Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_9.195.703ON57257229110.0
YIL150C (MCM10)5.703ON57155525820.0
Suva_9.385.703ON56955525260.0
Skud_9.185.703ON57155524160.0
NCAS0G002205.703ON59256716070.0
KAFR0D022105.703ON58456914740.0
TDEL0B021705.703ON56756114650.0
CAGL0H06589g5.703ON58357613950.0
KNAG0L021505.703ON61659713970.0
Kpol_1043.715.703ON58556613900.0
NDAI0F002805.703ON61058813900.0
ZYRO0G06578g5.703ON56956213770.0
TPHA0E002105.703ON54452013151e-176
TBLA0G010205.703ON59457912791e-170
KLTH0E01034g5.703ON58355912021e-158
SAKL0E14938g5.703ON57456111801e-155
Kwal_55.196915.703ON46645110441e-136
AFR287W5.703ON6115879561e-121
KLLA0A00572g5.703ON5775618931e-112
Kpol_1026.214.61ON43777900.026
Skud_4.1562.356ON353163890.031
CAGL0H05357g8.542ON770127890.041
ZYRO0D01276g7.527ON668127870.069
TBLA0A088904.77ON698127870.070
NDAI0B061903.547ON947125870.074
Kpol_1052.262.548ON314136850.088
NDAI0A084507.101ON1119147860.10
TBLA0A008002.636ON478182830.19
Kwal_27.103538.823ON224107810.20
KLTH0H10758g1.316ON395133820.23
KAFR0A074102.91ON35382810.29
Smik_15.3858.609ON470187810.33
Suva_8.2548.609ON470187800.43
ZYRO0A11132gsingletonON69863800.48
Skud_15.3658.609ON470185790.57
YOR198C (BFR1)8.609ON470190790.57
Skud_14.2082.146ON484136790.57
NDAI0K028606.51ON814152790.65
TBLA0B032008.831ON1086152790.67
Ecym_26257.101ON1097159790.68
YNL005C (MRP7)1.410ON371200780.68
Skud_4.3308.200ON402172780.71
Suva_16.1648.659ON452114780.74
Suva_13.2052.596ON557101780.79
TPHA0B004504.339ON565133780.79
YNL167C (SKO1)2.86ON647169780.81
Suva_14.2492.199ON1244108780.90
Suva_8.2698.636ON48599770.99
Kpol_1048.162.146ON505111771.0
KAFR0G001406.190ON59246771.1
Kpol_1002.286.252ON66293771.1
KAFR0H013403.291ON213129751.1
CAGL0E03245g4.61ON42582761.3
Ecym_64102.86ON48789761.3
SAKL0A04356g6.218ON51193761.3
Skud_10.461.170ON73490761.4
KLLA0C10879g5.296ON755168761.5
Suva_11.1192.476ON1120111761.5
Skud_9.195.702ON1680101761.6
SAKL0A00352g6.378ON490113751.7
TBLA0E002203.567ON570150751.8
TPHA0A045103.212ON627157751.8
TPHA0A010408.617ON690161751.9
YBR237W (PRP5)6.148ON849178751.9
NCAS0A041102.409ON1247118752.0
SAKL0E04532g2.409ON1273119752.0
TBLA0B018102.199ON1504187752.1
CAGL0F02255g8.95ON14674712.1
TPHA0B028808.609ON498128742.3
CAGL0K03949g2.396ON505138742.3
KLLA0F08019g7.102ON75892742.5
NCAS0A014005.241ON762100742.5
Kpol_1019.22.618ON89592742.6
Skud_4.2203.159ON1001156742.6
Skud_13.4038.766ON34999732.7
YNL091W (NST1)2.199ON1240108742.7
TBLA0E047304.341aON129487742.7
CAGL0G02497g5.702ON178067742.8
NCAS0A083101.470ON424106732.9
SAKL0G19008g2.636ON447170732.9
Ecym_41648.403ON497157552.9
ZYRO0G00484g4.385ON647171733.2
KLLA0B09944g8.507ON674173733.2
TBLA0E008705.677ON699128733.3
SAKL0C09746g3.100ON721113733.3
KAFR0E040105.414ON905134733.4
KNAG0F002901.52ON1125155733.5
Smik_14.2362.199ON1232108733.5
Skud_14.2402.199ON1243108733.5
NDAI0J030204.373ON1625235733.6
Ecym_11798.524ON1670114733.6
Smik_6.3438.659ON45199723.9
Smik_14.2042.146ON471122723.9
ZYRO0C11748g5.65ON490152724.0
TPHA0C037902.369ON49087724.0
CAGL0L03069g1.259ON53298724.0
CAGL0C00407g8.277ON550137724.1
NCAS0G020002.86ON55155724.1
TBLA0C056701.162ON627206724.2
Kwal_14.22584.77ON699131724.3
TBLA0J015607.191ON714123724.3
Suva_6.2491.170ON73790724.3
Ecym_41448.423ON84069724.4
NCAS0A079905.591ON95750724.5
CAGL0J00693g5.267ON188481724.8
Smik_8.905.267ON1927169724.8
Kpol_274.48.121ON59592715.5
Kwal_23.65166.381ON31452705.9
Kpol_1031.155.414ON929183715.9
ABR035C4.165ON98177715.9
SAKL0E00770g6.7ON1047163716.0
Kpol_1018.1057.409ON1048117716.0
KLTH0F13464g7.160ON1372183716.1
SAKL0E09768g2.201ON1448100716.1
ZYRO0B05786g3.124ON2994133716.4
Ecym_82052.153ON11462666.5
YDR076W (RAD55)8.200ON406104706.5
NCAS0B00660na 1ON427101706.6
TPHA0B046801.59ON443209706.7
NCAS0C051902.636ON444133706.7
KNAG0A066902.504ON9751656.7
ZYRO0E06424g2.572ON11885666.8
Skud_15.4788.787ON512124707.0
SAKL0H09922g8.547ON55574707.1
TPHA0D009108.121ON62683707.3
TPHA0H005008.127ON285164697.4
Kpol_1055.894.236ON75360707.5
TPHA0J014405.677ON796146707.6
TPHA0K019404.56ON873127707.7
NDAI0G041501.414ON31893697.8
TBLA0H003002.409ON127594708.0
YDR464W (SPP41)5.587ON1435234708.1
ZYRO0F16368g1.96ON344261698.1
ZYRO0G21318g1.294ON1454173708.1
TBLA0B096802.79ON1535101708.1
SAKL0G12804g5.206ON183985708.2
Kthe_YGOB_CWC158.345ON23140688.6
Suva_7.4293.506ON408137698.6
TBLA0B050506.204ON513122699.2
Smik_15.4918.787ON516118699.2
Kpol_1018.352.531ON517114699.2
KNAG0I019902.174ON545121699.3
Kpol_413.58.728ON568192699.4
AGL075C2.538ON594150699.5
KLTH0E13596g8.587ON76675699.9
Smik_10.2395.241ON77087699.9
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Smik_9.19
         (1719 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...  1125   0.0  
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...   999   0.0  
Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...   977   0.0  
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...   935   0.0  
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   623   0.0  
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   572   0.0  
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   568   0.0  
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   541   0.0  
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   542   0.0  
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   540   0.0  
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   540   0.0  
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   535   0.0  
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   511   e-176
TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...   497   e-170
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   467   e-158
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   459   e-155
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   406   e-136
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   372   e-121
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   348   e-112
Kpol_1026.21 s1026 complement(46606..47919) [1314 bp, 437 aa] {O...    39   0.026
Skud_4.156 Chr4 (278886..279947) [1062 bp, 353 aa] {ON} YDL099W ...    39   0.031
CAGL0H05357g Chr8 complement(514513..516825) [2313 bp, 770 aa] {...    39   0.041
ZYRO0D01276g Chr4 complement(96840..98846) [2007 bp, 668 aa] {ON...    38   0.069
TBLA0A08890 Chr1 (2183143..2185239) [2097 bp, 698 aa] {ON} Anc_4...    38   0.070
NDAI0B06190 Chr2 (1503529..1506372) [2844 bp, 947 aa] {ON} Anc_3...    38   0.074
Kpol_1052.26 s1052 complement(86331..87275) [945 bp, 314 aa] {ON...    37   0.088
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    38   0.10 
TBLA0A00800 Chr1 complement(174131..175567) [1437 bp, 478 aa] {O...    37   0.19 
Kwal_27.10353 s27 complement(298957..299631) [675 bp, 224 aa] {O...    36   0.20 
KLTH0H10758g Chr8 complement(927171..928358) [1188 bp, 395 aa] {...    36   0.23 
KAFR0A07410 Chr1 (1496247..1497308) [1062 bp, 353 aa] {ON} Anc_2...    36   0.29 
Smik_15.385 Chr15 complement(668338..669750) [1413 bp, 470 aa] {...    36   0.33 
Suva_8.254 Chr8 complement(457591..459003) [1413 bp, 470 aa] {ON...    35   0.43 
ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {...    35   0.48 
Skud_15.365 Chr15 complement(657763..659175) [1413 bp, 470 aa] {...    35   0.57 
YOR198C Chr15 complement(718653..720065) [1413 bp, 470 aa] {ON} ...    35   0.57 
Skud_14.208 Chr14 (383074..384528) [1455 bp, 484 aa] {ON} YNL124...    35   0.57 
NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6....    35   0.65 
TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {...    35   0.67 
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    35   0.68 
YNL005C Chr14 complement(621313..622428) [1116 bp, 371 aa] {ON} ...    35   0.68 
Skud_4.330 Chr4 (573869..575077) [1209 bp, 402 aa] {ON} YDR076W ...    35   0.71 
Suva_16.164 Chr16 complement(285371..286729) [1359 bp, 452 aa] {...    35   0.74 
Suva_13.205 Chr13 complement(332274..333947) [1674 bp, 557 aa] {...    35   0.79 
TPHA0B00450 Chr2 complement(98591..100288) [1698 bp, 565 aa] {ON...    35   0.79 
YNL167C Chr14 complement(319416..321359) [1944 bp, 647 aa] {ON} ...    35   0.81 
Suva_14.249 Chr14 (451061..454795) [3735 bp, 1244 aa] {ON} YNL09...    35   0.90 
Suva_8.269 Chr8 complement(486474..487931) [1458 bp, 485 aa] {ON...    34   0.99 
Kpol_1048.16 s1048 (53728..55245) [1518 bp, 505 aa] {ON} (53728....    34   1.0  
KAFR0G00140 Chr7 (40399..42177) [1779 bp, 592 aa] {ON} Anc_6.190...    34   1.1  
Kpol_1002.28 s1002 complement(85813..87801) [1989 bp, 662 aa] {O...    34   1.1  
KAFR0H01340 Chr8 (252802..253443) [642 bp, 213 aa] {ON} Anc_3.29...    33   1.1  
CAGL0E03245g Chr5 complement(299473..300750) [1278 bp, 425 aa] {...    34   1.3  
Ecym_6410 Chr6 (795710..797173) [1464 bp, 487 aa] {ON} similar t...    34   1.3  
SAKL0A04356g Chr1 complement(405004..406539) [1536 bp, 511 aa] {...    34   1.3  
Skud_10.46 Chr10 complement(76968..79172) [2205 bp, 734 aa] {ON}...    34   1.4  
KLLA0C10879g Chr3 (936212..938479) [2268 bp, 755 aa] {ON} weakly...    34   1.5  
Suva_11.119 Chr11 complement(225373..228735) [3363 bp, 1120 aa] ...    34   1.5  
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...    34   1.6  
SAKL0A00352g Chr1 complement(38015..39487) [1473 bp, 490 aa] {ON...    33   1.7  
TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567...    33   1.8  
TPHA0A04510 Chr1 complement(1018807..1020690) [1884 bp, 627 aa] ...    33   1.8  
TPHA0A01040 Chr1 complement(203011..205083) [2073 bp, 690 aa] {O...    33   1.9  
YBR237W Chr2 (691969..694518) [2550 bp, 849 aa] {ON}  PRP5RNA he...    33   1.9  
NCAS0A04110 Chr1 complement(829352..833095) [3744 bp, 1247 aa] {...    33   2.0  
SAKL0E04532g Chr5 (364158..367979) [3822 bp, 1273 aa] {ON} simil...    33   2.0  
TBLA0B01810 Chr2 complement(410017..414531) [4515 bp, 1504 aa] {...    33   2.1  
CAGL0F02255g Chr6 (221723..222163) [441 bp, 146 aa] {ON} similar...    32   2.1  
TPHA0B02880 Chr2 (657768..659264) [1497 bp, 498 aa] {ON} Anc_8.6...    33   2.3  
CAGL0K03949g Chr11 complement(365526..367043) [1518 bp, 505 aa] ...    33   2.3  
KLLA0F08019g Chr6 (752184..754460) [2277 bp, 758 aa] {ON} some s...    33   2.5  
NCAS0A01400 Chr1 (274080..276368) [2289 bp, 762 aa] {ON} Anc_5.241     33   2.5  
Kpol_1019.2 s1019 complement(4070..6757) [2688 bp, 895 aa] {ON} ...    33   2.6  
Skud_4.220 Chr4 (389016..392021) [3006 bp, 1001 aa] {ON} YDL031W...    33   2.6  
Skud_13.403 Chr13 (714405..715454) [1050 bp, 349 aa] {ON} YMR234...    33   2.7  
YNL091W Chr14 (452408..456130) [3723 bp, 1240 aa] {ON}  NST1Prot...    33   2.7  
TBLA0E04730 Chr5 (1208306..1212190) [3885 bp, 1294 aa] {ON}            33   2.7  
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...    33   2.8  
NCAS0A08310 Chr1 (1641487..1642761) [1275 bp, 424 aa] {ON} Anc_1...    33   2.9  
SAKL0G19008g Chr7 (1640890..1642233) [1344 bp, 447 aa] {ON} simi...    33   2.9  
Ecym_4164 Chr4 complement(348576..350069) [1494 bp, 497 aa] {ON}...    26   2.9  
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    33   3.2  
KLLA0B09944g Chr2 (870678..872702) [2025 bp, 674 aa] {ON} weakly...    33   3.2  
TBLA0E00870 Chr5 complement(187915..190014) [2100 bp, 699 aa] {O...    33   3.3  
SAKL0C09746g Chr3 (880534..882699) [2166 bp, 721 aa] {ON} weakly...    33   3.3  
KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {O...    33   3.4  
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    33   3.5  
Smik_14.236 Chr14 (432694..436392) [3699 bp, 1232 aa] {ON} YNL09...    33   3.5  
Skud_14.240 Chr14 (442718..446449) [3732 bp, 1243 aa] {ON} YNL09...    33   3.5  
NDAI0J03020 Chr10 complement(753506..758383) [4878 bp, 1625 aa] ...    33   3.6  
Ecym_1179 Chr1 complement(363479..368491) [5013 bp, 1670 aa] {ON...    33   3.6  
Smik_6.343 Chr6 (546746..548101) [1356 bp, 451 aa] {ON} YPL146C ...    32   3.9  
Smik_14.204 Chr14 (372646..374061) [1416 bp, 471 aa] {ON} YNL124...    32   3.9  
ZYRO0C11748g Chr3 (918429..919901) [1473 bp, 490 aa] {ON} highly...    32   4.0  
TPHA0C03790 Chr3 complement(822142..823614) [1473 bp, 490 aa] {O...    32   4.0  
CAGL0L03069g Chr12 complement(354287..355885) [1599 bp, 532 aa] ...    32   4.0  
CAGL0C00407g Chr3 (40815..42467) [1653 bp, 550 aa] {ON} similar ...    32   4.1  
NCAS0G02000 Chr7 complement(360567..362222) [1656 bp, 551 aa] {O...    32   4.1  
TBLA0C05670 Chr3 complement(1371536..1373419) [1884 bp, 627 aa] ...    32   4.2  
Kwal_14.2258 s14 (679677..681776) [2100 bp, 699 aa] {ON} YGR145W...    32   4.3  
TBLA0J01560 Chr10 (349382..351526) [2145 bp, 714 aa] {ON} Anc_7....    32   4.3  
Suva_6.249 Chr6 (444869..447082) [2214 bp, 737 aa] {ON} YJL168C ...    32   4.3  
Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}...    32   4.4  
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    32   4.5  
CAGL0J00693g Chr10 complement(61246..66900) [5655 bp, 1884 aa] {...    32   4.8  
Smik_8.90 Chr8 (131286..137069) [5784 bp, 1927 aa] {ON} YHR023W ...    32   4.8  
Kpol_274.4 s274 (5051..6838) [1788 bp, 595 aa] {ON} (5051..6838)...    32   5.5  
Kwal_23.6516 s23 complement(1621594..1622538) [945 bp, 314 aa] {...    32   5.9  
Kpol_1031.15 s1031 (38596..41385) [2790 bp, 929 aa] {ON} (38596....    32   5.9  
ABR035C Chr2 complement(461280..464225) [2946 bp, 981 aa] {ON} S...    32   5.9  
SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar...    32   6.0  
Kpol_1018.105 s1018 complement(274868..278014) [3147 bp, 1048 aa...    32   6.0  
KLTH0F13464g Chr6 complement(1104307..1108425) [4119 bp, 1372 aa...    32   6.1  
SAKL0E09768g Chr5 complement(813986..818332) [4347 bp, 1448 aa] ...    32   6.1  
ZYRO0B05786g Chr2 complement(457353..466337) [8985 bp, 2994 aa] ...    32   6.4  
Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON} ...    30   6.5  
YDR076W Chr4 (598468..599688) [1221 bp, 406 aa] {ON}  RAD55Prote...    32   6.5  
NCAS0B00660 Chr2 complement(94734..96017) [1284 bp, 427 aa] {ON}       32   6.6  
TPHA0B04680 Chr2 (1100596..1101927) [1332 bp, 443 aa] {ON} Anc_1...    32   6.7  
NCAS0C05190 Chr3 complement(1056868..1058202) [1335 bp, 444 aa] ...    32   6.7  
KNAG0A06690 Chr1 (1043455..1043490,1043606..1043863) [294 bp, 97...    30   6.7  
ZYRO0E06424g Chr5 (487921..488277) [357 bp, 118 aa] {ON} similar...    30   6.8  
Skud_15.478 Chr15 complement(836937..837160,837194..838505) [153...    32   7.0  
SAKL0H09922g Chr8 complement(849513..851180) [1668 bp, 555 aa] {...    32   7.1  
TPHA0D00910 Chr4 (180414..182294) [1881 bp, 626 aa] {ON} Anc_8.1...    32   7.3  
TPHA0H00500 Chr8 (97469..98326) [858 bp, 285 aa] {ON} Anc_8.127 ...    31   7.4  
Kpol_1055.89 s1055 (228896..231154) [2259 bp, 753 aa] {ON} (2288...    32   7.5  
TPHA0J01440 Chr10 (334822..337212) [2391 bp, 796 aa] {ON} Anc_5....    32   7.6  
TPHA0K01940 Chr11 (408375..410996) [2622 bp, 873 aa] {ON} Anc_4....    32   7.7  
NDAI0G04150 Chr7 complement(997652..998608) [957 bp, 318 aa] {ON...    31   7.8  
TBLA0H00300 Chr8 complement(51145..54972) [3828 bp, 1275 aa] {ON...    32   8.0  
YDR464W Chr4 (1388872..1393179) [4308 bp, 1435 aa] {ON}  SPP41Pr...    32   8.1  
ZYRO0F16368g Chr6 complement(1342457..1343491) [1035 bp, 344 aa]...    31   8.1  
ZYRO0G21318g Chr7 complement(1751145..1755509) [4365 bp, 1454 aa...    32   8.1  
TBLA0B09680 Chr2 (2298522..2303129) [4608 bp, 1535 aa] {ON} Anc_...    32   8.1  
SAKL0G12804g Chr7 complement(1091709..1097228) [5520 bp, 1839 aa...    32   8.2  
Kthe_YGOB_CWC15 Chr7 complement(983375..984070) [696 bp, 231 aa]...    31   8.6  
Suva_7.429 Chr7 (742946..744172) [1227 bp, 408 aa] {ON} YGR142W ...    31   8.6  
TBLA0B05050 Chr2 (1191456..1192997) [1542 bp, 513 aa] {ON} Anc_6...    31   9.2  
Smik_15.491 Chr15 complement(846605..848155) [1551 bp, 516 aa] {...    31   9.2  
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    31   9.2  
KNAG0I01990 Chr9 complement(387149..388786) [1638 bp, 545 aa] {O...    31   9.3  
Kpol_413.5 s413 (13659..15365) [1707 bp, 568 aa] {ON} (13659..15...    31   9.4  
AGL075C Chr7 complement(568737..570521) [1785 bp, 594 aa] {ON} S...    31   9.5  
KLTH0E13596g Chr5 (1204633..1206933) [2301 bp, 766 aa] {ON} weak...    31   9.9  
Smik_10.239 Chr10 (380101..382413) [2313 bp, 770 aa] {ON} YJL033...    31   9.9  

