSPDNDDKVKDLETRLTAVIQEAENNAKEWSSE 658

Query: 642 LTTYKKLLCDKKIASQDFENFKMLAKEKESILETRVNNLKTDLEKQKLSVPSFV------ 695
            +  +K L +    S +FE+     K   ++ E R+N L++ LE  K             
Sbjct: 659 NSNLRKKLYE---ISLNFES----EKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDL 711

Query: 696 ------QDNKVRDSTE-LLQSRTKTEILMHEISSLKKETANSMVLKESLTRDLERCCKEK 748
                 QD + +++ + L+++++    +  E+S LK E      +++ L  + ER  KE 
Sbjct: 712 QDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKES 771

Query: 749 I-------QLQMKLKESEISLNEQKVNFDSKGIKYDARIKQXXXXXXXXXXXXKSKAQEI 801
           +       QLQ   +E E+ L E + ++  K  K +  +                 A   
Sbjct: 772 VEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIA--- 828

Query: 802 XXXXXXXXXXXXWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLK- 860
                       W Q  ID    +     T L  KE  +  + S I     +L+E + + 
Sbjct: 829 ----SNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARA 884

Query: 861 --YEFLNNTSDASTLQPALRKELEQTQLELKDAHSQVRTY 898
             Y  L+N  DA  L   LR+ELE+  L+L D++SQ+  +
Sbjct: 885 QSYTMLSNVDDAQNLVETLRQELEKVNLQLSDSYSQIEHH 924

 Score = 57.8 bits (138), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 75/160 (46%), Gaps = 24/160 (15%)

Query: 1458 LKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENAS---------SLTFSCDRKETNDD 1508
            LKKRIRLP++++I KI+  RK  LEE F+ K+ E A          ++T    R E N  
Sbjct: 1575 LKKRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIGNDAITLEKHRAELNAL 1634

Query: 1509 PDEDLWNSPSKGNSERPSVITDFMKQKNIKVQEQLKKAKNGVFFGDSRSSSMNKENSALV 1568
             D           S R     D  + K    +E  ++    + F +S+  ++ ++ S + 
Sbjct: 1635 KD-----------SMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQKSTIK 1683

Query: 1569 KVNDDKAASTFSFGKPLFPSTTTSFQSFQNPFTQSTIDSN 1608
             V +D +  + +F  P+F S +T    F +PF+ S I  N
Sbjct: 1684 PVENDTSNMSAAFQAPVFGSHST----FTSPFSTSEISPN 1719

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1554

 Score =  185 bits (470), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 232/789 (29%), Positives = 406/789 (51%), Gaps = 55/789 (6%)

Query: 3   DKISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRIXXX 62
           DKIS F  +P  + + ++   L K++ K   ++  +E  + ++  +D+IK  Y  +I   
Sbjct: 15  DKISSFFDLPGNTWESMDEHALEKIYTKA--YDLMKEN-SFVSAAIDDIKHVYEGKINTI 71

Query: 63  XXXXXXXXXQ-KNIASKELSHL--QDQLMQDRERCRRKIDALNKQLDSSR---DAIKRLN 116
                    + K +  KE  +L  +++L+ ++++     DALN ++   +   +A++R +
Sbjct: 72  SQKYFNLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDH 131

Query: 117 DEKDAKE---ESMIRQSKHQNVNSV--QNVLDKENKLLRRKLMEMENILQICKSNSVSLQ 171
              +A+E   E+++ QSK +  +S+   + L ++  +   KL  M   L +  + +  LQ
Sbjct: 132 TTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQ 191

Query: 172 LKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESAL 231
                +++E  L L+ K    +K     NK L   +  ASR   L+++L    ++  S  
Sbjct: 192 TGM-KLLRENNLYLEIKCKETDK-----NKKLYSSAEDASR---LQDQLQIVSSEILSLK 242

Query: 232 SYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFE 291
           S    L   N+ LS  ++ K+  IK+L D     K EF+KE+TL++ +N+LL +++AS++
Sbjct: 243 SEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYK 302

Query: 292 RDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKATV 351
           +     +I +      + P+   +  EL++ K +   S+ EC  L++ +  ++      +
Sbjct: 303 K-----QIERLTSKNLETPEKK-IIQELVDLKEKLVNSEKECNELKSTVDKYI-----NI 351

Query: 352 DTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKS 411
           D        G     I++LR+QL+KE+  K  LQ Q+E F++ELE K P + SFKER  S
Sbjct: 352 DEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSS 411

Query: 412 LEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQVKVLLLN 471
           LE EL R T  LE  +  +   +RELT+L++KI++ E     L++QR DLA QV+ LLL 
Sbjct: 412 LERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLL- 470

Query: 472 TSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINELQEKNVELLY 531
              I   + P ++ +   ++KI+ + +  N+ D+  IIS+RL+ F N+ ELQ+KN+ELL 
Sbjct: 471 --CIDNKS-PFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMELLR 527

Query: 532 CIRTLADKLEFHEGKKDTTLAEVEKQTIKE-AKDAIIELENTNMKMESRINILLRERDSY 590
             R L   LE  E ++  TL   +   I E AK   ++LE     +ES+INI+ +ERDSY
Sbjct: 528 TTRQLVQTLERQEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSY 587

Query: 591 KLLASSKENNVNVNAKNFTEISHEKKIKE-LEAELSSTKVESSAVIQNLRKELTTYKKLL 649
           KLL ++     N +  + + +   +  KE L  ELSS K +   V++ L  ++ T +K  
Sbjct: 588 KLLVTNSTIQSNTSNNSISSLQQCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQ 647

Query: 650 CDKKIASQ----DFENFK---MLAKEKESILETRVNNLKTDLEKQKLSVPSFVQD--NKV 700
              K+  +    +F+  K    L KE    LE ++  L+ DL + +L   + +    N +
Sbjct: 648 LTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNL 707

Query: 701 RDS--TELLQSRTKTEILMHEISSLKKETAN--SMVLKESLTRDLERCCKEKIQLQMKLK 756
             S   EL  +  K   L  EIS+LK +  N    +L  +L+++L     + +QL+  L 
Sbjct: 708 EQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNL--LDNKVLQLETSLS 765

Query: 757 ESEISLNEQ 765
           E E+  N Q
Sbjct: 766 ERELPKNTQ 774

 Score = 90.1 bits (222), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 126/482 (26%), Positives = 229/482 (47%), Gaps = 31/482 (6%)

Query: 1032 LKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIGSVTEG 1091
             K  K+SL + +  +++ +++ +  +++Y  E+    E+ E   V+ +    K+  + E 
Sbjct: 934  FKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGKVTEILES 993

Query: 1092 SDGN-EDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQKNASL-EKNINDLQIDQPA 1149
             DG   +   +     +L HE+  L   L +    L   + +N +  EK  + ++IDQ +
Sbjct: 994  YDGKILNTAAIGHLVRSLIHEKKMLALNLNSANYSLRRARYRNKNPREKFPSFVKIDQQS 1053