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
            YIL150C (REAL)
          Length = 572

 Score = 1125 bits (2911), Expect = 0.0
 Identities = 560/572 (97%), Positives = 560/572 (97%)
 Frame = +1

Query: 1    MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 180
            MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA
Sbjct: 1    MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60

Query: 181  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 360
            IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA
Sbjct: 61   IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 120

Query: 361  KKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKRYIPEDDLKRSLH 540
            KKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKRYIPEDDLKRSLH
Sbjct: 121  KKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKRYIPEDDLKRSLH 180

Query: 541  EIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 720
            EIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH
Sbjct: 181  EIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240

Query: 721  TLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 900
            TLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI
Sbjct: 241  TLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300

Query: 901  GSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 1080
            GSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT
Sbjct: 301  GSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360

Query: 1081 KVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDM 1260
            KVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDM
Sbjct: 361  KVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDM 420

Query: 1261 LANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLI 1440
            LANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLI
Sbjct: 421  LANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLI 480

Query: 1441 QRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKK 1620
            QRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKK
Sbjct: 481  QRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKK 540

Query: 1621 RNHREEVWQRHFGPKGXXXXXXXXXXXXLEII 1716
            RNHREEVWQRHFGPKG            LEII
Sbjct: 541  RNHREEVWQRHFGPKGEAEEASDASASDLEII 572

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
            MCM10Essential chromatin-associated protein involved in
            the initiation of DNA replication; required for the
            association of the MCM2-7 complex with replication
            origins
          Length = 571

 Score =  999 bits (2582), Expect = 0.0
 Identities = 489/555 (88%), Positives = 521/555 (93%)
 Frame = +1

Query: 1    MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 180
            M+DPREILAVDPYN++TSDEEDEQAIA+ELEFMERKRQAL+ERLKRKQ FKKP DPNFEA
Sbjct: 1    MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60

Query: 181  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 360
            IEVPQSPTK+RVK GS NA +Q T+ E SN NE  LSQ+Q+QP+ P +TTTYFM+KFQNA
Sbjct: 61   IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA 120

Query: 361  KKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKRYIPEDDLKRSLH 540
            KK+ED+QIAKFESMM+ARVHTF TD KKY PII NELE FSNLWVKKRYIPEDDLKR+LH
Sbjct: 121  KKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALH 180

Query: 541  EIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 720
            EIKILRLGKLFAK+RPPKFQ PEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH
Sbjct: 181  EIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240

Query: 721  TLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 900
            TLDVYIFGKKGVERYYNLRLGD+IAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI
Sbjct: 241  TLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300

Query: 901  GSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 1080
            GSSRDLGWCPIVN KTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT
Sbjct: 301  GSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360

Query: 1081 KVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDM 1260
            KV+SQPSLYKAKGEN FNII+  RK LSEEEER+KKSSHNFTNSNSAKAFFDEKFQNPDM
Sbjct: 361  KVDSQPSLYKAKGENGFNIIKGTRKRLSEEEERLKKSSHNFTNSNSAKAFFDEKFQNPDM 420

Query: 1261 LANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLI 1440
            LANLDNKRRKI +TKKS AL+REL KIMRR+ESSGLEDKS GE+QKMK+TTE+ALQTGLI
Sbjct: 421  LANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLI 480

Query: 1441 QRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKK 1620
            QRLGFDPTHG+IS+VLKSSV G E KNNLL  KKTVINDLLHYKKEKVILAPSKNEWFKK
Sbjct: 481  QRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKK 540

Query: 1621 RNHREEVWQRHFGPK 1665
            R+HREEVWQ+HFG K
Sbjct: 541  RSHREEVWQKHFGSK 555

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
            YIL150C (REAL)
          Length = 569

 Score =  977 bits (2526), Expect = 0.0
 Identities = 477/555 (85%), Positives = 514/555 (92%)
 Frame = +1

Query: 1    MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 180
            MDDPREILAVDPYN+VTSDEEDEQAIAKELEFMERK+QALMERLKRKQ FKKP DPNFEA
Sbjct: 1    MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60

Query: 181  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 360
            +EVPQSP K  +   SQ+A+KQ  R   SN NES LSQ  +  E P NTTTYFMQKFQ+A
Sbjct: 61   VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQ--QSQESPSNTTTYFMQKFQDA 118

Query: 361  KKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKRYIPEDDLKRSLH 540
            K++ED+QIAK+E MM+ARVHTFGTDNK+YKPII NELE FSNLWVKKRYIPE+DLKR+LH
Sbjct: 119  KRNEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALH 178

Query: 541  EIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 720
            EIKILRL KLFAK+RPPKFQ P+YANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH
Sbjct: 179  EIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 238

Query: 721  TLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 900
            +LDVYIFGKKGVERYYNLRLGD+IAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI
Sbjct: 239  SLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 298

Query: 901  GSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 1080
            GSSRDLGWCPIVN KTHK CGSPIN ++H CCDYHREVQFRGT AKRIELNGGYALGAPT
Sbjct: 299  GSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGAPT 358

Query: 1081 KVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDM 1260
            KV+SQPSLY+AKGEN+FNI+R  RKGLSEEEER+K++SHNFTNSNSAKAFFDEKFQNPDM
Sbjct: 359  KVDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDM 418

Query: 1261 LANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLI 1440
            LANLD+KRRKI DTKKS AL+REL KIMRRK+SSGLEDKS+GEKQKMKQTTE+ALQTGLI
Sbjct: 419  LANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLI 478

Query: 1441 QRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKK 1620
            QRLGFDPTHG+ISKVLKSSVPGGES  N +NGKKTVINDLL YKKEKVILAPSKNEWFKK
Sbjct: 479  QRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKK 538

Query: 1621 RNHREEVWQRHFGPK 1665
            R+HREEVWQRHFG K
Sbjct: 539  RSHREEVWQRHFGSK 553

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
            YIL150C (REAL)
          Length = 571

 Score =  935 bits (2416), Expect = 0.0
 Identities = 451/555 (81%), Positives = 504/555 (90%)
 Frame = +1

Query: 1    MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 180
            MDDPRE L  DPYN+VTSDE+DEQ IAKELEFMERK+QAL+ERLKRKQ FK+  DPNFEA
Sbjct: 1    MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60

Query: 181  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 360
            IEVPQSP K+R    SQN +K+  R   SN N+  LSQ+Q++ ELP NTT YFMQKFQNA
Sbjct: 61   IEVPQSPAKNRNIMKSQNTMKRDMRPAASNINDLKLSQLQQKQELPSNTTGYFMQKFQNA 120

Query: 361  KKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKRYIPEDDLKRSLH 540
            K++E++Q AK+E+MM+ARVHTFGTD K+Y+  IANELE FSN+WVKKRYIPEDDLKR+LH
Sbjct: 121  KRNEEKQRAKYENMMNARVHTFGTDKKEYRATIANELEEFSNIWVKKRYIPEDDLKRALH 180

Query: 541  EIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 720
            EIKILRLGKLFAK+RPPKFQ P+YANWA VGLISHKSD+KFTSS+KP KFFMFTITDFQH
Sbjct: 181  EIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFTITDFQH 240

Query: 721  TLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 900
            TLDVYIFGKK VERYYNLRLGD+IAILNPEVLPWRPSG+GNFIKSFNLRISHDFKCILEI
Sbjct: 241  TLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFIKSFNLRISHDFKCILEI 300

Query: 901  GSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 1080
            GSSRDLGWCPIVN K ++ CGSPINI+LHKCCDYHREVQFRGTSAKRIELNGGYALGAPT
Sbjct: 301  GSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360

Query: 1081 KVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDM 1260
            KV++QP+LY+AKGEN FN++R  RK LSEEEERMKK+SHNF NSNSAKAFFDEKFQNPDM
Sbjct: 361  KVDAQPTLYRAKGENNFNLVRSIRKTLSEEEERMKKNSHNFRNSNSAKAFFDEKFQNPDM 420

Query: 1261 LANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLI 1440
            LANLD+KRRKI D+KKS AL+REL KIMRRK SSGLEDK D EKQK+KQTTE+ALQTGL+
Sbjct: 421  LANLDSKRRKIIDSKKSTALSRELGKIMRRKGSSGLEDKCDEEKQKIKQTTESALQTGLL 480

Query: 1441 QRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKK 1620
            QRLGFDPTHG+ISKVLKSSVPGGE +N ++ GKKTVI+DLL+YKKEKVILAPSKNEWFKK
Sbjct: 481  QRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILAPSKNEWFKK 540

Query: 1621 RNHREEVWQRHFGPK 1665
            R+HREEVWQ+HFG K
Sbjct: 541  RSHREEVWQKHFGSK 555

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
            Anc_5.703 YIL150C
          Length = 592

 Score =  623 bits (1607), Expect = 0.0
 Identities = 311/567 (54%), Positives = 417/567 (73%), Gaps = 12/567 (2%)
 Frame = +1

Query: 1    MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 180
            M+DPRE+L  DPY++V+SDE+DE+AI ++LE +ERKRQ L+ R+K KQ  KK  DPNF+ 
Sbjct: 1    MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60

Query: 181  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 360
            ++VP SP K    +      K    +E  + N + L   +K  +LP NTTTYFM+KFQ +
Sbjct: 61   LQVPCSPVKKTETNVPVAMKKSTNEMEIPHENPNELRIREKSGQLPSNTTTYFMEKFQKS 120

Query: 361  KKDEDRQIAKFESMMDARVHTFGTDNKK--YKPIIANELEGFSNLWVKKRYIPEDDLKRS 534
            KK+E+ +I K E+MM+ARVHTF     K  +KPI  NE+E +SN+W+KKRYIP+ +L++ 
Sbjct: 121  KKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSELRKM 180

Query: 535  LHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDF 714
            LH IKILRL KLFAKVRPPKF  P+Y+NWA +G+IS K D KFT+++KP K+  FT+TDF
Sbjct: 181  LHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFTMTDF 240

Query: 715  QHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCIL 894
            QH LDVYIFGK GVERYYNLR+GD+IAILNPEV PWRPSG+G FIKSFNLRI+HDFKCIL
Sbjct: 241  QHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFIKSFNLRINHDFKCIL 300

Query: 895  EIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGA 1074
            EIGSS+DLG+C  V ++    C +PIN+S    CDYH+E++FR  ++KRIELNG +ALGA
Sbjct: 301  EIGSSKDLGFCK-VTSRNGTLCNTPINMSKEDRCDYHQEIRFRDNNSKRIELNGSFALGA 359

Query: 1075 PTKVNSQPSLYKAKG-------ENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFF 1233
            PTKV + P+LY+ K        +NR N    A  G S  +++    + +F+N+NSAKAFF
Sbjct: 360  PTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFG-SINKDQFDLRNRHFSNNNSAKAFF 418

Query: 1234 DEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTT 1413
            DEKFQNPDML NL++KRRKI D KK   +++EL+K +  + S  L ++S  E ++MK+ T
Sbjct: 419  DEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEVKQMKRAT 478

Query: 1414 ENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNL---LNGKKTVINDLLHYKKEKV 1584
            E  LQ+G+IQRLGFDPTHG+I+ VL+++    E K+ L   ++GKK  +NDLLH++K  V
Sbjct: 479  ETTLQSGVIQRLGFDPTHGKIANVLRTT-HSKEEKDTLSEQMSGKKDKVNDLLHFRKSHV 537

Query: 1585 ILAPSKNEWFKKRNHREEVWQRHFGPK 1665
            ILAP++NE  ++R+ RE +WQ +FG K
Sbjct: 538  ILAPTRNELIERRDRRERIWQENFGQK 564

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
            Anc_5.703 YIL150C
          Length = 584

 Score =  572 bits (1474), Expect = 0.0
 Identities = 291/569 (51%), Positives = 395/569 (69%), Gaps = 16/569 (2%)
 Frame = +1

Query: 1    MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 180
            M DPREI   D Y ++T D+ED + I  ELE +E  ++ L+ERL RK+   +  DPNF  
Sbjct: 1    MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60

Query: 181  IEVPQSPTKS---RVKSGSQNAVKQVTRLETSNANESNL---SQIQKQPELPINT---TT 333
            ++VP SP K    ++       +K + R E SN N + L    + QKQ     ++   T 
Sbjct: 61   VQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNASTE 120

Query: 334  YFMQKFQNAKKDEDRQIAKFESMMDARVHTF-GTDNK-KYKPIIANELEGFSNLWVKKRY 507
            YFM+KF++AK+ E   I K ESMM +RVHTF G + K +Y+ +I +ELE +SNLW+ KRY
Sbjct: 121  YFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKRY 180

Query: 508  IPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVK 687
             P  +LK  LHE+KILRL KLFAKVRPPKF+ P+Y+NW  VG++S KSDIKFT+S KP K
Sbjct: 181  TPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQK 240

Query: 688  FFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLR 867
            +  FT+TDF+H +D YIFGK+GVERYYNLR+GDIIA+LNPE+LPWRPSG+ N+IKSFNLR
Sbjct: 241  YLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQNYIKSFNLR 300

Query: 868  ISHDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIE 1047
            ISH +KCILEIG SRDL  CPIV   T K+CG PIN  + +CC+YHRE++ R   +KR++
Sbjct: 301  ISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGPSKRLD 360

Query: 1048 LNGGYALGAPTKVNSQPSLYKAKGE-----NRFNIIRDARKGLSEEEERMKKSSHNFTNS 1212
            L+G YALGAPTK+ SQP+LY+           F +     +      ++  + S  F+N 
Sbjct: 361  LSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNPHLIDKYGEKSKFFSNR 420

Query: 1213 NSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEK 1392
            N+AKAFFD++FQNPDM++NLDNKRRKI + +KS  LNREL +++R+ +   LE K+  E 
Sbjct: 421  NAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRKDQD--LEGKTREEV 478

Query: 1393 QKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYK 1572
            +KMKQTT+  LQ+GL Q++GFDPT G+IS++LK+     + +   L+ K   ++DL+ +K
Sbjct: 479  EKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVDDLMAFK 538

Query: 1573 KEKVILAPSKNEWFKKRNHREEVWQRHFG 1659
            KE +ILAPSK +   K+N RE+VWQ +FG
Sbjct: 539  KEYIILAPSKVDLLNKKNKREKVWQENFG 567

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
            Anc_5.703 YIL150C
          Length = 567

 Score =  568 bits (1465), Expect = 0.0
 Identities = 285/561 (50%), Positives = 395/561 (70%), Gaps = 6/561 (1%)
 Frame = +1

Query: 1    MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 180
            M+DPRE++  DP+  +TSDEED++ +  ++  +ER+++ L+ERLK K+  K   DPNF+A
Sbjct: 1    MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLKS-KDPNFDA 59

Query: 181  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 360
            I+V  SP K   +S      +    L+  N NE    +++ + ++P NTT+YF+  F+N+
Sbjct: 60   IQVESSPVKKPAESIKVEPSRTKRVLDIENLNEK---KVESRSQIPANTTSYFIDNFRNS 116

Query: 361  KKDEDRQIAKFESMMDARVHTF-GTD-NKKYKPIIANELEGFSNLWVKKRYIPEDDLKRS 534
            KK+E +   + + ++  RVHTF G D N K+K +   E+E +S+LWVK+RYI +DDL++ 
Sbjct: 117  KKEEQKSQQERQELLSKRVHTFRGIDGNHKFKAVAVEEVEEYSDLWVKQRYISQDDLRKV 176