Query: 1150 SQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIYEELTIRQEEV 1209
             + E +   +      + TK +A    L+E+NA L K ++N T+ N  +  +L   Q ++
Sbjct: 1054 KKEEDKEEVM-----ENTTKLLA----LEESNAKLIKEVENCTKVNETLSSQLADMQVKL 1104

Query: 1210 SQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIEKLNSEISDF 1269
              L+ ++ + K +V+     + I + E+++ K R   +  Q + V+++   K   +I   
Sbjct: 1105 EPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTL 1164

Query: 1270 KAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRDKLEQDLNS- 1328
            + +L        +L ++F+RLKKQAHEKLDA+K  Q  LT ++ EL   +  LE+ L   
Sbjct: 1165 EEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQE 1224

Query: 1329 --KNFKTVDLDTEPKEHTVQ-------SGDLLRDQEKVA--SLPLIEEIESLKRELQ--- 1374
              KN ++ +   +  E  ++       S +   + EK    +     EIESLK ELQ   
Sbjct: 1225 IEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQSVK 1284

Query: 1375 VFKNANNSSDAFEKLRDNMXXXXXXXXXXRTKEFEKKLE---EIVSKSKSTGKVADNSE- 1430
             ++N+  +S   + L+++             KEF+ KLE   E +   +    +A+  E 
Sbjct: 1285 AYENSTVNSKIIKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQRKNNILANGQES 1344

Query: 1431 -NIXXXXXXXXXXXXXXXXXXXXXXXXNLKKRIRLPSEERIQKIISKRKEELEEEFQRKL 1489
             NI                        NLKKR+RLPSEE+I  +I KR++ LE+EF+ KL
Sbjct: 1345 ANIEELKKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKL 1404

Query: 1490 KE 1491
            +E
Sbjct: 1405 RE 1406

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1674

 Score =  176 bits (445), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 197/669 (29%), Positives = 350/669 (52%), Gaps = 70/669 (10%)

Query: 134 NVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQLKYDTIVQEKELMLQNKKWTEE 193
           N  S+ N+ D+        ++ ++  L+  KS  +  Q + +  +++ EL+ ++ +W EE
Sbjct: 92  NATSISNINDE--------ILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEE 143

Query: 194 KLSSYNNKTLADESTKASRIRNLEEKLYQAQADRE--SALSYSQ-LLLDQNKQLSHSVEE 250
            L     KT  +  T+   I  +EEK  +    R   S L  +  LLL +N++LS +V+E
Sbjct: 144 HLV----KTTEELMTQKQSILKMEEKDQEIDNLRHEVSILKKNNDLLLGKNQELSENVQE 199

Query: 251 KILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFERDHSSGEIGKDDDNLCKDP 310
           K++EIK   D    ++ EF  E+ L+  +N  L +QL   +++ S     +++DN  +  
Sbjct: 200 KLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQQEKSI----QNEDNTSR-A 254

Query: 311 DHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKATVDTNGASHTVGKLFSDIKVL 370
           +   + ++L++T+ Q + S++EC RL++ +++F+       D NG      +  S   +L
Sbjct: 255 ESQKIMEQLIDTRKQLKDSRNECTRLKSYVNEFIN------DVNG------EYSSSSSLL 302

Query: 371 RKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKSLEHELKRSTELLETISMAK 430
           +K+L+K + QK  L+ Q+E+FI ELE K P + S +++ K LE EL   T L++ IS+ +
Sbjct: 303 KKELLKVKEQKDYLETQVENFITELEIKVPVIDSLEKKNKDLEKELSDVTSLVDRISIER 362

Query: 431 RKDERELTSLRQKINSCEANIHLLVKQRLDLARQVKVLLLNTSAIQKTTLPLSKDDLISL 490
              E+E  S ++K    +  I  L  QR DLA Q++ LLL       T   LSKD+   +
Sbjct: 363 ESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFI 422

Query: 491 RKILESGSDVNENDAQAIISERLVEFNNINELQEKNVELLYCIRTLADKLEFHEGKKDTT 550
           R++ E+ +    ND+Q+IISERL++F +I ELQ++N+++L  +R LA +LE  E  +   
Sbjct: 423 RRLTENDTYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQAD 482

Query: 551 LAEVEKQTIKEAKDAIIELENTNMKMESRINILLRERDSYKLLASSKENNVNVNAKNFTE 610
              +E++T++EAK A+++L+     +E ++    +ERD YKLL+  K  + N  ++    
Sbjct: 483 HHTIERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVYKLLSKGKSPSSNKPSECNDI 542

Query: 611 ISHEKKIKELEAELSSTK----------VESSAVIQNLRKEL-TTYKKLLCDKKIASQDF 659
             H     +L+ EL  T+            ++  I N +KEL  + KK+   K+ A    
Sbjct: 543 DKH--TTGKLQNELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKMESAKEYAEGKA 600

Query: 660 E----NFKMLAKEKESILETRVNNLKTDLEKQKLSVPSFVQD-NKVRDSTELLQSR-TKT 713
           E    N  ML + ++S+LE   ++L+  L +++  +    QD +++     LLQ R T T
Sbjct: 601 ELIENNLLMLQENRKSVLEQN-DHLQQLLSQKEAKLAELTQDLHELTSQYNLLQIRFTDT 659

Query: 714 EILMHEISSLKKETANSMVLKESLT-RDLERCCKEKIQLQMKLKESEISLNEQKVNFDSK 772
           +             +NS+  +   T ++L    +EK  L++K+ E EIS NE       K
Sbjct: 660 Q-----------SQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNE------CK 702

Query: 773 GIKYDARIK 781
           GI+    +K
Sbjct: 703 GIQATVELK 711

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score =  163 bits (413), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 246/942 (26%), Positives = 429/942 (45%), Gaps = 90/942 (9%)

Query: 237  LLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFERDHSS 296
            L  +N++LS  +  KI EIK+L+++      +F  E  LQ  + + L +Q+ + +    S
Sbjct: 193  LFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLES 252

Query: 297  GEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDF-----VQEDKATV 351
                K DD   +  D + +  ++ N   + + S+ E   L + + +F      +    + 
Sbjct: 253  LSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNIPEEESSSVSS 312

Query: 352  DTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKS 411
              +G +++   L  D+ +LRK  +KER QK QL+ QM   + ELE   P L S+KER+  
Sbjct: 313  HASGRNNSALSLSGDVNILRKHFLKERQQKRQLEEQMRQILQELERNMPSLSSYKERSTF 372

Query: 412  LEHELKRSTELLETI-------SMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQ 464
            LE EL  S  LLE I       S    K E E ++LR  INS       L  QR  LARQ
Sbjct: 373  LEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINS-------LAFQRTVLARQ 425