Query: 535  LHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDF 714
            LHE+KILRL KLFAK++PPKF  P+Y+NWA +G+IS K  +KF+SS KP+K+F FT+TDF
Sbjct: 177  LHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLTDF 236

Query: 715  QHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCIL 894
            Q+ LDVY+FGKKGVERYYNLR+GDI+AILNPEVLPWRPS +GNFIKSFNLRISHDF CIL
Sbjct: 237  QYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFIKSFNLRISHDFPCIL 296

Query: 895  EIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGA 1074
            EIG SRD+ WC   N   +K CG+PIN +  KCCD+HRE+QFR   AKRIELNG +ALGA
Sbjct: 297  EIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSFALGA 356

Query: 1075 PTKVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSH----NFTNSNSAKAFFDEK 1242
            PTKV+S P+LY+ K        R+ +   +  ++ + K+S     +F+N N+AKAFF+++
Sbjct: 357  PTKVDSGPALYREKSAGAH---RNFKVLPNHYQKSVGKNSDLRGIHFSNGNAAKAFFNDE 413

Query: 1243 FQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENA 1422
            FQNPD+L NLD+KRRK  D KKS  L ++L +I  R  +  +E K   + +++ +TTE  
Sbjct: 414  FQNPDILNNLDSKRRKRQDDKKSLILQQQLKRINSRHAAIEIE-KGSKKYEEICETTEAT 472

Query: 1423 LQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSK 1602
            LQ+GLIQ LGFDPTHGEI  VLK +    +S N  LN K+  ++ LL +KKE V L P+K
Sbjct: 473  LQSGLIQNLGFDPTHGEIGNVLKQAAK-DKSNNGQLNKKQKEVSSLLKFKKEHVELKPAK 531

Query: 1603 NEWFKKRNHREEVWQRHFGPK 1665
                +++  RE  WQ +FG K
Sbjct: 532  EVLLQRKRDRERAWQENFGDK 552

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar to
            uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  541 bits (1395), Expect = 0.0
 Identities = 279/576 (48%), Positives = 399/576 (69%), Gaps = 25/576 (4%)
 Frame = +1

Query: 4    DDPREILAVDPYNSVTSDEEDEQA-IAKELEFMERKRQALMERLK--RKQAFKKPNDPNF 174
            +DPRE+  +DPY  ++ D++++++ I +ELE +ERK+Q L+ RLK  +++   K  DPN 
Sbjct: 7    NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66

Query: 175  EAI------EVPQSPTKSRV--KSGSQNAVKQVTRLETSNANESNLSQ---IQKQPELPI 321
            + I      EVP+SP +  +  +   Q+ V QVT  + +N  ++N ++   ++K+ ++ +
Sbjct: 67   KNINSRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQAANNKKANPNEEDIVRKELDV-V 125

Query: 322  NTTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTFG--TDNKKYKPIIANELEGFSNLWV 495
             TT+YF  KF+N+K DE+R +  ++ MM AR HTF   T     K I  +ELE +SN  +
Sbjct: 126  ATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNFHI 185

Query: 496  KKRYIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSE 675
            KKRYIP+D++ + LH IKILRL KLFAKVRPP F  P+Y+NW  +G IS K D+K T++ 
Sbjct: 186  KKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTNAA 245

Query: 676  KPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKS 855
            KPVK+F FT+TDF+H LDVY+FGKK VERYYNLR+GDIIA+LNPE+LPWRPSG  N IKS
Sbjct: 246  KPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCVNGIKS 305

Query: 856  FNLRISHDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSA 1035
            FNLRI HDF CILEIG+SRDLGWC +VN    K C SPIN    +CC++HRE+Q R T++
Sbjct: 306  FNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRSTAS 365

Query: 1036 KRIELNGGYALGAPTKVNSQPSLYKAKGENR---------FNIIRDARKGLSEEEERMKK 1188
            KRIEL+G YALGAPTKV +QPS+YK   ++R         F+I     K   +E+E+ + 
Sbjct: 366  KRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGHGSK-KEQEKEKHEI 424

Query: 1189 SSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGL 1368
             +H+F+N  +AKAFFD+ FQ+P +LANL++KRRKI    K+  ++R L K +  +++S  
Sbjct: 425  EAHHFSNKRAAKAFFDDSFQDPSLLANLESKRRKI----KASKMDRNLLKALNGEDAS-- 478

Query: 1369 EDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTV 1548
                   KQ++K+ TE  LQTG+IQRLGFDP+ G+I+KVL  S  G ++ +  ++ K  +
Sbjct: 479  ---QSKNKQQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKS-RGTKTDDPTISKKMGL 534

Query: 1549 INDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRHF 1656
            INDL+H+KK+K+ L PS+    +KR+ RE +W++HF
Sbjct: 535  INDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHF 570

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
            YIL150C
          Length = 616

 Score =  542 bits (1397), Expect = 0.0
 Identities = 283/597 (47%), Positives = 404/597 (67%), Gaps = 43/597 (7%)
 Frame = +1

Query: 7    DPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA-I 183
            DPR+++  DPY+++TSDE++E  I +ELE MER+++ L +RLK K+A  KP D N +  +
Sbjct: 4    DPRDVITADPYDNITSDEDEESKIQRELEEMERRKKDLEKRLKLKRAHVKPTDLNLQLDV 63

Query: 184  EVPQSPTK--------SRVKSGSQNAVKQ------VTRLETSNANESNLSQIQKQP-ELP 318
            +VP SP K        +R +     A+K+      +   +  N NE+  +Q+     +  
Sbjct: 64   QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQS 123

Query: 319  IN-TTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWV 495
            +N TT+YF++KFQ +KK E  +I   E+M+ ARVHTF   +K+++    NELE FS+LW+
Sbjct: 124  VNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVDKEFQLEAVNELEQFSDLWI 183

Query: 496  KKRYIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSE 675
             KRYIP+  L+ SL ++K+LRL KLFAKVRPPKFQ P+Y+NWA + +IS KS++KFT+S+
Sbjct: 184  SKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTTSK 243

Query: 676  KPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSG---RGNF 846
             P KF  FT+T+FQ  LD+++FG  GV+RYYNLR GDI+A+LNPE+LPWRPSG   +   
Sbjct: 244  NPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQTTS 303

Query: 847  IKSFNLRISHDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRG 1026
            IKSFNL+I+H FKCILEIG SRDLG+CP+    +++KCGS IN++  + C+YHRE+Q R 
Sbjct: 304  IKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQMRQ 363

Query: 1027 TSAKRIELNGGYALGAPTKVNSQPSLYKAKGENRF-----NIIRDARK------------ 1155
             S+KR++LNGG+ALGAPTKV +QP L++ +   RF     ++ RD  K            
Sbjct: 364  NSSKRLDLNGGFALGAPTKVGTQPDLFR-EASGRFKQSARSLPRDQGKRFYTEPSWNSRH 422

Query: 1156 ---GLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNR 1326
               G SEE   +K     FT+SN+AKAFFD++FQNPDML NLD KRRK+ D+KKS+ L+R
Sbjct: 423  GQGGSSEENYGLK--GKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDSKKSRQLDR 480

Query: 1327 ELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLK---SS 1497
            +L +++ + E     DK+  E   +K+TTE AL TGLIQRLGFDPTHG  + V+K   S 
Sbjct: 481  KLKRLLSKDEDRATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRDSE 540

Query: 1498 VPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRHFGPKG 1668
               G +++  L+ K+ ++N+LL +K++K  L PS+ +   ++ HR EVW+  FG KG
Sbjct: 541  RGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKKG 597

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
            (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  540 bits (1390), Expect = 0.0
 Identities = 276/566 (48%), Positives = 385/566 (68%), Gaps = 13/566 (2%)
 Frame = +1

Query: 1    MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 180
            M+DPRE    D Y++++SDE ++  I+++L+ +ER++Q L+ERLK+K+  K   DPNF  
Sbjct: 1    MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERQKQDLLERLKKKKERKSKLDPNF-- 58

Query: 181  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 360
            ++VP SP KSRV      + K +   E       N   +  + +    TT+YFM+KF N+
Sbjct: 59   VQVPSSPKKSRVVELKPTS-KPIDNNEEEEEENPNEVALMTKDDSNYGTTSYFMEKFYNS 117

Query: 361  KKDEDRQIAKFESMMDARVHTF-GTDNKK-YKPIIANELEGFSNLWVKKRYIPEDDLKRS 534
            KKD +R++  + SMM +RVHTF GT +KK +KP   +EL+ +SNLW++ RYIP D+L   
Sbjct: 118  KKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDELNLM 177

Query: 535  LHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDF 714
            L +IKILRL KLFAKVRPPKF  P+Y+NW   G+I+ K DIK+TSS KP K+F FTI+DF
Sbjct: 178  LLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTISDF 237

Query: 715  QHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPS----GRGNFIKSFNLRISHDF 882
            QH LDV+IFG KGVE+YYNLR+GD++AILNPE+LPWRPS    G G+ IKSFNLRISH F
Sbjct: 238  QHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLRISHKF 297

Query: 883  KCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGY 1062
             CILEIG+SRDLGWCPI N   +  C +PIN S    C YHRE+QFR T++ R+EL+G Y
Sbjct: 298  DCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVELSGTY 357

Query: 1063 ALGAPTKVNSQPSLYKAKG-------ENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSA 1221
            ALGAPTKV+++P+LY+ +G       +  +N++ D+     ++  +++   H+F+  NSA
Sbjct: 358  ALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFSTMNSA 417

Query: 1222 KAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKM 1401
            KAFFDE FQNPD+L NLD+KRRKI D+K    + R L K ++        DK     + +
Sbjct: 418  KAFFDEDFQNPDILNNLDSKRRKIKDSK----MERNLVKALK-----NTVDKESKNFKNL 468

Query: 1402 KQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEK 1581
            K  T+  LQTG++QRLGFDPT G++S V+++S    E  N     KK  ++DL+ ++K+ 
Sbjct: 469  KNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTFRKDT 528

Query: 1582 VILAPSKNEWFKKRNHREEVWQRHFG 1659
            V L PSK++  K+R  R+  W++ FG
Sbjct: 529  VNLKPSKDDLIKRRIDRQRNWKKLFG 554

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
            Anc_5.703 YIL150C
          Length = 610

 Score =  540 bits (1390), Expect = 0.0
 Identities = 285/588 (48%), Positives = 393/588 (66%), Gaps = 35/588 (5%)
 Frame = +1

Query: 1    MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 180
            M+DPRE    DP+  ++  EE+E A+ +ELE ++R++  L+ RLK  +  +K  DPNF+ 
Sbjct: 1    MNDPRECSPEDPFADLSDKEENEDAVLEELEDLDRRKSDLLGRLKELKERQKRRDPNFDE 60

Query: 181  IEVPQSPTK--SRVKSGSQNAVKQVTRLETS------------NANESNLSQIQKQPE-L 315
            +++P +P +  + + +  Q  ++   R E              N NE  + + ++  E L
Sbjct: 61   VQIPGTPEEKNTNIFTSEQTILQNRDRKEEEVEEEEFSGERLPNPNELKVREREENLEKL 120

Query: 316  PINTTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTFGTDNK-------KYKPIIANELE 474
            P NTT+YFM+KFQ+ KK E+ +  + E M+ ARVH F   NK       +Y+P  ANE+E
Sbjct: 121  PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVE 180

Query: 475  GFSNLWVKKRYIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSD 654
             +S L ++KRYIP+ +L      IKILRL KLFAKVRPPKF+ P+Y+NW T+G+I+ K  
Sbjct: 181  EYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGS 240

Query: 655  IKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSG 834
            IKFTSS+KP K+F FTI+DF++ +D++IF K  VERYYNLR+GDIIAILNPEVLPWRPS 
Sbjct: 241  IKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSN 300

Query: 835  --RGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNTKTHK-KCGSPINISLHKCCDYH 1005
               G  IKSFNLRI+H++ CI+E+G S+DLG+CPI N       C +PI+IS    C YH
Sbjct: 301  NKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYH 360

Query: 1006 REVQFRGTSAKRIELNGGYALGAPTKVNSQPSLYKAKG--------ENRFNIIRDARKGL 1161
            +E++FR   +KRIELNG +ALGAP KV +QP LY+            NRFN+++ +    
Sbjct: 361  QEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGSEIRK 420

Query: 1162 SEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKI 1341
            +E +   ++    F+++NSAKAFFDEKFQNPDML NLD KRRKI D K+S  L++EL+K 
Sbjct: 421  NESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQELSKA 480

Query: 1342 MRRKESSGLE-DKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESK 1518
            +  K S+ L  +K+  E  KMK  TE  LQTG+IQRLGFDPTHG+I+KVL++    G  K
Sbjct: 481  IENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGKDSG--K 538

Query: 1519 NNLLNGKKT-VINDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRHFG 1659
            +N+ N  K   + DLL +KK KV+LAP+K E  K++N REEVWQ+HFG
Sbjct: 539  DNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFG 586

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
            similar to uniprot|P32354 Saccharomyces cerevisiae
            YIL150C MCM10 Essential chromatin-associated protein
            involved in the initiation of DNA replication required
            for the association of the MCM2-7 complex with
            replication origins
          Length = 569

 Score =  535 bits (1377), Expect = 0.0
 Identities = 270/562 (48%), Positives = 381/562 (67%), Gaps = 6/562 (1%)
 Frame = +1

Query: 1    MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 180
            M DPRE+L  D Y+ +TS+ E+E  I  ++  +ER+++ L++RL  K+   KP DPN   
Sbjct: 1    MRDPREVLNNDLYDVLTSEGEEENEIEAQIAEIERQKKDLLQRLNVKKTNPKPLDPNLSH 60

Query: 181  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 360
            I+V  SP K           +Q  R E  N N + L + Q Q ++P NTT++F++K+  +
Sbjct: 61   IQVESSPKKVTNSVLPPTVQQQEPRGEVRNENLNEL-KAQSQEQIPANTTSFFIEKYSTS 119

Query: 361  KKDEDRQIAKFESMMDARVHTFGTDNKK--YKPIIANELEGFSNLWVKKRYIPEDDLKRS 534
            K+ +D ++   E ++  RVHTF    ++  YKPI  NELE FSNLW+ KRYIP+++ +  
Sbjct: 120  KRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQRSI 179

Query: 535  LHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDF 714
               IKILRL KLFAKV+PPKF  P Y+NWA +GLIS+K ++KFTS+  P K+F FT+T+F
Sbjct: 180  FANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLTNF 239

Query: 715  QHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCIL 894
            Q+++D YIFGK+GVERYYNLR+GDIIAILNP+VLPWRPSG    IKSFNLRISH F+CIL
Sbjct: 240  QYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIKSFNLRISHKFECIL 299

Query: 895  EIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGA 1074
            EIG+SRDLGWCP+ N   ++ C +PIN     CC+YHRE++FR T+AKR+EL+G YALGA
Sbjct: 300  EIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYALGA 359

Query: 1075 PTKVNSQPSLYKAKGENR---FNIIRDARKGLSEEE-ERMKKSSHNFTNSNSAKAFFDEK 1242
            PT++++QP+LY+     +   +NII +   G S +E   +  ++ +F+N N+AKAFFDE+
Sbjct: 360  PTRIDAQPALYRGGSSQKNLNYNIITNGADGGSNKEINPLDINARHFSNRNAAKAFFDER 419

Query: 1243 FQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENA 1422
            FQNP+ L NL+NKRRK+ D +KS  LNREL    ++     ++ KS  E  ++K+TTE+ 
Sbjct: 420  FQNPETLRNLENKRRKLRDNRKSNILNREL----KKNSELDIKHKSAEEIDEIKRTTEST 475

Query: 1423 LQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSK 1602
            + +G+++ LGFDPT G+I+ V K      +S    L  K + +  LL +KK+ V L PSK
Sbjct: 476  MGSGMMKNLGFDPTQGKIASVFKHQ--RSDSDKKPLTEKDSSVASLLSFKKDNVKLKPSK 533

Query: 1603 NEWFKKRNHREEVWQRHFGPKG 1668
                K++  RE VW+ HFG  G
Sbjct: 534  EILIKQKRRRERVWKEHFGSGG 555

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
            Anc_5.703 YIL150C
          Length = 544

 Score =  511 bits (1315), Expect = e-176
 Identities = 261/520 (50%), Positives = 351/520 (67%), Gaps = 9/520 (1%)
 Frame = +1

Query: 121  MERLKRKQAFKKPNDPNFEAIEVPQSPTKSRVKSGSQ-NAVKQVTRLETSNANESNLSQI 297
            M+RLK K+  +K  DPNF  I++ +SP K +    +  N +     +E  N NE+   ++
Sbjct: 1    MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDVNPNEA---KV 57

Query: 298  QKQPELPINTTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTFGTDN--KKYKPIIANEL 471
                 LP NTT+YFMQ F  AKK+E +Q+ +++  M +RVH+F   N  KKY+ II  EL
Sbjct: 58   VSNANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEEL 117

Query: 472  EGFSNLWVKKRYIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKS 651
            E +S   + KRY+P++++ + LH IKILRL KLFAK+RPPKF  P+YANWA  G+I  K 
Sbjct: 118  EEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKE 177

Query: 652  DIKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPS 831
            DIK TSS+ PVKFF FTIT+FQHTLD++IFG  GVE+YYNLR+GDII ILNPEVLPWRP 
Sbjct: 178  DIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPE 237

Query: 832  GRGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHRE 1011
             +GN IKSFNLRISH F CILEI  S+D+ WC  +N KT  KC +PIN S    CDYH+E
Sbjct: 238  FKGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKE 297

Query: 1012 VQFRGTSAKRIELNGGYALGAPTKVNSQPSLYKAKGE------NRFNIIRDARKGLSEEE 1173
            +QFR  +AKR+EL+G YALGAPT+++S+P+LY++K        N FNI+ D R    +E 
Sbjct: 298  MQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYMKKKEN 357

Query: 1174 ERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRK 1353
            + +    H+F++SNSAKAFFDE FQNPDML NL+NKRRKI D K+   L R L + +   
Sbjct: 358  DPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDKRDVMLQRALRESVGNS 417

Query: 1354 ESSGLEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLN 1533
            +   L+DKS+ E Q M+ TT+  LQ G IQ+LGFDPT G+I  VL+ S     +++ L  
Sbjct: 418  KLL-LKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSA-DKSTQSKLQK 475

Query: 1534 GKKTVINDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRH 1653
             K   + +L+ +KK  V L PS+    +K +HRE+ + ++
Sbjct: 476  QKSNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQY 515

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
            YIL150C
          Length = 594

 Score =  497 bits (1279), Expect = e-170
 Identities = 254/579 (43%), Positives = 379/579 (65%), Gaps = 26/579 (4%)
 Frame = +1

Query: 1    MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNF-- 174
            M+DPRE+   D +++++ DE++E  + K++E +ER+++ L ERL+ K+   +  DPNF  
Sbjct: 1    MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60

Query: 175  ----------EAIEVPQSPTKSRVKSGSQNAVKQVTRLETS---NANESNLSQIQKQPEL 315
                        I+VP SP K + K  +Q A   VT+  T    N NE  L    +   +
Sbjct: 61   TEGNVDATSESRIQVPGSPEKIKRKH-TQLAATPVTKKNTGIQDNPNELKLKNQIEPASV 119

Query: 316  PINTTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTFG--TDNKKYKPII-ANELEGFSN 486
            P  +T YFM  F ++KK E ++I  +E++M ARVH+FG  T+ +K   II   E E +S 
Sbjct: 120  PAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSG 179

Query: 487  LWVKKRYIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFT 666
            LW+ +RY+ E+ + + L +IKILRL KLFAK+RPPKF++P+Y+NW  VG+I+ KS  K T
Sbjct: 180  LWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLT 239

Query: 667  SSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNF 846
            SS  P K+F FTI DFQ  + +++F ++ + +YYNLR+GDII ILNP + PWRPS    +
Sbjct: 240  SSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGY 299

Query: 847  IKSFNLRISHDFKCILEIGSSRDLGWCPI-VNTKTHKKCGSPINISLHKCCDYHREVQFR 1023
            IKSFNL I   + CI+EIG SRDLGWC + V +K  K CG+PIN +  KCC++HRE +FR
Sbjct: 300  IKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFR 359

Query: 1024 GTSAKRIELNGGYALGAPTKVNSQPSLYKAK-----GENRFNIIRDARKGLSEEEERMKK 1188
              +AKRIELNG +ALGAPTK ++ PSLYK K      +N+FN++R  R    E + ++  
Sbjct: 360  NAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVR-RRNARKEGDSKLHN 418

Query: 1189 SSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKE--SS 1362
            S  NF ++N AKAFF+++FQNPD+++NLD+KRRK+ D K+   L +EL K + +++  S 
Sbjct: 419  S--NFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSK 476

Query: 1363 GLEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKK 1542
             LE KS  + ++M+  TEN +Q G+++ +G+DPTHG++  ++K S   G+  +   N + 
Sbjct: 477  NLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKS--NGKDPSYTSN-RS 533

Query: 1543 TVINDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRHFG 1659
              +NDLLH+KK+KV L P K++   K+  R+E+W  +FG
Sbjct: 534  NAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFG 572

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp, 583
            aa] {ON} similar to uniprot|P32354 Saccharomyces
            cerevisiae YIL150C MCM10 Essential chromatin-associated
            protein involved in the initiation of DNA replication
          Length = 583

 Score =  467 bits (1202), Expect = e-158
 Identities = 243/559 (43%), Positives = 363/559 (64%), Gaps = 9/559 (1%)
 Frame = +1

Query: 7    DPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEAIE 186
            DPRE+L +D ++ VTSDE+++  I ++L+ +ER+++ L +RL++K + KK    + E +E
Sbjct: 6    DPREVLQLDVHDIVTSDEDEDTKIKQQLDELERQQRDLRDRLEQKASRKKAQRQSLERVE 65

Query: 187  VPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNAKK 366
            VP SP + R    S  + K    + T  AN +N S        P NTT+YF++ F NA+K
Sbjct: 66   VPASPKEERKSKASPQSQKSSKGI-TLAANSNNDSIEVPWKNGPSNTTSYFVENFVNARK 124

Query: 367  DEDRQIAKFESMMDARVHTF-GTDNKK-YKPIIANELEGFSNLWVKKRYIPEDDLKRSLH 540
             E+++I    S++  RVHTF G D+ K  +P+  +E E +S   + +RY+   +L   + 
Sbjct: 125  VEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELDEIMR 184

Query: 541  EIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 720
            EIK+LRL KLF+KVRPPKF  P+YANW  +G+IS KS++K TSS KP K+F  T+TDF H
Sbjct: 185  EIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLTDFTH 244

Query: 721  TLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSG------RGNFIKSFNLRISHDF 882
             LD+YIF  K VE+YYNLR+GDIIAILNP++LPWRPS        G  +KSFNL I H+F
Sbjct: 245  NLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSIRHNF 304

Query: 883  KCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGY 1062
             C+LEIG+S+DLG+C I N  T K CG+PIN +    C+YH++V+FR  +A+R+ELNG  
Sbjct: 305  DCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVELNGST 364

Query: 1063 ALGAPTKVNSQPSLYKAKG-ENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDE 1239
            +L +P K   + +LY   G + +  ++ D  K   + ++   +++  F+N N AKAFFD+
Sbjct: 365  SLRSPVKNGKKQALYGTSGVKRKLQLLPD--KHAPQAQDGESQNTLFFSNPNYAKAFFDD 422

Query: 1240 KFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTEN 1419
             +QNPDML NL+NKRRK+ D++K + L  +L   + +       +KS  E+++MK  TE 
Sbjct: 423  SYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMKDATEQ 482

Query: 1420 ALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPS 1599
             L +GL++ +GFDP  G++ +VLK     G++ N+ LN K + + +++ +KK  V LAPS
Sbjct: 483  VLNSGLLRDIGFDPFRGKMREVLKF----GKNVNSGLNSKSSQVKEIMSFKKSNVSLAPS 538

Query: 1600 KNEWFKKRNHREEVWQRHF 1656
            K E  K+   RE+VW+ HF
Sbjct: 539  KAEQKKRLLRREQVWREHF 557

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
            aa] {ON} similar to uniprot|P32354 Saccharomyces
            cerevisiae YIL150C MCM10 Essential chromatin-associated
            protein involved in the initiation of DNA replication
            required for the association of the MCM2-7 complex with
            replication origins
          Length = 574

 Score =  459 bits (1180), Expect = e-155
 Identities = 237/561 (42%), Positives = 362/561 (64%), Gaps = 9/561 (1%)
 Frame = +1

Query: 1    MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 180
            M+DPRE   +D ++ ++ DE+D+  + K L+ +ER+++ L +RL+     KK  DPNF  
Sbjct: 1    MEDPREPREIDIFDELSCDEDDD--LHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58

Query: 181  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANES-NLSQIQKQPELPINTTTYFMQKFQN 357
            +EVP+SP+KS+  +  + +  +  R     A+E+ N  Q+QK+  L   +T YF Q F +
Sbjct: 59   VEVPRSPSKSKHVAVKETSRSKDDRESCFPAHENLNELQVQKKASLSSISTPYFAQNFSS 118

Query: 358  AKKDEDRQIAKFESMMDARVHTFGTDN--KKYKPIIANELEGFSNLWVKKRYIPEDDLKR 531
            +KK ++ +  +   M++ RVHTF   +  ++Y PI  NE E FS  W+ KRYI  +  ++
Sbjct: 119  SKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQARK 178

Query: 532  SLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITD 711
             L E K+LRL KLFAKVRPP F  P+Y+NW T+G+IS KS +K T+  KP ++F  T+TD
Sbjct: 179  ILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLTLTD 238

Query: 712  FQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPS------GRGNFIKSFNLRIS 873
            F+HT+++Y+FG K VE+YYNL++GDIIA+LNPE+ PWRPS           IKSFNL I 
Sbjct: 239  FKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNLCIK 298

Query: 874  HDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELN 1053
            H+F  ILEIG+SRD G+C I N    K CG+PIN S+   C YH+EVQFR  +AKR+ELN
Sbjct: 299  HNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRLELN 358

Query: 1054 GGYALGAPTKVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFF 1233
            G  +L +PTK   +  LY      +++++ D  +   + + +  ++   F+N N+A+AFF
Sbjct: 359  GNKSLRSPTKNGVKHILYGKNKSGKYDLLPD--RYAPQTQSKDSQNVLYFSNPNAARAFF 416

Query: 1234 DEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTT 1413
            D+ +QNPD L NLD+KRRK+   KK K L ++L +++ +  S+  ++++  ++ ++++ T
Sbjct: 417  DDDYQNPDFLNNLDSKRRKLEVGKKEKLLQKQLQQVIGKSNSNLFKNETSTKQDEIRRAT 476

Query: 1414 ENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILA 1593
            +NAL++GLI+++GFDPT G +S VLK++     SK      K + + ++L  KKEK+ L 
Sbjct: 477  KNALESGLIKKIGFDPTSGRMSSVLKNN-----SKGLKEQAKNSAVEEILQIKKEKIELK 531

Query: 1594 PSKNEWFKKRNHREEVWQRHF 1656
            PSK    +K   REEVW  HF
Sbjct: 532  PSKEALRQKFKKREEVWNHHF 552

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
            YIL150C (DNA43) - (putative) involved in DNA replication
            [contig 159] FULL
          Length = 466

 Score =  406 bits (1044), Expect = e-136
 Identities = 206/451 (45%), Positives = 295/451 (65%), Gaps = 9/451 (1%)
 Frame = +1

Query: 340  MQKFQNAKKDEDRQIAKFESMMDARVHTFG--TDNKKYKPIIANELEGFSNLWVKKRYIP 513
            M+ F N++K E+ +I     M+D+RVHTF      K  KPI   E E  S LWV +RYI 
Sbjct: 1    MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60

Query: 514  EDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFF 693
             D+L   L +IKILRL KLF+KVRPPKF  P+YANW  VG++ HKS +K TSS KP K+F
Sbjct: 61   SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120

Query: 694  MFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGN------FIKS 855
              TITDF H+LDVY+F    VE+YYNLR+GDIIAILN ++LPWRPS  GN       +KS
Sbjct: 121  KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180

Query: 856  FNLRISHDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSA 1035
            FNL I  ++ C+LEIG+SRDLG+C I N    K CG+PIN +    CDYH+E++FR  +A
Sbjct: 181  FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240

Query: 1036 KRIELNGGYALGAPTKVNSQPSLYKAKG-ENRFNIIRDARKGLSEEEERMKKSSHNFTNS 1212
            +R+ELNG  +L +P K   + +LY + G + + N++ D  K   ++++R  +++  F+N 
Sbjct: 241  QRVELNGSMSLRSPVKNGKKQALYGSSGVKRKLNLLPD--KHAPQQQDRESQNTLYFSNP 298

Query: 1213 NSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEK 1392
            N AKAFFD+ +QNPD+L NLD+KRRK+ DT+  + L  +L++ + +       +K+  E+
Sbjct: 299  NYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSEKTKQEQ 358

Query: 1393 QKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYK 1572
            ++MKQ TE  + +GL++ +GFDPT G++  VLK     G++  N  + K   + +++  +
Sbjct: 359  KQMKQATEQTIHSGLLKNIGFDPTKGKMRDVLKV----GKNSKNSTDTKSIQVREIIETR 414

Query: 1573 KEKVILAPSKNEWFKKRNHREEVWQRHFGPK 1665
            K  V LAPSK +  K+   RE+VW+ HF  K
Sbjct: 415  KTNVSLAPSKADQKKRLLRREQVWKEHFETK 445

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  372 bits (956), Expect = e-121
 Identities = 208/587 (35%), Positives = 328/587 (55%), Gaps = 35/587 (5%)
 Frame = +1

Query: 1    MDDPREILAVDPYNSVTSDEEDE-----------------------QAIAKELEFMERKR 111
            ++DPREI+    Y+ + SDEED                          +   L+ +E +R
Sbjct: 6    LNDPREIVPTSNYD-ILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESER 64

Query: 112  QALMERLKRKQAFKKPNDPNFEAIEVPQSPTKSRVKSG--SQNAVKQVTRLETSNANESN 285
              L+ RL+  +   K        +EVP+SPTK++      + +     T +E    NE+ 
Sbjct: 65   SDLLARLEELKHRSKKKAKKSPTVEVPRSPTKAKCVEDEPAPSTSASTTYVEEPEENENE 124

Query: 286  LSQIQKQPELPINTTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTFGTDNK--KYKPII 459
               +         TT+YF +KF  A+      + + + ++  RV+TF   +   +Y    
Sbjct: 125  RYLLSANTP----TTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFA 180

Query: 460  ANELEGFSNLWVKKRYIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLI 639
             +E+E +SN+ + KRY+PE+DLKR LH+IK+LRL KLFAKVRPPKF  P+YANW T+G I
Sbjct: 181  VDEVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAI 240

Query: 640  SHKSDIKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLP 819
            S+KSD+K TS EKP K+F   ITDF + + + +FG+K VE+YY LR+GD+IAILNPE+ P
Sbjct: 241  SYKSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYP 300

Query: 820  WRPSGR------GNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINIS 981
            W+ S +          +SF L I H+  CILEIG S++LG+CP +N      CG+PIN  
Sbjct: 301  WKESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKL 360

Query: 982  LHKCCDYHREVQFRGTSAKRIELNGGYALGAPTKVNSQPSLYKAKGEN--RFNIIRDARK 1155
              + C YH+E   R  +AKR+ELNG  +L APT+   Q + Y  +  +  +  ++ D   
Sbjct: 361  KEQVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKIGLLPDVYA 420

Query: 1156 GLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELA 1335
              +   E  +K   +F ++N+ +A+FD  + NPD+L NL++KRRKI  +KK + +N++L+
Sbjct: 421  PRAPGAE--QKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLS 478

Query: 1336 KIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGES 1515
             ++ +  +   +  S+   Q+ ++ T+N ++TG+++ +GFDPT G ++ VL     G   
Sbjct: 479  LVLGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHGPAD 538

Query: 1516 KNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRHF 1656
                   ++  I+++L  KK  + L PSK    K+   R EV+   F
Sbjct: 539  -----TVREPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIF 580

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp, 577
            aa] {ON} similar to uniprot|P32354 Saccharomyces
            cerevisiae YIL150C MCM10 Essential chromatin-associated
            protein involved in the initiation of DNA replication
          Length = 577

 Score =  348 bits (893), Expect = e-112
 Identities = 202/561 (36%), Positives = 320/561 (57%), Gaps = 13/561 (2%)
 Frame = +1

Query: 1    MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 180
            + DPREI A DPY  ++ DE + + + + +  ++ +++ L  RL   +  +   DPNF++
Sbjct: 5    LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTNRLLELEKKRNLKDPNFDS 64

Query: 181  IEVPQSPTKSRVKSGSQNAVKQVTRLE-----TSNANESNLSQIQKQPELPINTTTYFMQ 345
            I+VP+SP KS   +     +K +  +      T N NE  + +  K+    + TT+YF +
Sbjct: 65   IDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVKK----LGTTSYFTE 120

Query: 346  KFQNAKKDEDRQIAKFESMMDARVHTFGTDN-KKYKPIIANELEGFSNLWVKKRYIPEDD 522
            K ++   +E   I + + ++  RV+TF  D   +Y+PI  +E +  S L + +RY+P   
Sbjct: 121  KLRSINTNEHEAIKRKKELLAHRVYTFNGDMFDEYEPITVDEKDDLSGLVIDRRYVPLAV 180

Query: 523  LKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFT 702
            L++    IK+LRL KLF+KVR PKF  P+Y NW  +G+IS K++ + T+S KPVKFF  T
Sbjct: 181  LRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLT 240

Query: 703  ITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWR--PSGRGNFIKSFNLRISH 876
            I+DFQ  L+V  FGK  VE+YY LRLGD+IAILNPE++P +   +G      +F+L++S 
Sbjct: 241  ISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFSLKVSK 300

Query: 877  DFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNG 1056
            D   ILE+G S++ G C        K CG+PIN      C YH+E + R  S++R+E++ 
Sbjct: 301  DTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEISS 360

Query: 1057 GYALGAPTKVNSQPSLYKAKGENRFNIIR---DARKGLSEEEERMKKSSHNFTNSNSAKA 1227
              A+ AP     Q ++ K++  N    IR   +  K    E    + +   F+++N++ A
Sbjct: 361  SVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNRFLFSSANASTA 420

Query: 1228 FFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQ 1407
            FFD+ ++NPD+LANLDNKRRKI + +     NR L K ++      L  K D   Q+ K+
Sbjct: 421  FFDDDYENPDILANLDNKRRKIQELRN----NRNLEKKLKGLSDKLLSKKEDRVNQEAKK 476

Query: 1408 T-TENALQTGLIQRLGFDPTHGEIS-KVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEK 1581
            T T +  Q GL  ++G+DPT G+ S ++L+ S      KN+    K+  I D+ + KK+ 
Sbjct: 477  TATLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPKND----KQLAITDICNIKKDN 532

Query: 1582 VILAPSKNEWFKKRNHREEVW 1644
            V L PSK +  +K   R  ++
Sbjct: 533  VSLKPSKKQLKEKIEKRNAIF 553

>Kpol_1026.21 s1026 complement(46606..47919) [1314 bp, 437 aa] {ON}
            complement(46606..47919) [1314 nt, 438 aa]
          Length = 437

 Score = 39.3 bits (90), Expect = 0.026
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = +1

Query: 1162 SEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANL-DNKRRKITDTKKSKALNRELAK 1338
            SEEEE+ KKSS +   S+S ++  DE   + +      D+K+RK+ ++++S+    E  +
Sbjct: 104  SEEEEKKKKSSSSSDESSSDESSSDESSSDEEEKEEAKDSKKRKLEESEESE----ESEE 159

Query: 1339 IMRRKESSGLEDKSDGE 1389
              +  + S  ED +DGE
Sbjct: 160  SEKESKKSKTEDSNDGE 176

 Score = 32.3 bits (72), Expect = 3.8
 Identities = 22/111 (19%), Positives = 50/111 (45%)
 Frame = +1