Query: 465  VKVLLLNTSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINELQE 524
            VK LLL     +     L + DL  L + L + +    +D++ I+ ERL +F N+ ELQ 
Sbjct: 426  VKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVKELQN 485

Query: 525  KNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINILL 584
            +N++LL   R LA K E  E      ++  E +TI +AK+AI+ L+  + K+ES+I  L 
Sbjct: 486  RNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQIKELS 545

Query: 585  RERDSYKLLASSKENNVNVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLRKELTT 644
             E    K   + KE   +++A +  E        +L  +LS+    S  +I  L  E+  
Sbjct: 546  DELAVQKKEKTEKE---SISAMSKIEDDASSHTIDLGKQLSANLKHSKDIIDALNSEIEN 602

Query: 645  YKKLLCDKKIASQDFENFKMLAKEKESILETRVNNLKTDLEKQKLSVPSFVQDNKVRD-- 702
              +   D  I+    ++ + LA+++ ++LE  V+ LK++ E+ +  V    Q+  + D  
Sbjct: 603  LHQANTDVNISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEELQEEVNKLQQN--ILDKE 660

Query: 703  ------STELLQSRTKTEILMHEISSLKKETANSMVLKESLTRDLERCCKEKIQLQMKLK 756
                  S + +  ++K      EI+SL+ E   S+  + +L    E    E+  L+M + 
Sbjct: 661  KQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLNERNNLRMTVT 720

Query: 757  ESEISLNEQKVNFDSKGIKYDARIKQXXXXXXXXXXXXKSKAQEIXXXXXXXXXXXXWAQ 816
            +     NE +         YD ++K             +   Q +            W +
Sbjct: 721  QMNSLNNELQTLLKETKSGYDDKLKISALKCTQTNNQLQLVQQRMSELKSQNDSEIKWYK 780

Query: 817  NTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLKYEFLNNTSDASTLQPA 876
             TIDD +  +  +  EL +KE+ +   S  +EN+ NEL         L N+ D S  + A
Sbjct: 781  ATIDDLKANVFELNEELKQKEEKIEEFSKTLENVQNELT--------LANSKDVSEEKRA 832

Query: 877  LRKELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQLASMKEDYDARIELECKEKLA 936
            L KEL + + +L+ ++ +V+ YE +IST++++ +  + Q     +   ++++ E +E+  
Sbjct: 833  LEKELSEVKSQLEKSNLEVKEYENVISTSKRSFENKSIQYEDRIKALASKLDSELRER-- 890

Query: 937  NXXXXXXXXXXXXXXXXXQPKLKEGTVCLVKQSEKLRNQAEKIQEMKAKIDKMNWNVQVY 996
                              Q  L      +V Q ++L +    + E++   D +    + +
Sbjct: 891  ---------------TTLQENLSTLQARMVVQQDELTSNNNTLSELRVSYDSLLLEQKTF 935

Query: 997  KKE----------KTSQFQS-------IMKANKELSELVTRLEKEATDSQMELKKLKSSL 1039
            K +          KT  + S       IM+ N ELS++V  L +E  +     +K +  L
Sbjct: 936  KDKEAELRSVIAVKTGNYDSLSKSYERIMQENSELSKVVELLREEVKNRTSNGEK-EGDL 994

Query: 1040 HKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIGSVTEGSD------ 1093
              T+ ++   +  W EEK  +E ++ +  E+   L  EN  L+ ++ S  +G++      
Sbjct: 995  EDTESIIKKGQDVWDEEKKVFEVQITNLNERLSELLEENESLLARLESQDKGNNSPSAET 1054

Query: 1094 ---GNEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQK 1132
               GNE+ L      + LR ER SL  KLT  +++   V+ K
Sbjct: 1055 NAAGNEETL------AALRSERTSLIEKLTAAQKEERSVRHK 1090

 Score = 57.0 bits (136), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 55/96 (57%), Gaps = 7/96 (7%)

Query: 1457 NLKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSLTFSCDRKETNDDPDEDLWNS 1516
            NLKKRIRLP+EE+I  II KRK ELE  F++K+KE A SL    D     DD  + ++  
Sbjct: 1238 NLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSD-----DDKIKKIYKE 1292

Query: 1517 PSKGNSERPSVITDFMKQKNIKVQEQLKKAKNGVFF 1552
              +  S R ++  +F +Q NI  ++  ++ K  V  
Sbjct: 1293 IEE--SGRETLQQEFDEQLNIVRKKAFEEGKQHVLM 1326

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1608

 Score =  137 bits (345), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 126/411 (30%), Positives = 223/411 (54%), Gaps = 47/411 (11%)

Query: 216 LEEKLYQAQADRESALSYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTL 275
           L++ L + +A R+S    +  LLD  ++++  + +K    K L D    ++ +F +E+  
Sbjct: 162 LDQSLSEIKALRDS----NSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFERELAT 217

Query: 276 QKSMNDLLSSQLASFERDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQR 335
           +  +N +L  Q+ S    HS  E+G    N  + P H    D+        Q SQ E + 
Sbjct: 218 RDKLNAVLKKQVNSL---HS--ELG----NGGETPAHAEPNDQFAK-----QSSQHEEE- 262

Query: 336 LQNIISDFVQEDKATVDTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILEL 395
               IS++ ++ +  +        +G+    I  LRK L+KER +   L+ QME F++EL
Sbjct: 263 ----ISNYKEQVEELLGI------LGQGAPSIAHLRKLLLKERKENVSLKKQMESFVIEL 312

Query: 396 EHKTPELVSFKERTKSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLV 455
           EH+ P L   +++ K ++ +L  +T  +   S AK + +REL+S RQK++      H L 
Sbjct: 313 EHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQKVDHLNQIFHKLR 372

Query: 456 KQRLDLARQVKVLLLNTSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVE 515
            QR DLA Q++ LL   S+   T LP S  +L  ++ I+E+ +     D+Q I+S+RL+ 
Sbjct: 373 VQRSDLAHQIQFLLTVNSS--DTVLPPS--ELSFIKTIIENENWDAYKDSQRIVSDRLLR 428

Query: 516 FNNINELQEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMK 575
           F+NI ELQE+N++L+  +R+L DK+E  E   D+ L      T++ AK  I +LE +N +
Sbjct: 429 FDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGL------TLEAAKLQISKLEQSNAQ 482

Query: 576 MESRINILLRERDSYKLLASSKENNVNVNAK-NFTEISHEKKIKELEAELS 625
           +ES +        +++ L  + ++  ++++K N T +  +KKI+ELE++L+
Sbjct: 483 LESEVK-------NWEALMETLKDGDSLDSKINVTMVEQQKKIEELESKLT 526

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  123 bits (309), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 143/544 (26%), Positives = 278/544 (51%), Gaps = 36/544 (6%)

Query: 814  WAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLK---YEFLNNTSDA 870
            W Q  ID   E LK V ++L  + +T   L S+ + L+  L+E + K   Y+ LN T D 
Sbjct: 843  WYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDV 902

Query: 871  STLQPALRKELEQTQLELKDAHSQVRTYEEIISTNEKALK-----------ELNSQLASM 919
                 ALR ELE+++++L+DA+SQ+  +     + E+AL            E +    +M
Sbjct: 903  LAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNM 962

Query: 920  KEDYD---ARIELECKEKLANXXXXXXXXXXXXXXXXXQPKLKEGTVCLVKQSEKLRNQA 976
            K+  D    ++E   K +++N                 +  L+   V L    E + +  
Sbjct: 963  KKKEDELVGQVEA-LKHQISNLNNELGHQKKQFDSEKNE--LENQLVSLQSTQETMNSMK 1019

Query: 977  EKIQEMKAKIDKMNWNVQVYKKEKTSQ-FQSIMKANKELSELVTRLEKEATDSQMELKKL 1035
            E  ++   K+ + + N Q     K  + ++  ++ + ++S+ +++L +E+   + +   L
Sbjct: 1020 EHYEQQLGKLTQ-DLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVL 1078

Query: 1036 KSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIGSVTEGSDGN 1095
            +SS+ + +  LD  + KW+ +K +YE +L S  ++ E L V+N +L++++    E  D N
Sbjct: 1079 QSSIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLD--LEAKDPN 1136

Query: 1096 ------EDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQKNASLEKNINDLQIDQPA 1149
                  E   K+    ++LR ER+ L+TKL   KR   +  +K  ++E+ ++  + +  +
Sbjct: 1137 SELGQSEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEELSS 1196

Query: 1150 SQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIYEELTIRQEEV 1209
             Q     ++++ DE N + +++ Q+NLL+E+N  L+  ++  T++ +E+  ++   Q+ +
Sbjct: 1197 LQALSSQNSIMADEHNKLLEQLNQLNLLRESNITLRSEVQKKTQRCQELEGQIDNLQQSL 1256

Query: 1210 SQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIEKLNSEISDF 1269
              L+S+L   K  V    ++I +   E ++ KQR  D+ ++   +  +  +KL  E+S  
Sbjct: 1257 QPLESELASLKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQA 1316

Query: 1270 KAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRDKL------E 1323
            KA+L    +  +ELE++F RLKKQA E+LDA+K  Q  L+ EL + +  +  +      E
Sbjct: 1317 KAELAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKE 1376

Query: 1324 QDLN 1327
            QD+N
Sbjct: 1377 QDVN 1380

 Score = 50.1 bits (118), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%)

Query: 1458 LKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSLT 1497
            L+KRIRLP+EE+I KI+  RK ELE+EF+ KL++ AS L 
Sbjct: 1552 LRKRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASELA 1591

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1651

 Score =  115 bits (289), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 136/538 (25%), Positives = 267/538 (49%), Gaps = 60/538 (11%)

Query: 149 LRRKLMEMENILQICKSNSVSLQLKYD-TIVQEKELMLQNKKWTEE-----KLSSYNNKT 202
           LR +L  ++N L++ K   ++LQ + D T+     L L+N     E     +L+S     
Sbjct: 95  LRAELENLQNDLELLKDKDLALQSERDSTVALLDGLKLENSALRAEIEQAKELASIRQHD 154

Query: 203 L-ADESTKASRIRNLEEKLYQAQADRESALSYSQLLLDQNKQLSHSVEEKILEIKNLKDT 261
             AD  +K   + + EE+L  A+++R S       L+ Q ++LS  + ++  +I+ L D 
Sbjct: 155 YEADLDSKTGALVSKEEELRLAKSERAS-------LISQTERLSQELLQRDADIRQLVDA 207

Query: 262 ACIEKTEFSKEMTLQKSMNDLLSSQLASFERDHSSGEIGKDDDNLCKDPDHNNVTDELMN 321
             + + E++ E+ LQK    LL  Q+AS E++  +  +G + +   + P           
Sbjct: 208 DKLRQDEYTDEINLQKHRARLLQEQVASLEKE--AKLVGHETEPEYEIPPPGE------- 258

Query: 322 TKVQFQKSQDECQRLQNIISDFVQEDKATVDTNGASHTVGKLFSDIKVLRKQLIKERSQK 381
            +V  Q      QR     S  +  D      +  SH++ +L ++I +L  +L +E   K
Sbjct: 259 -EVALQ------QR-----SHSISMDSLLTGNDETSHSMSELNNNISILSNRLKRETLSK 306

Query: 382 FQLQNQMEDFILELEHKTPELVSFKERTKSLEHELKRSTELLETISMAKRKDERELTSLR 441
            +L+ Q+  F+ ELE   P + SFK++++  + ++ +    LE ++  K    +E+   +
Sbjct: 307 QKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQEVEQYK 366

Query: 442 QKINSCEANIHLLVKQRLDLARQVKVLLLNTSAIQKTTLPLSKDDLISLRKILESG---S 498
           +++        +L ++R DLARQ++ LLLN   ++ +  PL+  +   +++IL +     
Sbjct: 367 KQLEQISGQDKILRRERFDLARQLQYLLLN-GFVKDSDDPLTSSEFSYIKEILNTDPEEG 425

Query: 499 DVNENDAQAIISERLVEFNNINELQEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQT 558
           + +  D+Q IIS+R+++F +I ELQ++N+ LL  +RTL+D+ E  E K ++  +    + 
Sbjct: 426 NTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKLESGDS---IEA 482

Query: 559 IKEAKDAIIELENTNMKMESRINILLRERDSYKLLASSKENNVNVNAKNFTEISHEKKIK 618
           I EAK  +++L+  N  +E+++  L     + KL A+    ++       +++S    I+
Sbjct: 483 INEAKQTLLDLQQYNSSLEAKVESL-----TNKLKANEHFTSIGDGEFGNSDLSDGNNIQ 537

Query: 619 ELEAELSSTKVESSAVIQNLRKELTTYKKLLCDKKIASQDFENFKMLAKEKESILETR 676
            L+ +  S   ESS  I +L  ++   ++   D             LAKE ES++ ++
Sbjct: 538 ALKNKYDSLMAESSETIGHLYSQINNLQQSKSD-------------LAKECESLINSK 582

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
           (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  102 bits (255), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 94/335 (28%), Positives = 174/335 (51%), Gaps = 23/335 (6%)

Query: 340 ISDFVQEDKATVDTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKT 399
           I+D ++  KAT+  + A           K L KQ          L++ +++++ ELE + 
Sbjct: 188 INDDIENSKATIPPSPA-----------KALSKQ-------NNGLKSDIQNYLNELEQQL 229

Query: 400 PELVSFKERTKSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRL 459
           P + +FK   ++L+  L +   ++E++   K+++ + + S+++ IN   ++I  L  QR 
Sbjct: 230 PLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMKKTINEKSSSIEALDIQRT 289

Query: 460 DLARQVKVLLLNTSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNI 519
           DLA Q++ LL+++S       PLSK +++ ++ ++        +D Q++IS+RL++F +I
Sbjct: 290 DLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLSSDVQSVISDRLIKFKDI 349

Query: 520 NELQEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESR 579
             LQEKN+EL   IR LA  LE  E +   +    +  TI EAK+ I+ L+  N  ++  
Sbjct: 350 VSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEAKETILSLQEYNNVLKLE 409

Query: 580 INILLRERDSYKLLASSKENNVNVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLR 639
           I  L   +     L SS  N+     ++F    H   +K+LE++LS     S + I+NL 
Sbjct: 410 IGTL---QSKISELQSSIPNSKESEKQHFN--YHSNLVKDLESKLSKLSAYSQSTIENLN 464

Query: 640 KELTTYKKLLCDKKIASQDFENFKMLAKEKESILE 674
           K++        D  I  +  ++  +LA EK ++L+
Sbjct: 465 KDIQNLYNERTDILINLEKEKSSTILANEKLTLLQ 499

 Score = 56.2 bits (134), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 96/168 (57%), Gaps = 22/168 (13%)

Query: 1458 LKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSLTFSCDRKETNDDPDEDLWNSP 1517
            LK++IRLPSEE+I  II  +  +LEE++++KL+  ++    S D ++   + +++L N+ 
Sbjct: 1114 LKRKIRLPSEEKINTIIESKVADLEEDYKKKLETVSAE---STDIEKIKQEFEDNLVNAK 1170

Query: 1518 SKG---NSERPSVITDFMKQKNIKVQEQLKKAKNGVFFGDSRSSSMNKENSALVKVNDDK 1574
             K      ++ S+ T F++ K  K++ QL+  ++ V   ++   + + E S   +++  +
Sbjct: 1171 KKAFEEGKQQASMKTKFLENKIAKLESQLQNNESDVTDKEAEVKTTDNEKSN-PELDKQE 1229

Query: 1575 AASTFSFGKPLFPSTTTSFQSFQNPFTQSTIDSNTGVSL----PTFNI 1618
            A  +F+F  P  P++        NPFT +T D+++ VS+    PTF++
Sbjct: 1230 AKPSFTFSPP--PNS--------NPFT-TTQDTDSPVSVFGIKPTFSL 1266

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 84.3 bits (207), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/229 (28%), Positives = 129/229 (56%), Gaps = 11/229 (4%)

Query: 364 FSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKSLEHELKRSTELL 423
            ++I  ++ +LIKE+ +K  L+ +  DF+ ++E K P L     +  S+E+E     ++ 
Sbjct: 280 INNIDDIKTELIKEKYEKSLLEKKFNDFLFDIESKLPYL-----QNNSVENETNNGNKIE 334

Query: 424 ETISMAKRKDEREL--TSLRQKINSCEANIHLLVKQRLDLARQVKVLLLNTSAI-QKTTL 480
           E   +    D  +L   SL+ K+N  E+ +  L++QR DL  Q+  LL+  S + +    
Sbjct: 335 EQ-KIIHEHDSLKLENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNK 393

Query: 481 PLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINELQEKNVELLYCIRTLADKL 540
            L++++L  +R ++   ++    + Q IISERL++F+N+++L  KN++L+  +R L +K+
Sbjct: 394 ILTENELNFIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKM 453

Query: 541 EFHEGKKDTTLAEVEK--QTIKEAKDAIIELENTNMKMESRINILLRER 587
           E  E +      ++E   ++I EAK  +I L+  N+K +  IN ++ E+
Sbjct: 454 ESIEKQNSQKFGDLEMDFKSIDEAKQRMIVLKEENVKNKDIINQIISEK 502

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score = 70.5 bits (171), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 73/334 (21%), Positives = 171/334 (51%), Gaps = 7/334 (2%)

Query: 996  YKKEKTSQFQSIMKANKELSELVTRLEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWME 1055
            Y  +  + ++  ++ +  +S+ +++L ++    + E+ +L  S    + LL+ ++  W +
Sbjct: 1046 YANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAELTISATDAKRLLNENQISWQK 1105

Query: 1056 EKADYERELISNIEQTESLRVENSVLIEKIGSVTEGSDGNEDYLKLVS-------FFSNL 1108
            ++ +YE+++    ++ E    +N +L E+    T+ +D +      V+          +L
Sbjct: 1106 QRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQANDEDNAESSGVNSIEGDNKLVLSL 1165

Query: 1109 RHERNSLETKLTTCKRDLALVKQKNASLEKNINDLQIDQPASQTELQCSAVIIDEFNDIT 1168
            R ER+ L+ +L   + +  L++++  S+EK+     ++    + E      ++++   + 
Sbjct: 1166 RSERDLLQERLNVTEAEEKLLRERLTSIEKDFRATDLELQKIKEETHNYPDLLEQHKTVM 1225

Query: 1169 KEIAQVNLLKENNAILQKSLKNVTEKNREIYEELTIRQEEVSQLKSDLIKTKEQVSVNAN 1228
             ++ Q++LL+E+N  L+     +  KN+ +  E+    +++  L+++L      +     
Sbjct: 1226 SQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKLLPLETELQTLTNLIEEKDK 1285

Query: 1229 KILIYESEMDQCKQRYHDLSTQQREVQKKTIEKLNSEISDFKAKLLDAENTKTELENKFN 1288
            ++ I   E ++ KQR  D+ ++ + +     E L  E +  +A+L +      EL N+F 
Sbjct: 1286 QLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQLEEKSKENEELGNRFE 1345

Query: 1289 RLKKQAHEKLDASKKQQTALTNELKELKAVRDKL 1322
            +LKKQAHEKL+ASK  Q +LT ++ +L+A + +L
Sbjct: 1346 KLKKQAHEKLNASKISQNSLTIQINDLEAKKKEL 1379

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score = 66.6 bits (161), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 135/252 (53%), Gaps = 5/252 (1%)

Query: 364 FSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKSLEHELKRSTELL 423
           F D  +L+K++ K   Q+  LQ ++E  I ELE+  PEL +  ++   LE  L +     
Sbjct: 295 FCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKINELELLLSKEKNTS 354

Query: 424 ETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQVKVLLLNTSAIQKTTLPLS 483
           E      ++ E E  ++  ++   +  I  L ++  DL  Q++ +L++ S        L+
Sbjct: 355 EHFKTTIKEIENEKKNIISRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGELT 414

Query: 484 KDDLISLRKILESGSDVNEN---DAQAIISERLVEFNNINELQEKNVELLYCIRTLADKL 540
           ++++  ++ + E G++ + N   ++Q IIS+RL+ F ++  LQ+KN+EL+  +R +  KL
Sbjct: 415 ENEIKFIKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMELIKTLRLITKKL 474

Query: 541 EFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINILLRERDSYKLLASSKENN 600
           +  E +            + EAK+ I+++ + + K++ +I+ L ++ ++ + ++  K  +
Sbjct: 475 DNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQLNANRPVSHEKNGH 534

Query: 601 VNVNAKN--FTE 610
            +V A+N  +TE
Sbjct: 535 ESVLAENKLYTE 546

 Score = 37.7 bits (86), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 66/133 (49%), Gaps = 13/133 (9%)

Query: 1195 NREIYEELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREV 1254
            NR++ E+L   ++ + Q+  ++ K  + +       L   SE+   + R  +L  + +E 
Sbjct: 908  NRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITLLRNRCKELENKLKEA 967

Query: 1255 QKKTIEKLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNEL-- 1312
              +         SDFK K         E  ++FNRLKKQA+ +L +SK++Q AL  ++  
Sbjct: 968  SLQ---------SDFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISS 1018

Query: 1313 --KELKAVRDKLE 1323
              K+L  V+ KLE
Sbjct: 1019 LKKDLAEVQSKLE 1031

 Score = 32.7 bits (73), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 99/215 (46%), Gaps = 44/215 (20%)

Query: 1192 TEKNREIYEELTIRQEEVSQLKSDLIKTK---------EQVSVNANKILIYES------E 1236
            TE +R I +EL     E ++  S++I            + + + A+++  Y+S      +
Sbjct: 545  TEGDRLILDELKNNIPEFTKQASNIISMNFDQLTSLYNKNLELTADRLKAYQSRDITQKK 604

Query: 1237 MDQCKQRYHDLST------QQREVQKKTI----EKLNSEIS---DFKAKLLDAENTKTEL 1283
            +D  + +Y  LS       +  EV K TI    E LNS I+   D KA LL   N    L
Sbjct: 605  LDLLQDKYDYLSISNEKLKEHMEVIKDTIRRKDETLNSTIANHVDCKASLLSVTNDMNSL 664

Query: 1284 ENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRDKLEQDLNSKNFKTVDL--DTEPK 1341
              K++ LK          K QQ+ +TN   ELK  R++L+ +L   N KTV +  D E  
Sbjct: 665  MTKYDELK--------YLKDQQSRITN---ELKMEREQLKMEL--LNIKTVQIQSDLESA 711

Query: 1342 EHTVQSGDLLRDQEKVASLPLIEEIESLKRELQVF 1376
            E+       + D E + +  L +++ + ++ELQ F
Sbjct: 712  EYKASVASKINDLE-ITNSNLSKDLRTKEQELQDF 745

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score = 47.0 bits (110), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/34 (64%), Positives = 28/34 (82%)

Query: 1458 LKKRIRLPSEERIQKIISKRKEELEEEFQRKLKE 1491
            LKKRIRLPSE +I ++I KRK ELE E++ KL+E
Sbjct: 1516 LKKRIRLPSETKINRVIEKRKHELENEYEVKLQE 1549

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
           (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 46.2 bits (108), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 67/289 (23%), Positives = 129/289 (44%), Gaps = 28/289 (9%)

Query: 183 LMLQNKKWTEEKLSSYNNKTLAD------ESTKASRIRNLEEKLYQAQADRESALSYSQL 236
           L+  N KW  E+L       L D       S   +++ N   KL + Q          + 
Sbjct: 33  LLENNYKWLNERLVRDQKNYLIDTHDVKYSSKNDNKLYNSHNKLLELQK---------EF 83

Query: 237 LLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFERDHSS 296
           L+  N++LS  + E  +E  +  ++  I+     K + L +   +LL+ + +   +D   
Sbjct: 84  LISHNEKLSDRLNENSIEFNDKFNSVVIDNLNNEKNLILFEKKLNLLNERYSIIIKDQ-- 141

Query: 297 GEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKATVDTNGA 356
            ++  +D N  K  +  ++ ++++      +  + + ++L  II +F+  D    D N  
Sbjct: 142 KDVIDNDINNSKYLEFKSLNEKIIKQNSNMKSMESKIEKLNAIIHNFI--DINEFD-NEN 198

Query: 357 SHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKSL---- 412
           ++      +D KVL+K L+ E++   +LQ ++   +LEL  K P L S KE+   L    
Sbjct: 199 TNKYSLDLNDNKVLKKLLVHEKNSNLKLQEELNSILLELNFKLPSLTSLKEKNHELQSVF 258

Query: 413 EHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDL 461
           E+ +  + ELL+       K    + S+  KI   E ++  L+ QR +L
Sbjct: 259 ENIISSNEELLQQFHSNTDK----IASMNNKIVDYEQSLKQLLSQRTNL 303

 Score = 37.7 bits (86), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 47/84 (55%), Gaps = 13/84 (15%)

Query: 1282 ELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVR-------DKLEQDLNSKNFKTV 1334
            E  +KF+RLK+QA+E+L+ASK  Q  L++ +K L+  R        KLE D+N+ N   V
Sbjct: 666  EANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINNLNNALV 725

Query: 1335 DLDTEPKEHTV------QSGDLLR 1352
            + + +  E  +      Q+G  LR
Sbjct: 726  EAEKKLSEENLKYETERQTGSTLR 749

>KLLA0F13420g Chr6 (1240135..1244145) [4011 bp, 1336 aa] {ON}
            uniprot|O59904 Kluyveromyces lactis SIR4 Silent
            information regulator 4
          Length = 1336

 Score = 40.4 bits (93), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 71/148 (47%), Gaps = 34/148 (22%)

Query: 509  ISERLVEFNNINELQEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIE 568
            ++ERL E   I  ++++ VE    I+ L D LE      ++ LA +EKQ +   K A   
Sbjct: 969  VTERLFE---IKRIKDREVENHPIIKQLRDTLEGERAHFESQLA-LEKQKVSNLKAA--- 1021

Query: 569  LENTNMKMESRINILLRERDSYKLLASSKENNVNVNAKNFTEISHEKKIKELEAELSSTK 628
                                   LL+   +N++N   K    +   KK++EL+AELSST+
Sbjct: 1022 -----------------------LLSRHGKNDINEEVKPAAPLDG-KKLEELQAELSSTR 1057

Query: 629  VESSA---VIQNLRKELTTYKKLLCDKK 653
            + + A     ++L+ E +TY+ LL +KK
Sbjct: 1058 LYARAQHNAAKHLQTECSTYRNLLSEKK 1085

>NCAS0F03050 Chr6 (607255..611625) [4371 bp, 1456 aa] {ON} Anc_5.383
          Length = 1456

 Score = 36.2 bits (82), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 4/70 (5%)

Query: 246  HSVEEKILEIKNLK---DTACIEKTEFSKEMTLQKSMNDLLSSQLASFERDHSSGEIGKD 302
            H++E  IL+  N K   D   I+K +F+ +   + S+ DLL S+     ++ + G +  D
Sbjct: 1316 HTIESNILKKANQKRQLDNVVIQKGDFTTDYFTKLSVRDLLGSEDNDGAKE-TEGPLLLD 1374