Query: 1087 NSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLA 1266
            +S  S   +  E   +    + +  SE+E++   SS +  + +S+    DEK +    + 
Sbjct: 26   SSSSSSSSSSAEESSSSSSSSSESESEDEDKSSSSSSSSESDSSSDESEDEKKEEKKEVK 85

Query: 1267 NLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTEN 1419
              + K    +D+  S + + E  K   +K+SS   D+S  ++    +++ +
Sbjct: 86   KEEKKEESSSDSSSSSSESEEEEK---KKKSSSSSDESSSDESSSDESSSD 133

>Skud_4.156 Chr4 (278886..279947) [1062 bp, 353 aa] {ON} YDL099W
           (REAL)
          Length = 353

 Score = 38.9 bits (89), Expect = 0.031
 Identities = 39/163 (23%), Positives = 71/163 (43%), Gaps = 26/163 (15%)
 Frame = +1

Query: 52  SDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNF----------------EAI 183
           S++E E   AK+LE   ++ + L ++  +K   KK  + N                 E +
Sbjct: 2   SEQEAEAKRAKQLEEARKRVEELKKKKNKKGKGKKNKNSNVTSTTASEALDLESIPGEEL 61

Query: 184 EVPQSPTKSRVKSGSQNAV-------KQVTRLETSNANESNLSQIQKQPELPINTTTYFM 342
              Q+PT   +KSG+ N +       ++  + ET +A ESN S+I+K+  +        +
Sbjct: 62  AQEQTPTADSIKSGNDNEIVEENDENEETEKKETESA-ESNDSEIKKEKVVEEGDRAATV 120

Query: 343 QKF--QNAKKDE-DRQIAKFESMMDARVHTFGTDNKKYKPIIA 462
           +K+  +NA+++E D      +      V       K+ K I A
Sbjct: 121 EKYGAENAQEEELDESTENTDDKQTIEVEKTAQSQKEKKVIQA 163

>CAGL0H05357g Chr8 complement(514513..516825) [2313 bp, 770 aa] {ON}
           similar to uniprot|P40328 Saccharomyces cerevisiae
           YPL074w YTA6
          Length = 770

 Score = 38.9 bits (89), Expect = 0.041
 Identities = 32/127 (25%), Positives = 55/127 (43%), Gaps = 15/127 (11%)
 Frame = +1

Query: 46  VTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEAIEV------------ 189
           V S  E+E+   KELE +ER+R+   ERL R++A K+  +   + +E             
Sbjct: 198 VASKLEEEELKRKELELLERERE---ERLAREKALKEQEEAKLKEMEEQERLRKEVQRQI 254

Query: 190 ---PQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 360
               +   K R +       K+V     SN  +  +S    + ++ +N  +  M    +A
Sbjct: 255 ELHKEQERKERERQEKLERQKEVELTSVSNRGKKQVSSSNDRSDIVMNRRSIDM---GSA 311

Query: 361 KKDEDRQ 381
            +D DRQ
Sbjct: 312 NRDHDRQ 318

>ZYRO0D01276g Chr4 complement(96840..98846) [2007 bp, 668 aa] {ON}
           weakly similar to uniprot|Q06604 Saccharomyces
           cerevisiae YPR171W BSP1 Adapter that links synaptojanins
           Inp2p and Inp53p to the cortical actin cytoskeleton
          Length = 668

 Score = 38.1 bits (87), Expect = 0.069
 Identities = 33/127 (25%), Positives = 56/127 (44%), Gaps = 4/127 (3%)
 Frame = +1

Query: 13  REILAVDPYNSVTSDEEDEQAIAKELEFME--RKRQALMERLKRKQAFKKPNDPNFEAIE 186
           R +   D + +  + E D  A  K+    E  +K  +L E LKR     K   P     +
Sbjct: 461 RHVDRTDSHGNKINSEADFTAKLKKTTPPEVPKKNPSLPEALKRLSNLSKAAPPPKPEED 520

Query: 187 VPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTY--FMQKFQNA 360
           VP++ TK    S +    K+   +  + A+   L+++ KQP +P    +    +QK Q  
Sbjct: 521 VPEALTKVGHLSRAAPPPKRAEDVPEALAHLEKLNKVSKQPPVPTRKISMGEALQKAQEL 580

Query: 361 KKDEDRQ 381
           KK + +Q
Sbjct: 581 KKQQQKQ 587

>TBLA0A08890 Chr1 (2183143..2185239) [2097 bp, 698 aa] {ON} Anc_4.77
           YGR145W
          Length = 698

 Score = 38.1 bits (87), Expect = 0.070
 Identities = 34/127 (26%), Positives = 59/127 (46%), Gaps = 4/127 (3%)
 Frame = +1

Query: 58  EEDEQAIAKELEFMERKRQALMERLKRKQAFK-KPNDPNFEAIEVPQSPTKSRVKSGSQN 234
           E+D++ +AK+ E +ER+R+  +E  K     K    D N + ++      K R     + 
Sbjct: 569 EKDKKRLAKQREAVERRRKERIESEKYMNKLKASRGDSNDKQLQEETFGKKVRELKKEEF 628

Query: 235 AVKQ--VTRLETSNANESNLSQIQKQPE-LPINTTTYFMQKFQNAKKDEDRQIAKFESMM 405
           A KQ   + +  ++  E+ L+ I K+ E  P N  T   Q+    K+D  R   +F+   
Sbjct: 629 AKKQDGGSTVHRNHRGEAELTFIPKKKESTPKNIRTNTEQEEGEVKRDNGRSRPRFKGRR 688

Query: 406 DARVHTF 426
            A  +TF
Sbjct: 689 SASKNTF 695

>NDAI0B06190 Chr2 (1503529..1506372) [2844 bp, 947 aa] {ON} Anc_3.547
          Length = 947

 Score = 38.1 bits (87), Expect = 0.074
 Identities = 36/125 (28%), Positives = 54/125 (43%), Gaps = 9/125 (7%)
 Frame = +1

Query: 1000 YHREVQFRGTSAKRIELNGGY-ALGAPTKVNSQPSLYKAKGENRFNIIRDARKGLSEEEE 1176
            Y R +  + T+ K+ ELNG +  L      N++P+    K + +FN         + E+E
Sbjct: 548  YKRNLYLQSTNDKKHELNGAFNELTLNDNNNNEPAKKIMKNDTKFNANDSINNHNNNEKE 607

Query: 1177 RMKKSSHNFTNSN----SAKAFFDEKFQNPDMLANLDNKRRK---ITDTKKSKAL-NREL 1332
                + H  TN N          DE F+ P +  N + K RK   I D  K     N+ L
Sbjct: 608  ETSTNEHINTNQNIFAIDDVEEVDESFEIPYVGINQNEKLRKNPTIGDLFKINLYDNQIL 667

Query: 1333 AKIMR 1347
             KIM+
Sbjct: 668  TKIMK 672

>Kpol_1052.26 s1052 complement(86331..87275) [945 bp, 314 aa] {ON}
            complement(86331..87275) [945 nt, 315 aa]
          Length = 314

 Score = 37.4 bits (85), Expect = 0.088
 Identities = 34/136 (25%), Positives = 57/136 (41%)
 Frame = +1

Query: 1081 KVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDM 1260
            K+NS       K  NR  I+ + +    E +E+ KK  + F+N N      DE    P+M
Sbjct: 27   KINSMKG--NMKKSNRKQIMDNCKNLQFELDEKHKKELNRFSNGNDGIENEDEDEITPEM 84

Query: 1261 LANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLI 1440
            L    +   K  D  KS  L+        RK  +  +++    +QK+++  E A +    
Sbjct: 85   LLAQLSIETKQQDESKSDTLSSTANTNQPRKSRNRQKERLAKRQQKIEKIKEEAREEAAN 144

Query: 1441 QRLGFDPTHGEISKVL 1488
            Q     P + EI + +
Sbjct: 145  Q-----PNYQEIEQTV 155

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1119

 Score = 37.7 bits (86), Expect = 0.10
 Identities = 33/147 (22%), Positives = 60/147 (40%)
 Frame = +1

Query: 34  PYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEAIEVPQSPTKSR 213
           PY  +    E  Q    + E  +R  + LM+  K     K   + N   I   +   ++ 
Sbjct: 298 PYVMIKDHREKLQKFKGDYEIAKRNLRDLMKDKKPFVKTKLEIEENLNEIAEDKRTNETA 357

Query: 214 VKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNAKKDEDRQIAKF 393
           ++S      K V  L   NA   ++ + Q Q     + T    Q+  + K + +RQ + F
Sbjct: 358 LESSKDALSKTVENL---NAIRESIVKKQSQISYYQSRTKKLQQQILSTKSELERQQSLF 414

Query: 394 ESMMDARVHTFGTDNKKYKPIIANELE 474
           +SM    +  F   +KK + +I  +L+
Sbjct: 415 DSMTPPEISLFDEFDKKREELINEDLK 441

>TBLA0A00800 Chr1 complement(174131..175567) [1437 bp, 478 aa] {ON}
            Anc_2.636 YKL082C
          Length = 478

 Score = 36.6 bits (83), Expect = 0.19
 Identities = 36/182 (19%), Positives = 79/182 (43%)
 Frame = +1

Query: 1120 ENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITD 1299
            EN  + +++ ++ L+   ++  K + N  +       FD+  +    L  +  K    T+
Sbjct: 266  ENNEDFVKNKKQKLNNSNKKENKYNINTDDLMFQNIMFDDGDKATSDLQRI-RKSTFSTN 324

Query: 1300 TKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEIS 1479
            TKKS     ++   ++  ES   + +++ E  ++K   +   Q  ++Q  G      E  
Sbjct: 325  TKKSGPSKNDIKAHLKLLESKKSKVENNDELTQIKIKEKEKWQRAMLQAEGHKLKDDE-- 382

Query: 1480 KVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRHFG 1659
            K+LK ++   E+K              + +K+ K ++  +KNE  K+R    ++ + + G
Sbjct: 383  KLLKKALKRKEAKKR---------KSAVEWKERKQLVETNKNERAKRREENLQIRKDNKG 433

Query: 1660 PK 1665
             K
Sbjct: 434  KK 435

>Kwal_27.10353 s27 complement(298957..299631) [675 bp, 224 aa] {ON}
            YMR269W - protein possibly involved in protein synthesis
            [contig 36] FULL
          Length = 224

 Score = 35.8 bits (81), Expect = 0.20
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 5/107 (4%)
 Frame = +1

Query: 1114 KGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKI 1293
            KG    N     ++ L E++E+ KKS      S   K+   EK +      +   ++ K 
Sbjct: 102  KGTIEINEESKLKRSLEEDDEQ-KKSRKKLKKSTKDKSHSKEKSKERSKEKSKKKEKSKS 160

Query: 1294 TD-TKKSKALNRELAKIMRRKESSGLED----KSDGEKQKMKQTTEN 1419
               +KK  + N+E +K+ R+K  +G  D    K+  +K K K+ + N
Sbjct: 161  KGKSKKDSSKNKEESKLKRKKSETGKSDEKKAKTTKKKHKSKKESSN 207

>KLTH0H10758g Chr8 complement(927171..928358) [1188 bp, 395 aa] {ON}
           similar to uniprot|P38344 Saccharomyces cerevisiae
           YBR267W REI1 Protein of unknown function involved in bud
           growth in the mitotic signaling network proposed
           negative regulator of Swe1p and Gin4p contains dispersed
           C2H2 zinc finger domains
          Length = 395

 Score = 36.2 bits (82), Expect = 0.23
 Identities = 29/133 (21%), Positives = 60/133 (45%), Gaps = 4/133 (3%)
 Frame = +1

Query: 61  EDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEAIEVPQSPTKSRVKSGSQNAV 240
           E E  +AK+   +E+ R++++  ++++      + P+ +A+E PQ       K G Q A 
Sbjct: 76  EKEALLAKKKALLEQARESILNNMQKEGNEASESGPSEQAVEAPQ-------KEGEQEAS 128

Query: 241 KQVTRLETSNANESNLSQ--IQKQPELPINTTTYFMQKFQNAKKDEDRQIAKFESMMD-- 408
           +      T +     L Q  ++ + ++P+N   +  +K         R+ A  +S +D  
Sbjct: 129 EAPDSTLTPDQLAEQLMQQKLENKVDIPLNVCLFCTRK---------REFADLDSNLDHM 179

Query: 409 ARVHTFGTDNKKY 447
            + H F    +KY
Sbjct: 180 FKNHGFYIPEQKY 192

>KAFR0A07410 Chr1 (1496247..1497308) [1062 bp, 353 aa] {ON} Anc_2.91
            YNL164C
          Length = 353

 Score = 35.8 bits (81), Expect = 0.29
 Identities = 24/82 (29%), Positives = 41/82 (50%)
 Frame = +1

Query: 1189 SSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGL 1368
            S++   +S SA AFFDE+F +P++                   +N E A+I+   ES  +
Sbjct: 106  SANILIDSKSAGAFFDEEFPDPEL------------------HINGEEAEIIFDYESHDM 147

Query: 1369 EDKSDGEKQKMKQTTENALQTG 1434
            ED ++G  +K+ +  E+ L  G
Sbjct: 148  EDPTEGIGRKISEMIESVLPGG 169

>Smik_15.385 Chr15 complement(668338..669750) [1413 bp, 470 aa] {ON}
            YOR198C (REAL)
          Length = 470

 Score = 35.8 bits (81), Expect = 0.33
 Identities = 41/187 (21%), Positives = 85/187 (45%), Gaps = 13/187 (6%)
 Frame = +1

Query: 1114 KGENRFNIIRDARKGLSEEEERM--------KKSSHNFTNSNSAKAFFDEKFQNPDMLAN 1269
            + + + N I    +G+ ++ + +        KK    ++     +A FD +F++    A 
Sbjct: 188  ENQQKLNDIHSKTQGVYDKRQTLFNKRTALYKKRDELYSQIRQIRADFDNEFKS--FRAK 245

Query: 1270 LDNKRRKITDTKKSKALNRELAKIMRRKE--SSGLEDKSDGEKQKMKQTTENALQTGLIQ 1443
            LD +R K  + +K       L+K++ +K+     L++K    K         A++  L  
Sbjct: 246  LDKERLKREEEQK-------LSKLLEQKDVDMGKLQEKLTHAKIPAFTYEIGAIENSL-- 296

Query: 1444 RLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEK---VILAPSKNEWF 1614
             L  DPT+ +  K + + +     +      +K V +DL+    +K   V +APSK++ +
Sbjct: 297  -LVLDPTYVKPKKNILADLSDNVMETK--PARKVVADDLVLVTPKKDDFVNVAPSKSKKY 353

Query: 1615 KKRNHRE 1635
            KK+N ++
Sbjct: 354  KKKNQQK 360

>Suva_8.254 Chr8 complement(457591..459003) [1413 bp, 470 aa] {ON}
            YOR198C (REAL)
          Length = 470

 Score = 35.4 bits (80), Expect = 0.43
 Identities = 43/187 (22%), Positives = 83/187 (44%), Gaps = 13/187 (6%)
 Frame = +1

Query: 1114 KGENRFNIIRDARKGLSEEEERM--------KKSSHNFTNSNSAKAFFDEKFQNPDMLAN 1269
            + + + N I    +G+ ++ + +        KK    +T     +A FD +F++    A 
Sbjct: 188  QNQEKLNDIHSKTQGVYDKRQNLFNKRTALYKKRDELYTQIRQIRADFDNEFKS--FRAK 245

Query: 1270 LDNKRRKITDTKKSKALNRELAKIMRRKE--SSGLEDKSDGEKQKMKQTTENALQTGLIQ 1443
            LD +R K  +  K       L+K++ +K+     L++K    K         A++  L  
Sbjct: 246  LDKERLKREEEHK-------LSKLLEQKDVDMGKLQEKLTHAKIAAFTYEIGAIENSL-- 296

Query: 1444 RLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEK---VILAPSKNEWF 1614
             L  DPT+ +  K + + +   E        +K V +DL+    +K   V +APSK++  
Sbjct: 297  -LVLDPTYVKPKKNILADL--NEPVLETKPARKVVADDLVLVTPKKDDFVNVAPSKSKKH 353

Query: 1615 KKRNHRE 1635
            KK+N ++
Sbjct: 354  KKKNQQK 360

>ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {ON}
            some similarities with uniprot|Q22X91 Tetrahymena
            thermophila SB210 TTHERM_00561660 Viral A-type inclusion
            protein repeat containing protein
          Length = 698

 Score = 35.4 bits (80), Expect = 0.48
 Identities = 23/63 (36%), Positives = 35/63 (55%)
 Frame = +1

Query: 1144 DARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALN 1323
            +AR   S+ E R   + +N   SNSAKA      +  DML +L N RR +  T+ S++LN
Sbjct: 640  NARMNASDHENRCTAADYNGLTSNSAKA----PLRKRDMLRSLAN-RRTVLVTEPSQSLN 694

Query: 1324 REL 1332
            + +
Sbjct: 695  KNI 697

>Skud_15.365 Chr15 complement(657763..659175) [1413 bp, 470 aa] {ON}
            YOR198C (REAL)
          Length = 470

 Score = 35.0 bits (79), Expect = 0.57
 Identities = 41/185 (22%), Positives = 84/185 (45%), Gaps = 13/185 (7%)
 Frame = +1

Query: 1120 ENRFNIIRDARKGLSEEEERM--------KKSSHNFTNSNSAKAFFDEKFQNPDMLANLD 1275
            + + N I    +G+ ++ + +        KK    ++     +A FD +F++    A LD
Sbjct: 190  QQKLNNIHSKTQGVYDKRQTLFNKRTALYKKRDELYSQIRQIRADFDNEFKS--FKAKLD 247

Query: 1276 NKRRKITDTKKSKALNRELAKIMRRKE--SSGLEDKSDGEKQKMKQTTENALQTGLIQRL 1449
             +R K  +  K       L+K++ +K+     L++K    K         A++  L   L
Sbjct: 248  KERLKREEDHK-------LSKLLEQKDVDMGKLQEKLTHAKIPAFTYEIGAIENSL---L 297