Query: 303  DDNLCKDPDH 312
            D N+ KDP H
Sbjct: 1375 DPNITKDPRH 1384

>Ecym_5020 Chr5 complement(43098..45470) [2373 bp, 790 aa] {ON}
           similar to Ashbya gossypii ADR400W
          Length = 790

 Score = 35.8 bits (81), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 76/304 (25%), Positives = 139/304 (45%), Gaps = 42/304 (13%)

Query: 247 SVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFERDHSSGEIGKDDDNL 306
           S++EK++   NL +   +  ++ SK+M+L K++    S +  S  R  +S   G      
Sbjct: 395 SIQEKMVNNDNLGN---VIGSKLSKQMSLLKTLAQ--SVERISTPRVPASAPAG------ 443

Query: 307 CKDPDHNNVTDELMNTKVQFQKS-QDECQRLQNIISDFVQE--DK----ATVDTNGASHT 359
             D   +N+ D          KS QD  + L++II  +  E  DK      + +     +
Sbjct: 444 --DAYISNLDDLAYKASRDLSKSYQDHIEALKSIIDRYKSELNDKDEKLEELKSCMKQES 501

Query: 360 VGKLFSDIKV-LRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKSLEHELKR 418
            G L  D++  LR QL+K + Q  QL++Q+ +   EL+    E +S K++   + + LK 
Sbjct: 502 SGSLNEDLEFQLRGQLVKTKEQCSQLEHQISELKAELKIADEEKLSQKQQISQVTNRLKY 561

Query: 419 STE--------LLETISMAKRK-----DERELTSLRQKINSCEANIHLLVKQRLDLARQV 465
             +        L +++ MA RK     DE  +  L+QKI   E     L+K    LA+Q 
Sbjct: 562 DLDSKECELQSLQKSLKMAVRKSAVYLDENHM--LQQKICELEEQHGTLIKDNYRLAQQA 619

Query: 466 KVLLLNTSAI---QKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINEL 522
             +  +  +I   +     L    ++ LRK+ +   ++ + D+   +++ + + +NIN L
Sbjct: 620 SAITKDFDSIGEFEGAYSSLKTHLVVHLRKMFKIFENILQQDS---VNQAVKKLDNINRL 676

Query: 523 QEKN 526
           Q  N
Sbjct: 677 QSLN 680

>Kpol_1031.15 s1031 (38596..41385) [2790 bp, 929 aa] {ON}
            (38596..41385) [2790 nt, 930 aa]
          Length = 929

 Score = 35.8 bits (81), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 11/88 (12%)

Query: 1254 VQKKTIEKLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELK 1313
            +Q K  EK NS+IS  +  L+D++NT TEL+ +   L+K+  +KL     Q   L + +K
Sbjct: 313  LQNKLKEK-NSQISVLENNLIDSKNTATELKTRLENLQKEYDDKLREKINQIHKLDDNIK 371

Query: 1314 ELKAVRDKLEQDLNSKNFKTVDLDTEPK 1341
            +LK+ RD           K V LDT  K
Sbjct: 372  QLKSERDS----------KYVSLDTNDK 389

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 35.0 bits (79), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 50/91 (54%), Gaps = 1/91 (1%)

Query: 1208 EVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIEKLNSEIS 1267
            ++ Q  ++L   KE +S + NKIL  E+ +D+ ++   ++  + RE++ + IE+ +SE  
Sbjct: 993  DIDQCTNELESIKELISSSDNKILELEASIDKLQKEGEEIEEKVREIE-RLIEEKSSEGQ 1051

Query: 1268 DFKAKLLDAENTKTELENKFNRLKKQAHEKL 1298
            DF    +D  N   +L +  N + K  H+ L
Sbjct: 1052 DFAVFEVDINNQLEKLNDLLNHIGKDGHDLL 1082

>Ecym_7101 Chr7 (194579..196732) [2154 bp, 717 aa] {ON} similar to
           Ashbya gossypii AGR229W
          Length = 717

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 80/310 (25%), Positives = 138/310 (44%), Gaps = 63/310 (20%)

Query: 129 QSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQLKYDTIVQEKELMLQNK 188
           Q+++ +V   ++ L++    L+ +  E++N L +   NS  LQ KY T V + E +    
Sbjct: 260 QAQYTDVCGQKDKLEQRVDKLKARSSELKNELTMAMQNSQILQEKYHTQVTKNEEL---- 315

Query: 189 KWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESALSYSQLLLDQNKQLSHSV 248
              E ++S            K   +++LE KL  +QA              Q KQLSH +
Sbjct: 316 ---EHQISD-----------KEDSVKSLETKLEHSQA--------------QIKQLSHQL 347

Query: 249 EE---KILEI-KNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFERDHSSGEIGKDDD 304
           E+   K+ E+ +NL D     K  +  + +  + +   LS + A  E    + E  KD  
Sbjct: 348 EQARDKVAEVEQNLMDG----KRAYDHQKSNAQQLESQLSEKTAKIEELTHTIEQSKDAQ 403

Query: 305 NLCKDPDHNNVTD---ELMNTKVQFQK----SQDECQRLQNIISDFVQEDKATVDTNGAS 357
           N       + +TD   E +  + ++QK       E + L+N I D  +E+K+        
Sbjct: 404 NRSSSELESKITDLTEENLILEKEYQKLLKDYDSETKALRNQIKDIYEENKS-------- 455

Query: 358 HTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKSLEH--- 414
                L S  +V  K+L+  ++Q+ + + Q+++ I ELE    ELVS K     L     
Sbjct: 456 -----LESKYEVDCKELVSLKTQRTEFEKQIKNLISELEEANNELVSKKAEVNELNSTIT 510

Query: 415 ELKRSTELLE 424
           ELK+S + L+
Sbjct: 511 ELKQSEKYLQ 520

>TBLA0B02580 Chr2 (588481..591882) [3402 bp, 1133 aa] {ON} Anc_3.330
            YPR049C
          Length = 1133

 Score = 35.0 bits (79), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 89/177 (50%), Gaps = 27/177 (15%)

Query: 975  QAEKIQEMKAKIDKMNWNVQVYKKEKTSQFQSIMKANKELSELVTRLEKEATDSQMELKK 1034
            +  KIQ ++++I   N  +  Y++  TS        NKELS L+T  EKE   +   LK+
Sbjct: 680  KTSKIQSLESQISDNNVEIHAYRETLTS-------LNKELSRLIT--EKEDNTA---LKR 727

Query: 1035 LKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIGSV-TEGSD 1093
            +K +  +       H +K + +    E +LIS+ + +E L +EN  L+  + ++  E + 
Sbjct: 728  VKDAEFRD------HIQKIINQNVILENKLISSSKYSERLEIENKKLLSFVLNIKVELTH 781