Query: 1450 GFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEK---VILAPSKNEWFKK 1620
              DPT+ +  K + + +   ++       +K V +DL+    +K   V +APSK++ +KK
Sbjct: 298  VLDPTYVKPKKNILAEL--SDTALETKPARKVVADDLVLVSPKKDDFVNVAPSKSKKYKK 355

Query: 1621 RNHRE 1635
            +N ++
Sbjct: 356  KNQQK 360

>YOR198C Chr15 complement(718653..720065) [1413 bp, 470 aa] {ON}
            BFR1Component of mRNP complexes associated with
            polyribosomes; implicated in secretion and nuclear
            segregation; multicopy suppressor of BFA (Brefeldin A)
            sensitivity
          Length = 470

 Score = 35.0 bits (79), Expect = 0.57
 Identities = 45/190 (23%), Positives = 88/190 (46%), Gaps = 16/190 (8%)
 Frame = +1

Query: 1114 KGENRFNIIRDARKGLSEEEERM--------KKSSHNFTNSNSAKAFFDEKFQNPDMLAN 1269
            + + + N I    +G+ ++ + +        KK    ++     +A FD +F++    A 
Sbjct: 188  ENQQKLNDIHSKTQGVYDKRQTLFNKRAALYKKRDELYSQIRQIRADFDNEFKS--FRAK 245

Query: 1270 LDNKRRKITDTKKSKALNRELAKIMRRKE--SSGLEDKSDGEKQKMKQTTENALQTGLIQ 1443
            LD +R K  + ++       L+K++ +K+     L++K    K         A++  L  
Sbjct: 246  LDKERLKREEEQR-------LSKLLEQKDVDMGKLQEKLTHAKIPAFTYEIGAIENSL-- 296

Query: 1444 RLGFDPTHGEISKVLKSSVPGGESKNNLLNGK---KTVINDLLHYKKEK---VILAPSKN 1605
             L  DPT+    K  K+ +P  +  +N L  K   K V +DL+    +K   V +APSK+
Sbjct: 297  -LVLDPTY---VKPKKNILP--DLSSNALETKPARKVVADDLVLVTPKKDDFVNVAPSKS 350

Query: 1606 EWFKKRNHRE 1635
            + +KK+N ++
Sbjct: 351  KKYKKKNQQK 360

>Skud_14.208 Chr14 (383074..384528) [1455 bp, 484 aa] {ON} YNL124W
           (REAL)
          Length = 484

 Score = 35.0 bits (79), Expect = 0.57
 Identities = 36/136 (26%), Positives = 58/136 (42%), Gaps = 25/136 (18%)
 Frame = +1

Query: 13  REILAVDPYNSVTSD-EEDEQAIA---KELEFMERKRQALMERLKRKQAFKKPNDPNFEA 180
           R I   D  N    +  E+EQ  +   KE  F + K+Q   ++ K++   K+PND +   
Sbjct: 220 RRIKGTDASNGYDEELPEEEQEFSDDEKEALFKKMKKQQQQQQRKKRDNRKQPNDSDNVK 279

Query: 181 IEVPQSPTKSRVK------SGSQNA----------VKQVTRLETSNANESNLS-QI---- 297
            + P+ P  + +         S NA           ++ T+ ET    + N S QI    
Sbjct: 280 SKKPRQPKPANLPKLVPPVGMSSNASLQRGYKSRNARENTKRETGTVFDQNRSLQIPMGQ 339

Query: 298 QKQPELPINTTTYFMQ 345
           Q+QP+ P N   Y +Q
Sbjct: 340 QQQPQFPANNYPYQLQ 355

>NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6.51
            YOR168W
          Length = 814

 Score = 35.0 bits (79), Expect = 0.65
 Identities = 35/152 (23%), Positives = 70/152 (46%), Gaps = 18/152 (11%)
 Frame = +1

Query: 1021 RGTSAKRIELNGGYALGAPTKVNSQPSL----YKAKGENRFNIIRDARKGLS--EEEERM 1182
            +G+S  + EL     +    K N Q S      KAKG +   +  +   G+     ++ +
Sbjct: 66   KGSSLDKSELIVNGIINEDLKTNLQISAAFKYIKAKGTDATQVEMNENSGVGIVVTDDDV 125

Query: 1183 KKSSHNFTNSNSAKAFFDEKFQN-PDMLANLDN-KRRKITDTKKSKAL-NRELAKIM--- 1344
            +KS  N+   N  +A  +++++  P + AN+ N    K  D +  K + + E+ K++   
Sbjct: 126  RKSVQNYIEENK-EAILEQRYKLVPGLFANIKNLPELKWADPRSFKPIIDEEILKVLGPK 184

Query: 1345 ------RRKESSGLEDKSDGEKQKMKQTTENA 1422
                  ++K +     K+D +K+  K+T +NA
Sbjct: 185  DERDLVKKKPTKDSTKKNDNKKKVSKETNKNA 216

>TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1086

 Score = 35.0 bits (79), Expect = 0.67
 Identities = 38/152 (25%), Positives = 64/152 (42%), Gaps = 12/152 (7%)
 Frame = +1

Query: 4    DDPREILAVDPYNSV----TSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPN 171
            D+ R+ILAV   + V    +SD  D Q   ++ + +   R AL     RKQ  K     +
Sbjct: 801  DEDRDILAVKSTSPVDFMSSSDGFDIQNQIQQKKTVTSLRPALNVTSSRKQTRKYDVKSD 860

Query: 172  FEAIEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQK- 348
               + + Q P +S      Q+   Q  +++ +N  + N    Q    +P NTTTY  Q+ 
Sbjct: 861  TRPVPLKQKPQESLNYQVKQSQQIQHQQIQLNNNYQHNQ---QYYDTVPDNTTTYTSQEN 917

Query: 349  -------FQNAKKDEDRQIAKFESMMDARVHT 423
                   F N   ++   I +  +   + +HT
Sbjct: 918  LNSLTSNFSNNSNNQKDNITQNNNKGRSAIHT 949

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar to
            Ashbya gossypii AEL337
          Length = 1097

 Score = 35.0 bits (79), Expect = 0.68
 Identities = 35/159 (22%), Positives = 66/159 (41%), Gaps = 2/159 (1%)
 Frame = +1

Query: 1114 KGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKI 1293
            K +  F +  +  + LS+E E +KK      NS         K  +  ++  L N+R  I
Sbjct: 305  KDKKPFKVASEKLQLLSDESEGLKKIKEEEYNSL--------KTNHKKLIETLSNQRISI 356

Query: 1294 TDTKKSKALNRELAKIMRRKESSGLEDKSDGEK--QKMKQTTENALQTGLIQRLGFDPTH 1467
             D KK  +  R   + MRRK     +D S   K  + +   ++  +     +R+      
Sbjct: 357  QDLKKKISYYRSRRENMRRKVEMAEQDISSRNKLLETLMLPSQEVMDDYERRRVQLYEKE 416

Query: 1468 GEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKV 1584
             +I + ++   P   +    LN + TVI   +  +K+++
Sbjct: 417  SDIERKIEEFEPQARA----LNRELTVIRSRIEKRKKEL 451

>YNL005C Chr14 complement(621313..622428) [1116 bp, 371 aa] {ON}
            MRP7Mitochondrial ribosomal protein of the large subunit
          Length = 371

 Score = 34.7 bits (78), Expect = 0.68
 Identities = 46/200 (23%), Positives = 87/200 (43%), Gaps = 5/200 (2%)
 Frame = +1

Query: 1036 KRIELNGGYALGAPTKVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSN 1215
            K IEL   Y +     + +   +  A+  +R+ +         +EEER+K    ++TN  
Sbjct: 189  KDIELATSYLIRVRASLKNGYPIEDARFNSRYYL---------KEEERLKARRESWTNEK 239

Query: 1216 SAKAF--FDEKFQNPDMLANLDNKRR--KITDTKKSKALNRELAKIMRRKESSGLEDKSD 1383
             +++    DE     +   + +NK    +    ++ +AL  +L + + +  S  LE K D
Sbjct: 240  LSESLSKIDECSDLLNSSTSFNNKLELHQYISEQEKQALKAKLLEDLEK--SQHLETKKD 297

Query: 1384 GEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLL 1563
              K  +K   ++A     +     +  H    K LKS  P  +S     +GKK++++   
Sbjct: 298  --KNYIKALFKDACNFLTLS----EEVHLR-RKYLKSVFPETDSTVETKSGKKSIVSRRF 350

Query: 1564 HYKKEKV-ILAPSKNEWFKK 1620
             Y K KV ++A S+  +  K
Sbjct: 351  DYTKNKVEVIARSRRAFLSK 370

>Skud_4.330 Chr4 (573869..575077) [1209 bp, 402 aa] {ON} YDR076W
           (REAL)
          Length = 402

 Score = 34.7 bits (78), Expect = 0.71
 Identities = 42/172 (24%), Positives = 79/172 (45%), Gaps = 8/172 (4%)
 Frame = +1

Query: 184 EVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNAK 363
           E+   P   +   G Q   K +  ++ S AN+  +  I+   ++PIN       +F   K
Sbjct: 40  EIFGPPGIGKTNFGLQLVSKLLEAMQQSEANDDRILWIEAFQDMPINILRERFPEFDIVK 99

Query: 364 KDEDR-QIAKFESMMDARVHTFG-TDNKKYKPIIANELEGFSNL------WVKKRYIPED 519
           ++  R +I KF  ++    + F  + + KYK II   ++GFS L       + KR     
Sbjct: 100 ENLKRVRITKFGQLLYFFQNLFKLSQSMKYKLII---IDGFSQLVCDHLCTLSKR--SGG 154

Query: 520 DLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSE 675
            L +++HE+K   L  +F  +   K+    ++  +T+ L++   +  F S+E
Sbjct: 155 TLDKTIHELKCRHLILIFTAM--TKY---THSTGSTIILLNDCMNTAFQSNE 201

>Suva_16.164 Chr16 complement(285371..286729) [1359 bp, 452 aa] {ON}
            YPL146C (REAL)
          Length = 452

 Score = 34.7 bits (78), Expect = 0.74
 Identities = 35/114 (30%), Positives = 49/114 (42%), Gaps = 16/114 (14%)
 Frame = +1

Query: 1072 APTKVNSQPSLYK---AKGENRFNIIRDARKGLSEEEERM-KKSSHNFTNSNS------A 1221
            APT V  +PS YK    KG+  +    D    +SE E+ M KK  H  T+  S       
Sbjct: 2    APTNVTKKPSQYKQSSRKGKKAWRKNID----ISEVEQYMEKKIDHEVTHGTSDMTSLQN 57

Query: 1222 KAFFDEKFQNPDMLANLDNKRRKITDTKKSKAL------NRELAKIMRRKESSG 1365
             A F    +  D+L     KR +I  + KSK +      N ++A +   K  SG
Sbjct: 58   DALFQVDVEGDDILKKKLIKRNQIKKSLKSKEILDAVKTNSKIAALKHHKSGSG 111

>Suva_13.205 Chr13 complement(332274..333947) [1674 bp, 557 aa] {ON}
           YMR036C (REAL)
          Length = 557

 Score = 34.7 bits (78), Expect = 0.79
 Identities = 23/101 (22%), Positives = 44/101 (43%)
 Frame = +1

Query: 55  DEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEAIEVPQSPTKSRVKSGSQN 234
           DEE++  I   + F  +  Q+      R+       +     I+ P+SP +S   S S++
Sbjct: 95  DEEEDDDIVLNMHFASQSLQSPTRNSSRRSLTNTKENDLLNRIKYPRSPQRSSSFSRSRS 154

Query: 235 AVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQN 357
             ++ +   T+N+++    Q  K P     ++  F Q  QN
Sbjct: 155 LSRRTSMNSTNNSSKRVQRQDGKIPRSSRKSSQRFSQVSQN 195

>TPHA0B00450 Chr2 complement(98591..100288) [1698 bp, 565 aa] {ON}
            Anc_4.339 YML071C
          Length = 565

 Score = 34.7 bits (78), Expect = 0.79
 Identities = 40/133 (30%), Positives = 58/133 (43%), Gaps = 16/133 (12%)
 Frame = +1

Query: 1174 ERMKKSSHNFTNSNSAKAFFDEKFQN-PDMLANLDNKRRKITDTKKSKALNRELAK---- 1338
            E+++K S    NSN  K  F     N P +L NLDN    ITD  +   L R   K    
Sbjct: 156  EKLRKRS--MLNSNYDK--FGNNLNNLPLVLENLDN----ITDLMELPFLVRTCIKTGHY 207

Query: 1339 ---IMRRKESSGLEDKSDGEK------QKMKQTTENALQTGLIQRLGFDPTHGEISKVLK 1491
               IM    S  L+ K  G        +K+       + TGL++ L  + T   + K+LK
Sbjct: 208  QEAIMLFTHSKSLQSKFAGSSIIDDICEKVLNEISTTMLTGLVKLLATNVTVNSLKKILK 267

Query: 1492 --SSVPGGESKNN 1524
              S++P  + K+N
Sbjct: 268  YLSAIPPFDEKDN 280

>YNL167C Chr14 complement(319416..321359) [1944 bp, 647 aa] {ON}
           SKO1Basic leucine zipper transcription factor of the
           ATF/CREB family; forms a complex with Tup1p and Cyc8p to
           both activate and repress transcription; cytosolic and
           nuclear protein involved in osmotic and oxidative stress
           responses
          Length = 647

 Score = 34.7 bits (78), Expect = 0.81
 Identities = 42/169 (24%), Positives = 70/169 (41%), Gaps = 26/169 (15%)
 Frame = +1

Query: 40  NSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAF--KKPNDPNFEAIE--------- 186
           N+VT DE +EQ   K  EF+ER R A  +  KRK+ +  K  ND  F   E         
Sbjct: 418 NNVTLDENEEQE-RKRKEFLERNRVAASKFRKRKKEYIKKIENDLQFYESEYDDLTQVIG 476

Query: 187 -----VPQSPTKSRV-------KSGSQNAVKQVTRLET--SNANESNLSQIQKQPELPIN 324
                +P S + S+         S S  +   +  LE+  S ++ S+   +    +  I 
Sbjct: 477 KLCGIIPSSSSNSQFNVNVSTPSSSSPPSTSLIALLESSISRSDYSSAMSVLSNMKQLIC 536

Query: 325 TTTYFMQKFQNAKKDEDRQIAKFESMMD-ARVHTFGTDNKKYKPIIANE 468
            T ++ +  +N + D D Q   F    +  +    G  +   +PII ++
Sbjct: 537 ETNFYRRGGKNPRDDMDGQEDSFNKDTNVVKSENAGYPSVNSRPIILDK 585

>Suva_14.249 Chr14 (451061..454795) [3735 bp, 1244 aa] {ON} YNL091W
           (REAL)
          Length = 1244

 Score = 34.7 bits (78), Expect = 0.90
 Identities = 27/108 (25%), Positives = 51/108 (47%)
 Frame = +1

Query: 58  EEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEAIEVPQSPTKSRVKSGSQNA 237
           EE+++ + KELE  E KR+   +R K ++A ++ ++     +E  Q   + + K   Q  
Sbjct: 675 EEEQERLKKELEEREMKRRE-AQRKKVEEAKRRKDEERKRRLEEQQRREEMQEKQRKQ-- 731

Query: 238 VKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNAKKDEDRQ 381
                + E     E    +I+++  L         +K QN K++E+RQ
Sbjct: 732 -----KEEQKRKREEEKKRIREEKRLE-------QEKLQNEKEEEERQ 767

>Suva_8.269 Chr8 complement(486474..487931) [1458 bp, 485 aa] {ON}
           YOR216C (REAL)
          Length = 485

 Score = 34.3 bits (77), Expect = 0.99
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 7/99 (7%)
 Frame = +1

Query: 121 MERLKRKQAFKKPNDPNFEAI-------EVPQSPTKSRVKSGSQNAVKQVTRLETSNANE 279
           M + K+K   K  N P+ EA+       EV  +P K    + +  A+  +  LE + A E
Sbjct: 1   MGKNKKKTGKKAKNQPHVEAVDETTNEHEVVINPAKDNATTETPKAIDALEVLEKAEAKE 60

Query: 280 SNLSQIQKQPELPINTTTYFMQKFQNAKKDEDRQIAKFE 396
              S+   Q E+  +  T  +   ++ K DE+ +  K E
Sbjct: 61  EEHSEEINQQEVCADMVTEKVIPLEDRKTDEEIKALKEE 99

>Kpol_1048.16 s1048 (53728..55245) [1518 bp, 505 aa] {ON}
           (53728..55245) [1518 nt, 506 aa]
          Length = 505

 Score = 34.3 bits (77), Expect = 1.0
 Identities = 24/111 (21%), Positives = 54/111 (48%), Gaps = 1/111 (0%)
 Frame = +1

Query: 52  SDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEAIE-VPQSPTKSRVKSGS 228
           S+  DE+   +E EF + +++++ +++K+KQ   K +  + +  E V     K  +K+ S
Sbjct: 236 SNGYDEELPEEEQEFSDDEKESMFKKMKKKQKKNKNSTRSSDNSENVTNRVHKQPLKNNS 295

Query: 229 QNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNAKKDEDRQ 381
            + +KQ   ++  N    +  + + Q +   + TT   +  Q+     +RQ
Sbjct: 296 THKIKQYPSMKFPNETPQSSYRSRDQRQQVNSNTTNKSRPVQSESNSYNRQ 346

>KAFR0G00140 Chr7 (40399..42177) [1779 bp, 592 aa] {ON} Anc_6.190
            YPL189W
          Length = 592

 Score = 34.3 bits (77), Expect = 1.1
 Identities = 18/46 (39%), Positives = 28/46 (60%)
 Frame = +1

Query: 1255 DMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEK 1392
            D L NLDN+RRK+T T+ +  L+  +AK   R+E     ++S  +K
Sbjct: 239  DYLENLDNRRRKVTTTRTAYGLDTHVAK---RREKWSRNNRSASKK 281

>Kpol_1002.28 s1002 complement(85813..87801) [1989 bp, 662 aa] {ON}
           complement(85813..87801) [1989 nt, 663 aa]
          Length = 662

 Score = 34.3 bits (77), Expect = 1.1
 Identities = 25/93 (26%), Positives = 42/93 (45%)
 Frame = +1