Query: 1094 GNEDYLKLVSFFSNLRHERNSLETKLTTCKRDL--ALVKQ-KNASLEKNINDLQIDQ 1147
              ED+    ++F   + + N +  K T  K  L  +L++Q  NAS  KN + + I+Q
Sbjct: 782  MREDFF---NYFDKAKSQLNLITLKYTNFKNKLPKSLLQQLPNAS--KNASVIGINQ 833

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score = 34.7 bits (78), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/18 (77%), Positives = 17/18 (94%)

Query: 1457 NLKKRIRLPSEERIQKII 1474
            NLKKRIRLPSEE+I ++I
Sbjct: 1494 NLKKRIRLPSEEKINRVI 1511

>KNAG0M01260 Chr13 complement(231670..233970) [2301 bp, 766 aa] {ON}
           Anc_5.123 YLR045C
          Length = 766

 Score = 33.9 bits (76), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%)

Query: 79  ELSHLQDQLMQDRERCRRKIDALNKQLDSSRDAIKRLNDEK 119
           EL    D L+QD E  +RK+DAL  +LD  R      NDE+
Sbjct: 626 ELRRANDVLIQDNESLKRKLDALQSELDQWRQKAMNANDER 666

>AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL058W
            (USO1)
          Length = 1292

 Score = 33.9 bits (76), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 101/374 (27%), Positives = 168/374 (44%), Gaps = 75/374 (20%)

Query: 1003 QFQSIMKANKELSELVTRLEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYER 1062
            Q++ +MKA +E    V+ L+++    + +L +  S   K +DL  T +      KAD  +
Sbjct: 734  QYKQLMKAKQESDTQVSDLDEKLAQLKTQLDEANS---KVEDL-STKKTTLEAAKADCLK 789

Query: 1063 ELISNIEQTESLRVENSVLIEKIGSVTEGSDGNEDYL-KLVSFFSNLRHERNSL------ 1115
            +L S+  Q  SL+   + L +++ +V+E     E  + K+     NL  E++SL      
Sbjct: 790  KLASHEGQVNSLKNRTTQLEKQLATVSEQKSTAEAGINKMNRELFNLTKEKDSLTAVMNK 849

Query: 1116 -----ETKLTTCK----RDLALVKQKNASLEKNINDLQIDQPASQTELQCSAVIIDEFND 1166
                 E KL   +    R   L+ Q++  +E   N+LQ DQ   + +L+      DE   
Sbjct: 850  LQKEGEKKLQEAEKEKVRITQLLSQRDRDIENLRNELQ-DQGTQKKKLE------DEHAG 902

Query: 1167 ITKEIAQ-----------VNLLKENNAILQKSLKNVTEKNREIYEEL----TIRQEEVSQ 1211
            + KEIA            +  LKE    L +SLK+   ++  + +++         E++Q
Sbjct: 903  LLKEIADLKSQCASQDSLIPKLKEKLKTLAESLKDTQNEHATLQKQVGNIQATSHAEITQ 962

Query: 1212 LKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKT--IEKLNSEISDF 1269
            L ++L K K++     N ILI  S  D+  Q    L  Q    +K+T  I  LN++ S+ 
Sbjct: 963  LNAELQKLKDE-----NVILI--SRKDELTQELEKLQAQTAAGEKQTSDIALLNTQKSEL 1015

Query: 1270 KAKLLDAE--------------NTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKEL 1315
             AKL  AE                + EL++K N  +KQ  E   +S+K    L+N   EL
Sbjct: 1016 SAKLSRAEKELVNQKAKAEGLFQERAELKDKLNTSEKQLQE---SSQK----LSNAQSEL 1068

Query: 1316 KAVRDKL---EQDL 1326
              +R +L   E DL
Sbjct: 1069 NEIRSRLKANEHDL 1082

>KAFR0B05770 Chr2 (1190270..1197952) [7683 bp, 2560 aa] {ON} Anc_8.331
            YDR150W
          Length = 2560

 Score = 33.1 bits (74), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 2/77 (2%)

Query: 1235 SEMDQCKQRYHDLSTQQREVQKKTIEKLNSEISDFKAKLLDAENTKTELENKFNRLKKQA 1294
            S+++Q    Y+D +T   +V + T E L+ +IS+F   +L  E   + +E   N     +
Sbjct: 392  SQINQTLVPYNDYTTLLEKVSQPTFEYLSEKISNFDKTILSNEEYHSLVERAEN--PSIS 449

Query: 1295 HEKLDASKKQQTALTNE 1311
            H K+ ASK  QT +++E
Sbjct: 450  HLKVKASKLGQTIVSSE 466

>YOR195W Chr15 (712866..715331) [2466 bp, 821 aa] {ON}
            SLK19Kinetochore-associated protein required for normal
            segregation of chromosomes in meiosis and mitosis;
            component of the FEAR regulatory network, which promotes
            Cdc14p release from the nucleolus during anaphase;
            potential Cdc28p substrate
          Length = 821

 Score = 32.7 bits (73), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 61/109 (55%), Gaps = 10/109 (9%)

Query: 1200 EELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTI 1259
            E L +++ E+  L S++ + K+Q++   ++  +++S       +Y  +  + + ++   +
Sbjct: 548  ETLKLKEAEIDSLNSEMDELKKQITSKDDEFKMWQS-------KYETVEDEAK-IRNAEV 599

Query: 1260 EKLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTAL 1308
             +LN +I D K   L  E T TELENK ++L+ +   +L+  K ++T+L
Sbjct: 600  TELNGDIEDLKESKLHLEETITELENKVHKLENEC--ELEKQKFEKTSL 646

>TPHA0A01150 Chr1 complement(224257..226713) [2457 bp, 818 aa] {ON}
            Anc_8.604 YOR195W
          Length = 818

 Score = 32.7 bits (73), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 63/115 (54%), Gaps = 11/115 (9%)

Query: 1233 YESEMDQCKQRYHDLSTQQREVQKKTIEKLNSEISDFKAKLLDAENTKTELENKFNRLK- 1291
            YE++++   +   ++ T+ RE Q + I+KL  +IS++K ++      +  L+NK+N+   
Sbjct: 348  YETKINITAEEMENIQTE-RENQNRKIDKLKKKISEYKDEISMLNQNQKILQNKYNQTSD 406

Query: 1292 -----KQAHE----KLDASKKQQTALTNELKELKAVRDKLEQDLNSKNFKTVDLD 1337
                 K +HE    KL A +K   A+ N L +L + ++KL  +L+S   +  DL+
Sbjct: 407  ESEKWKLSHEEVNDKLQALEKDHQAVLNNLNQLISDKEKLGSELSSYENQVKDLN 461

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.124    0.321 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 168,678,003
Number of extensions: 7886711
Number of successful extensions: 66495
Number of sequences better than 10.0: 2585
Number of HSP's gapped: 61742
Number of HSP's successfully gapped: 6055
Length of query: 1682
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1558
Effective length of database: 39,262,815
Effective search space: 61171465770
Effective search space used: 61171465770
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 73 (32.7 bits)