Query: 49  TSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEAIEVPQSPTKSRVKSGS 228
           +S    E +++K  EFM  K++   +  K K  F +PN   F       +PTK  V S +
Sbjct: 284 SSGNLSEDSVSKRFEFMLNKKKDSSQTKKTKTNFIQPNSVKF-------NPTKKSVDSNN 336

Query: 229 QNAVKQVTRLETSNANESNLSQIQKQPELPINT 327
           Q  +K     +++   ++N   I+    L  NT
Sbjct: 337 Q--IKSGIASDSNKIEKTNTKSIETDLYLLNNT 367

>KAFR0H01340 Chr8 (252802..253443) [642 bp, 213 aa] {ON} Anc_3.291
            YBR072W
          Length = 213

 Score = 33.5 bits (75), Expect = 1.1
 Identities = 29/129 (22%), Positives = 53/129 (41%)
 Frame = +1

Query: 1195 HNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLED 1374
            +NF +S + +  +  +  +PD       +RR +TD  +++ LN +L +    +      D
Sbjct: 7    YNFFDSINNEVQYFNRLLDPDFRPYRQGQRRTLTDRDQNEDLNSQLVRRDEYQRPRLFND 66

Query: 1375 KSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVIN 1554
             +D     +     N L++        D    + +  LK +VPG + K N+         
Sbjct: 67   LNDWFNNDLSLFPVNNLRSSATLAPPVDILDHDKNYELKVTVPGVKGKENI--------- 117

Query: 1555 DLLHYKKEK 1581
              L Y KEK
Sbjct: 118  -NLEYHKEK 125

>CAGL0E03245g Chr5 complement(299473..300750) [1278 bp, 425 aa] {ON}
            similar to uniprot|P27476 Saccharomyces cerevisiae
            YGR159c NSR1 nuclear localization sequence binding
            protein
          Length = 425

 Score = 33.9 bits (76), Expect = 1.3
 Identities = 22/82 (26%), Positives = 44/82 (53%)
 Frame = +1

Query: 1144 DARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALN 1323
            D+     E +E  K+SS + ++S+S+ +  D +  +    ++ + + ++  D+KK KA +
Sbjct: 100  DSESDSEESKEDKKESSDSESSSSSSSSSSDSESDSDSSSSDEEEEAKEEKDSKKRKAED 159

Query: 1324 RELAKIMRRKESSGLEDKSDGE 1389
             E       +ESS  + K+DGE
Sbjct: 160  EE-------EESSPKKAKTDGE 174

>Ecym_6410 Chr6 (795710..797173) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii AFR025C
          Length = 487

 Score = 33.9 bits (76), Expect = 1.3
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 2/89 (2%)
 Frame = +1

Query: 55  DEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEAIEVPQSPTKSRV-KSGSQ 231
           DEE+E+   K  EF+ER R A  +  KRK+ + K  + + +  E   S   S V +    
Sbjct: 310 DEEEEERERKRKEFLERNRLAASKFRKRKKEYIKKIETDLQFYETEYSDLTSFVDRLSGL 369

Query: 232 NAVKQVTRLETSNANESN-LSQIQKQPEL 315
           N   + T L+ S+ +    L Q   +P+L
Sbjct: 370 NGNSKSTDLQNSDLSLLKLLKQSLMRPDL 398

>SAKL0A04356g Chr1 complement(405004..406539) [1536 bp, 511 aa] {ON}
           similar to gnl|GLV|YALI0C05643g Yarrowia lipolytica
           YALI0C05643g and some similarites with YGL066W
           uniprot|P53165 Saccharomyces cerevisiae YGL066W SGF73
           SaGa associated Factor 73kDa Probable 73KkDa Subunit of
           SAGA histone acetyltransferase complex
          Length = 511

 Score = 33.9 bits (76), Expect = 1.3
 Identities = 26/93 (27%), Positives = 43/93 (46%), Gaps = 2/93 (2%)
 Frame = +1

Query: 46  VTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEAIEVPQSPTKSRVKSG 225
           V  +EE+E+ IA+E+  M  K++A       K+      DP+ E      +PT  + +  
Sbjct: 112 VDGEEEEEEEIAEEMSNMNTKKKAT----NSKRGTPSDADPSLEG-----TPTIKKQRKS 162

Query: 226 SQNAVKQVTRLETSNANESNLSQIQKQ--PELP 318
           +  A K+  + +  N  E +L    KQ   ELP
Sbjct: 163 TTPAPKKQRKSKPRNPTEKHLVDFDKQCGVELP 195

>Skud_10.46 Chr10 complement(76968..79172) [2205 bp, 734 aa] {ON}
           YJL168C (REAL)
          Length = 734

 Score = 33.9 bits (76), Expect = 1.4
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 6/90 (6%)
 Frame = +1

Query: 31  DPYNSVTSDEEDEQAIAKELEF----MERKRQALMERLKRKQAFKKPNDPNFEAIEVPQS 198
           DP     SDEE E+   K LE+    +ER +Q  +E LK+K   +       E I    +
Sbjct: 537 DPKKHKLSDEEYERKKQKRLEYERIALERAKQEELESLKQKLKLENERKIVLEDIIAEAN 596

Query: 199 PTKSRVKSGSQNAV--KQVTRLETSNANES 282
             K   K  ++  V  K+  RL+  N ++S
Sbjct: 597 KQKELQKEEAKKLVEAKEAKRLKRRNVSQS 626

>KLLA0C10879g Chr3 (936212..938479) [2268 bp, 755 aa] {ON} weakly
            similar to uniprot|P31111 Saccharomyces cerevisiae
            YDR285W ZIP1 Synaptonemal complex (SC) protein that
            connects homologous chromosomes partially during zygotene
            and entirely during pachytene potential Cdc28p substrate
            synaptonemal complex protein
          Length = 755

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 40/168 (23%), Positives = 74/168 (44%), Gaps = 8/168 (4%)
 Frame = +1

Query: 1159 LSEEEERMKKSSHNFTNSNSA--KAFFDEKFQNPDMLANLDNKRRKITDTKK--SKALNR 1326
            LS++   ++    + T SN A  +     K +N + + +LD+K    T+      K +N 
Sbjct: 495  LSDKNAILQTEFSSITVSNEAYVREITRIKKENEEAITSLDSKLTAQTEISSILQKDMND 554

Query: 1327 ELAKI--MRRKESSGL-EDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSS 1497
               +I  +++K +  L E+ S   K +  Q   + +   L+Q    +   GEI++ L+  
Sbjct: 555  TKKEIDSLKKKHTQALDENNSIKHKYENLQQQFHKINVELVQSKAKELEFGEINRNLREQ 614

Query: 1498 VPGGESKNNLLNGKKTVINDLLH-YKKEKVILAPSKNEWFKKRNHREE 1638
                ES +N  +     +ND +H  +KEK  L   K +   K    E+
Sbjct: 615  FEELESASNHTSNSFKRVNDKVHALEKEKSALNLEKLDLMDKIEELED 662

>Suva_11.119 Chr11 complement(225373..228735) [3363 bp, 1120 aa]
           {ON} YKL105C (REAL)
          Length = 1120

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 27/111 (24%), Positives = 52/111 (46%), Gaps = 1/111 (0%)
 Frame = +1

Query: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPND-PNFE 177
           +++ R +  ++   S+  +  D +A  +EL  +E KRQ   E+L++++  K  N+  N  
Sbjct: 357 LNEERRVEILERELSIAKENADLEA--EELRLIELKRQ---EQLRKEKETKIKNELANIH 411

Query: 178 AIEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTT 330
              V +S  +  +    QN +    +       ESN SQ+    + P+N T
Sbjct: 412 PPTVTESEPEKLLSEDGQNELNTQNKDRGIKNFESNHSQLDTVDDTPVNLT 462

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 26/101 (25%), Positives = 50/101 (49%)
 Frame = +1

Query: 1147 ARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNR 1326
            A K   EE E +KK    F N+N A   F EK +N     N++ ++ KI D +K+K   +
Sbjct: 1358 AFKPFVEEIESLKKELQVFRNANDASDAF-EKIKN-----NMEEEKNKIID-EKTKDFEK 1410

Query: 1327 ELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLIQRL 1449
            +L   + + +S+  E ++    + +K+      +   ++R+
Sbjct: 1411 KLQDAVNKSKSNESEVENSEHIEALKKEWLKEYEEETVKRI 1451

>SAKL0A00352g Chr1 complement(38015..39487) [1473 bp, 490 aa] {ON}
            some similarities with uniprot|P53741 YNR051C
            Saccharomyces cerevisiae BRE5 Ubiquitin protease cofactor
          Length = 490

 Score = 33.5 bits (75), Expect = 1.7
 Identities = 31/113 (27%), Positives = 51/113 (45%), Gaps = 5/113 (4%)
 Frame = +1

Query: 1084 VNSQP-SLYKAKGENRFNIIRDARK--GLSEEEERMKKSSHNFTNSNSAKAFFDE--KFQ 1248
            VN++P ++ +  GEN+   I D  K   + EE++  KK           K    E  K +
Sbjct: 170  VNAEPKTMVENGGENQVTKINDEDKKDDVKEEKKEEKKEEKKEEKKEEKKEEKKEEKKEE 229

Query: 1249 NPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQ 1407
              +      N+ RK  +  K +A   EL K   +KE S  E+K +  K++ K+
Sbjct: 230  KKEEKKEEKNEERKKEEELKKQAKKEELKK-QEKKEESKKEEKKEESKKQEKK 281

>TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567
           YGL244W
          Length = 570

 Score = 33.5 bits (75), Expect = 1.8
 Identities = 36/150 (24%), Positives = 66/150 (44%), Gaps = 5/150 (3%)
 Frame = +1

Query: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERK-----RQALMERLKRKQAFKKPND 165
           MD  RE     P      DE+D + I    E MER+     R  +M++ + ++ F++ + 
Sbjct: 72  MDGEREEPNPFPLEGKYKDEDDREKIESMPE-MERETLLFERSQIMQKYQERKMFRERSR 130

Query: 166 PNFEAIEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQ 345
              + + +  +   +  K+ +   V   T L  S+A  S LSQ+++Q E           
Sbjct: 131 ---KQMSLNNNSNLTGQKTRTSTRVTHTTGL--SDAKSSKLSQLKRQRER--------RN 177

Query: 346 KFQNAKKDEDRQIAKFESMMDARVHTFGTD 435
           K Q+   DED    ++E  ++    + G+D
Sbjct: 178 KGQSNYSDEDEYEDEYEDDLEQEYKSSGSD 207

>TPHA0A04510 Chr1 complement(1018807..1020690) [1884 bp, 627 aa] {ON}
            Anc_3.212 YDL003W
          Length = 627

 Score = 33.5 bits (75), Expect = 1.8
 Identities = 33/157 (21%), Positives = 64/157 (40%), Gaps = 2/157 (1%)
 Frame = +1

Query: 1129 FNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKK 1308
            F    D  K L  EEE M +   +  +++        K Q P   + L N R+ + D + 
Sbjct: 331  FGFDLDIGKDLIAEEELMAEEEEDNLSNSEKSRLNSIKKQKPLKHSELTNARKLVEDVEI 390

Query: 1309 SKALNRELAKIMRRKESSGLEDKSDGEKQK--MKQTTENALQTGLIQRLGFDPTHGEISK 1482
               L  E+ +     E + +    D    K  +++ TE  L   ++Q L + P     S 
Sbjct: 391  E--LKDEIVRRDNSDEETAMPTNYDQSSSKAYLERMTEKRLNDDIVQSLNYIP-----SS 443

Query: 1483 VLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILA 1593
            ++K+ +     +  L N  +  ++  L + ++ +I A
Sbjct: 444  IVKNYIQFDSKRFKLNNENENDLDMNLSFVEDDMISA 480

>TPHA0A01040 Chr1 complement(203011..205083) [2073 bp, 690 aa] {ON}
            Anc_8.617 YOR206W
          Length = 690

 Score = 33.5 bits (75), Expect = 1.9
 Identities = 31/161 (19%), Positives = 77/161 (47%), Gaps = 19/161 (11%)
 Frame = +1

Query: 1162 SEEEERMKKSSHNFT-NSNSAKAFFDEKFQNP---DMLANLDNKRRKITDTKKSKALNRE 1329
            ++EE++MKKS++N   N    + +FD+ F+ P     + N+D +R       +S++   +
Sbjct: 52   TKEEQKMKKSANNEVFNDMQIEQYFDKGFELPKTSKKVKNVDQRRNNSASESESESDAND 111

Query: 1330 LAKIMRRKE-SSGLEDKSD----------GEKQKMKQT----TENALQTGLIQRLGFDPT 1464
            +  +   +E    L+++++           EK+ +K++    T++ L   +++      T
Sbjct: 112  IDMLGEDEEVQKYLQNETEEIFHADVPTINEKEPIKKSNSSITKSILTESVVETWEEKLT 171

Query: 1465 HGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVI 1587
            +    KV+K+++   +      N  + ++N+  H   + V+
Sbjct: 172  NKPNLKVIKNTIDAFQYTVEYENAPERLLNNPFHIDSDDVM 212

>YBR237W Chr2 (691969..694518) [2550 bp, 849 aa] {ON}  PRP5RNA
           helicase in the DEAD-box family, necessary for
           prespliceosome formation, bridges U1 and U2 snRNPs and
           enables stable U2 snRNP association with intron RNA
          Length = 849

 Score = 33.5 bits (75), Expect = 1.9
 Identities = 47/178 (26%), Positives = 73/178 (41%), Gaps = 20/178 (11%)
 Frame = +1

Query: 46  VTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEAIEVPQSPTKSRVKSG 225
           VT+  E +Q   K   F ER+ +   E  KRK  F+K ++P      V   P+K   K  
Sbjct: 47  VTNSLEGKQTTEK---FTERQERVKEELRKRKNEFRKSDEP------VSVKPSK---KKS 94

Query: 226 SQNAVKQVTRLETSNANESNL-------SQIQKQPE-------LPINTTTYFMQKFQNAK 363
            ++ VK+    + S+ ++S +         IQK PE       L    T+   +K  N+K
Sbjct: 95  KRSKVKKKISFDFSDDDDSEIGVSFRSKEHIQKAPEHDNEKDPLDEFMTSLKEEKMSNSK 154

Query: 364 KDEDRQIAKFESMMDARVHTFGTDNKKYKPIIAN-ELEGFSNLWVKKR-----YIPED 519
              DR       + D      GTD++  +    N  +   + L  KKR     Y PE+
Sbjct: 155 GMYDR--GDILDVEDQLFELGGTDDEDVEDNTDNSNIAKIAKLKAKKRVKQIYYSPEE 210

>NCAS0A04110 Chr1 complement(829352..833095) [3744 bp, 1247 aa] {ON}
            Anc_2.409
          Length = 1247

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 31/118 (26%), Positives = 49/118 (41%), Gaps = 13/118 (11%)
 Frame = +1

Query: 1324 RELAKIMRRKESSGLEDKSDGEKQKMKQTT-------------ENALQTGLIQRLGFDPT 1464
            +EL K+  ++    +ED+SD      KQ               E AL+   +Q L F P 
Sbjct: 21   KELKKVRNKQFYREVEDESDDRVPDDKQDLDTNSELLKPVTEEEKALKKRKLQEL-FTPK 79

Query: 1465 HGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKKRNHREE 1638
              ++S++ K  +            KKT+I  L  YK +  +L  SK     ++  REE
Sbjct: 80   ESKVSRLKKKRLDKFIEHQLKREEKKTIIEKLQGYKIDTSLLTSSKRLGEGRQTKREE 137

>SAKL0E04532g Chr5 (364158..367979) [3822 bp, 1273 aa] {ON} similar to
            uniprot|Q04217 Saccharomyces cerevisiae YMR128W ECM16
            Essential DEAH-box ATP-dependent RNA helicase specific to
            the U3 snoRNP predominantly nucleolar in distribution
            required for 18S rRNA synthesis
          Length = 1273

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 29/119 (24%), Positives = 52/119 (43%), Gaps = 14/119 (11%)
 Frame = +1

Query: 1324 RELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLIQRLG--------------FDP 1461
            +EL K+  ++    +ED +D +++++++   NA    LIQ L               F P
Sbjct: 21   KELKKVRNKQFLRHMEDGADVDEEEVQEHDSNA---ELIQPLSKEEKELKKRKLELLFTP 77

Query: 1462 THGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKKRNHREE 1638
               +IS+  K  +     +      KKT+I  L  YK +  +L  SK     ++  +EE
Sbjct: 78   EETKISRTKKKRLDKFIEQQLKREEKKTIIEKLQDYKVDTSLLTSSKKLGHGRQTKKEE 136

>TBLA0B01810 Chr2 complement(410017..414531) [4515 bp, 1504 aa] {ON}
            Anc_2.199 YNL091W
          Length = 1504

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 41/187 (21%), Positives = 78/187 (41%), Gaps = 8/187 (4%)
 Frame = +1

Query: 1102 LYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNK 1281
            L + + E++   +++ +K    E+E+ +K           +   +E+ ++       + K
Sbjct: 761  LEELEAEDKKKKVKEEKKQKKREKEKERKRLQQVAKEEEKRKKEEERIRSELEAQEREMK 820

Query: 1282 RRK-----ITDTKKSK-ALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLIQ 1443
            RR+     + + KK K    R   +  RR+E      +   E+QK K+  E   +    +
Sbjct: 821  RREAQRKKVEENKKKKDEEKRRKLEEQRRREEEQERQRKLKEEQKRKRDEERRQREEEQK 880

Query: 1444 RLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVIND-LLHYKKEKVILAP-SKNEWFK 1617
            R   +    +  +  K      E K  LL  +K +  + LL  KKE+  LA   K+E  K
Sbjct: 881  RKQEEKLRRKQEEENKRLQKEKEEKEKLLKKQKELEEEKLLKKKKEQERLAKFKKDEEAK 940

Query: 1618 KRNHREE 1638
            K+  + E
Sbjct: 941  KKKQQAE 947

>CAGL0F02255g Chr6 (221723..222163) [441 bp, 146 aa] {ON} similar to
           uniprot|P43587 Saccharomyces cerevisiae YFR003c
          Length = 146

 Score = 32.0 bits (71), Expect = 2.1
 Identities = 18/74 (24%), Positives = 37/74 (50%), Gaps = 1/74 (1%)
 Frame = +1

Query: 4   DDPREILAVD-PYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 180
           +DP ++   D  ++S +S     ++   +    E++RQ  +ER +R+Q   +P  PN   
Sbjct: 71  EDPEQLCPSDHEHSSSSSSSSSSESDDDDKYNSEQRRQRRIERRRRRQKTNRPASPNAYE 130

Query: 181 IEVPQSPTKSRVKS 222
           I+   S  + R+ +
Sbjct: 131 IQPDYSEYRKRMNA 144

>TPHA0B02880 Chr2 (657768..659264) [1497 bp, 498 aa] {ON} Anc_8.609
            YOR198C
          Length = 498

 Score = 33.1 bits (74), Expect = 2.3
 Identities = 35/128 (27%), Positives = 60/128 (46%), Gaps = 9/128 (7%)
 Frame = +1

Query: 1282 RRKITDTKKSKALNRELAKIMRRKES--SGLEDKSDGEKQKMKQTTENALQTGLIQRLGF 1455
            R K+ + +  +  + +L+KI+  KE   S L+DK    KQ        A++  L      
Sbjct: 257  RSKLENERLKREEDEKLSKIIEEKEEKLSKLQDKLLHAKQPAFTFEIEAIENSLTV---L 313

Query: 1456 DPTHGEISKV-------LKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWF 1614
            DP++ +  K        L +S P  + +N+L+  KK   ND + Y        PSK++ F
Sbjct: 314  DPSYVKPKKEIFEQESSLATSAPVRKVENDLVPIKKE--NDDIFYNT-----VPSKSKKF 366

Query: 1615 KKRNHREE 1638
            KK+N  ++
Sbjct: 367  KKKNQNKQ 374

>CAGL0K03949g Chr11 complement(365526..367043) [1518 bp, 505 aa] {ON}
            similar to uniprot|P40208 Saccharomyces cerevisiae
            YMR135c
          Length = 505

 Score = 33.1 bits (74), Expect = 2.3
 Identities = 34/138 (24%), Positives = 54/138 (39%), Gaps = 6/138 (4%)
 Frame = +1

Query: 1057 GYALGAPTKVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFD 1236
            GY L + + VN+     K K E + ++  D R                    N+ K F  
Sbjct: 353  GYFLQSESMVNTNILKIKTKDEFKDDLYNDDRY------------------KNNTKTF-- 392

Query: 1237 EKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKS------DGEKQK 1398
            EK++N     N D     +T +    A   E+ +      SS   D+S      + + + 
Sbjct: 393  EKYKNE--FQNEDGSNNSLTGSNSYWAETTEMLRRQSNTTSSSDNDQSSYSENDNNDSKN 450

Query: 1399 MKQTTENALQTGLIQRLG 1452
             KQTT NA + GL++  G
Sbjct: 451  KKQTTHNASKNGLLKEDG 468

>KLLA0F08019g Chr6 (752184..754460) [2277 bp, 758 aa] {ON} some
            similarities with uniprot|P31376 Saccharomyces cerevisiae
            YAL011W SWC3 Protein of unknown function component of the
            Swr1p complex that incorporates Htz1p into chromatin
          Length = 758

 Score = 33.1 bits (74), Expect = 2.5
 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 4/92 (4%)
 Frame = +1

Query: 1141 RDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKAL 1320
            R+ RK   EEE+R+KK           +A   EK +N D +       +K     +++ L
Sbjct: 161  REVRKKQQEEEKRLKKERKLLRKKLKQEALEKEKEKNKDKVKKPRKPYKKSAKRLEAERL 220

Query: 1321 NRELAKIMRRKESSGLEDK----SDGEKQKMK 1404
             +E  K      +SG++ K    S+ +K+KMK
Sbjct: 221  KKE-EKAKAAANTSGVKKKISKTSNVKKKKMK 251

>NCAS0A01400 Chr1 (274080..276368) [2289 bp, 762 aa] {ON} Anc_5.241
          Length = 762

 Score = 33.1 bits (74), Expect = 2.5
 Identities = 22/100 (22%), Positives = 48/100 (48%)
 Frame = +1

Query: 1102 LYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNK 1281
            +Y+ +GE  F      +KG +E ++      H+F N  +            +++A +D+K
Sbjct: 623  VYELEGEEEFQ-----KKGSAESQK------HDFLNKEA------------EVMATVDSK 659

Query: 1282 RRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKM 1401
             +++   K+ +   + L  + R  E++  ED+SD E + +
Sbjct: 660  DKQVAKEKRQEKKRKRLEAMRREMEAALEEDESDEETRNV 699

>Kpol_1019.2 s1019 complement(4070..6757) [2688 bp, 895 aa] {ON}
            complement(4070..6757) [2688 nt, 896 aa]
          Length = 895

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 26/92 (28%), Positives = 44/92 (47%), Gaps = 6/92 (6%)
 Frame = +1

Query: 40   NSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEAIEVPQSPTK--SR 213
            N+++  EE      KEL++  R  Q+  ER  R    K       +A++  +S T   S+
Sbjct: 801  NAISGIEESISFYFKELDYRIRSVQSTYERKVRSAERKLKRAEEKKALKDAKSDTNTVSK 860

Query: 214  VKSG----SQNAVKQVTRLETSNANESNLSQI 297
            VK+     S+N VK+ T   +  ++ S  SQ+
Sbjct: 861  VKTSRRNASENEVKEATSTGSGTSHNSEKSQV 892

>Skud_4.220 Chr4 (389016..392021) [3006 bp, 1001 aa] {ON} YDL031W
            (REAL)
          Length = 1001

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 41/156 (26%), Positives = 73/156 (46%), Gaps = 6/156 (3%)
 Frame = +1

Query: 1150 RKGLSEEEERMKKSSHNFTNSNSAK-AFF--DEKFQNPDMLANLDNKRRKITDTKKSKAL 1320
            R   S   E +K+S     +   A+ AFF  +E+ +  D LA L N+R K T  + ++  
Sbjct: 642  RTRTSASPESLKRSKEIIASGWDAQNAFFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNP 701

Query: 1321 NRELAKIM--RRKESSGLEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEIS-KVLK 1491
            + E+A +M  RRK+ + ++ K+  E++K+ +    A  +  I+        GE    V +
Sbjct: 702  DDEMAVLMKRRRKQLAPIQRKA-SERRKLLEKERMAGLSHSIENEILKGDDGETGYTVSE 760

Query: 1492 SSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPS 1599
             ++   E  + LL  ++   ND    KK K    P+
Sbjct: 761  EALKEFEDADQLLEAQE---NDSKKKKKPKTFKDPT 793

>Skud_13.403 Chr13 (714405..715454) [1050 bp, 349 aa] {ON} YMR234W
            (REAL)
          Length = 349

 Score = 32.7 bits (73), Expect = 2.7
 Identities = 33/99 (33%), Positives = 43/99 (43%)
 Frame = +1

Query: 1024 GTSAKRIELNGGYALGAPTKVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNF 1203
            GTS+ R    G Y  GAP +  S+P +  A+  NR  I            E +KK   N 
Sbjct: 201  GTSSSRAGY-GAYFEGAPEENISEPLMSGAQTNNRAEI--------EAVSEALKKIWDNL 251

Query: 1204 TNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKAL 1320
            TN N  K  +  K  + + +A L N R    D KK K L
Sbjct: 252  TNGND-KVKYQIK-TDSEYVAKLLNDRYVTYDDKKLKGL 288

>YNL091W Chr14 (452408..456130) [3723 bp, 1240 aa] {ON}  NST1Protein
           of unknown function, mediates sensitivity to salt
           stress; interacts physically with the splicing factor
           Msl1p and also displays genetic interaction with MSL1
          Length = 1240

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 27/108 (25%), Positives = 50/108 (46%)
 Frame = +1

Query: 58  EEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEAIEVPQSPTKSRVKSGSQNA 237
           EE+++ + KELE  E +R+   +R K ++A +K ++     +E  Q   + + K   Q  
Sbjct: 671 EEEKERLKKELEEREMRRRE-AQRKKVEEAKRKKDEERKRRLEEQQRREEMQEKQRKQ-- 727

Query: 238 VKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNAKKDEDRQ 381
                + E     E    +I++Q  L         +K Q  K++E+RQ
Sbjct: 728 -----KEELKRKREEEKKRIREQKRLE-------QEKLQKEKEEEERQ 763

>TBLA0E04730 Chr5 (1208306..1212190) [3885 bp, 1294 aa] {ON} 
          Length = 1294

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 19/87 (21%), Positives = 40/87 (45%)
 Frame = +1

Query: 1150 RKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRE 1329
            +K   +++E+  K  +     N  K   +EK +  +     D K +K    KK K   +E
Sbjct: 118  KKDKKDKKEKKDKKENEENEENEEKEEKEEKEEKEEKEEKKDKKDKKDKKDKKDKKEKKE 177

Query: 1330 LAKIMRRKESSGLEDKSDGEKQKMKQT 1410
              +   +KE    ++K + +++K K++
Sbjct: 178  KKEKKEKKERKEKKEKKEKKEKKEKKS 204

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 19/89 (21%), Positives = 39/89 (43%)
 Frame = +1

Query: 1150 RKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRE 1329
            +K   E++++ +   +        K   +EK +  +     D K +K    KK K   +E
Sbjct: 121  KKDKKEKKDKKENEENEENEEKEEKEEKEEKEEKEEKKDKKDKKDKKDKKDKKEKKEKKE 180

Query: 1330 LAKIMRRKESSGLEDKSDGEKQKMKQTTE 1416
              +   RKE    ++K + +++K K  +E
Sbjct: 181  KKEKKERKEKKEKKEKKEKKEKKSKSESE 209

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score = 33.1 bits (74), Expect = 2.8
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 3/67 (4%)
 Frame = +1

Query: 1141 RDARKGL-SEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKK--S 1311
            RDA K L SE+ ER      NF +SNS   + + K  N  ++ +L+N+  ++T+     S
Sbjct: 618  RDAFKLLVSEDRER------NFKSSNSVHKYHELKSYNETVVKDLENRLTQLTNDSNAHS 671

Query: 1312 KALNREL 1332
            KAL  EL
Sbjct: 672  KALTEEL 678

>NCAS0A08310 Chr1 (1641487..1642761) [1275 bp, 424 aa] {ON}
           Anc_1.470 YJR043C
          Length = 424

 Score = 32.7 bits (73), Expect = 2.9
 Identities = 28/106 (26%), Positives = 48/106 (45%), Gaps = 2/106 (1%)
 Frame = +1

Query: 7   DPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEAIE 186
           DP+    +D  N +  D+EDE    +E+E  E   ++    +  +    + N  N    +
Sbjct: 255 DPKRKAQMDELNKLFVDDEDEDEDEEEVEIKETATESDHHPVDMENIVAEQN--NINEKD 312

Query: 187 VPQSPTKSRVKSGSQNAVKQVTRLE--TSNANESNLSQIQKQPELP 318
              S T +RV S S+ A   V+ LE   +   E ++ +I+K  E P
Sbjct: 313 EQGSGTGTRV-SSSKIATTNVSELEELLNTTTEDSILEIKKDGEKP 357

>SAKL0G19008g Chr7 (1640890..1642233) [1344 bp, 447 aa] {ON} similar
            to uniprot|P36080 Saccharomyces cerevisiae YKL082C RRP14
            Required for normal pre-rRNA Processing Protein required
            for cell viability
          Length = 447

 Score = 32.7 bits (73), Expect = 2.9
 Identities = 31/170 (18%), Positives = 71/170 (41%), Gaps = 3/170 (1%)
 Frame = +1

Query: 1108 KAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRR 1287
            + K +   N + +A +  SE + + KK   +   +   K     + +  + + ++  KR+
Sbjct: 145  QVKEDENENFVAEAEEDHSEHKNKTKKELSDSEKAQKQKNLEQLRAKLQEKIKSMKEKRK 204

Query: 1288 KITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTH 1467
             +         +RE     R+K+    + KS+  KQK  ++++++  +     L   P +
Sbjct: 205  ALGTKVDGAPSSREAILAQRKKKEELKKRKSEEGKQKQAESSDDS-DSDSDSELEDQPPN 263

Query: 1468 GEISKVLKSSVPGGES---KNNLLNGKKTVINDLLHYKKEKVILAPSKNE 1608
             +  K  +S     +    +N + +      +DL H +K      P+KN+
Sbjct: 264  KKQRKNDESDGINAKQVIFQNIVFDDGDRATSDLQHLRKGPSKKGPAKND 313

>Ecym_4164 Chr4 complement(348576..350069) [1494 bp, 497 aa] {ON}
            similar to Ashbya gossypii AGL111W
          Length = 497

 Score = 25.8 bits (55), Expect(2) = 2.9
 Identities = 32/157 (20%), Positives = 61/157 (38%), Gaps = 6/157 (3%)
 Frame = +1

Query: 1087 NSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLA 1266
            N+QP + K K E+  +I+RD +K         K+S   F +       F +   +  ++ 
Sbjct: 300  NAQPIVKKQKFESPVSILRDGKK-------TKKRSVIRFVDDCKLVTVFGDDLPDSGVIT 352

Query: 1267 NLDNKRRKIT-----DTKKSKALNRELAKIMRRKESSG-LEDKSDGEKQKMKQTTENALQ 1428
            + D  ++ +      + ++    N    K+ +     G +ED    E +     T   + 
Sbjct: 353  SPDRLKKILNPYVEGEPREFLLENWRTQKVHKLIIDVGIIEDSDISEFRNGPIATSTKVP 412

Query: 1429 TGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGK 1539
            T    RL F   + +++   K  V   E +  L N K
Sbjct: 413  TA--YRLNFTKFNEDLANFHKEPVDNEEEEQELKNHK 447

 Score = 25.4 bits (54), Expect(2) = 2.9
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
 Frame = +2

Query: 1577 KKLSSHPQRTNGSRKETIVRRFGKDTSGL-RERLKKPRMLVPAIWR 1711
            ++L +H  +  G +   IVR FGK+   L +ER   P   VP + R
Sbjct: 441  QELKNHKGKRRGGKGPIIVRAFGKNALLLKKERGGLPYKKVPEVRR 486

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 32.7 bits (73), Expect = 3.2
 Identities = 34/171 (19%), Positives = 72/171 (42%), Gaps = 13/171 (7%)
 Frame = +1

Query: 1051 NGGYALGAPTKVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHN----FTNSNS 1218
            N G   G   +  +   L  A  +++FN+++     L ++ +  K+ S+N    F   NS
Sbjct: 164  NSGTQTGTEERAGANLILGNAVTKDKFNLLKRRVDRLQKDLDSAKEESYNAKLEFQKLNS 223

Query: 1219 -----AKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSD 1383
                  ++ F  K  N +++ N +     + +  +   L   + +  R K++SG + ++ 
Sbjct: 224  KYNTVVESLFTFKTVNDNLMNNFNILCSVLNN--RGIELPPHIYQDPRLKQNSGTQQQAQ 281

Query: 1384 GEKQKMKQTTENALQT----GLIQRLGFDPTHGEISKVLKSSVPGGESKNN 1524
                   Q T +A  +      +Q   FDP +  ++ ++   VP   S +N
Sbjct: 282  AATSAATQATTSASNSTAGMSPMQNKPFDPLNSAVNAMVPGPVPLSASLSN 332

>KLLA0B09944g Chr2 (870678..872702) [2025 bp, 674 aa] {ON} weakly
            similar to uniprot|P38283 Saccharomyces cerevisiae
            YBR156C SLI15 Mitotic spindle protein involved in
            chromosome segregation.
          Length = 674

 Score = 32.7 bits (73), Expect = 3.2
 Identities = 46/173 (26%), Positives = 80/173 (46%), Gaps = 11/173 (6%)
 Frame = +1

Query: 1123 NRFNIIRDARKGLSEEEERM----KKSSHNFTNSNSAKAFFDEKFQNPDMLANLD----- 1275
            N  N IR A+K L EE  +     + S+H  T+ +   +  D++  + D L         
Sbjct: 448  NETNNIR-AKKQLPEEVSQPPVIPQLSTHKSTSISPTSS--DQRTNSHDRLTRFQLITGS 504

Query: 1276 --NKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLIQRL 1449
              NK+ K  DT K K LN+ L+++MR ++   +  K + +++++ Q  E+   T    ++
Sbjct: 505  SSNKQEK--DTLKQK-LNKRLSEVMRNQQEQQMRKKYELQQRRISQADED---TKRRTKI 558

Query: 1450 GFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNE 1608
              D  +  +  + KS+     S N++L+   TV  D   Y     I AP K E
Sbjct: 559  LLDRNNATLPPLSKSA-----STNSMLHDINTV--DYREY-----IGAPPKTE 599

>TBLA0E00870 Chr5 complement(187915..190014) [2100 bp, 699 aa] {ON}
           Anc_5.677 YOR073W
          Length = 699

 Score = 32.7 bits (73), Expect = 3.3
 Identities = 31/128 (24%), Positives = 54/128 (42%), Gaps = 1/128 (0%)
 Frame = +1

Query: 40  NSVTSDEEDEQAIAKELEFM-ERKRQALMERLKRKQAFKKPNDPNFEAIEVPQSPTKSRV 216
           ++ +S +  E  ++K  E   E K  + + + KRK   KK  D   + IE  +  TK   
Sbjct: 458 DATSSVDIHELEVSKRRETKNESKGVSSIRKEKRKSIRKKKVDEPIKMIESNEETTKREE 517

Query: 217 KSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNAKKDEDRQIAKFE 396
            SGSQ+    V   E+ N+ +S++  + +      N T        N+    D  +   E
Sbjct: 518 PSGSQSGT--VIPSESDNSQKSHIPNLVQSMVYVENITCNSSSSAYNSSSIIDDTMTARE 575

Query: 397 SMMDARVH 420
            +   +VH
Sbjct: 576 QIPSLKVH 583

>SAKL0C09746g Chr3 (880534..882699) [2166 bp, 721 aa] {ON} weakly
           similar to uniprot|Q03388 Saccharomyces cerevisiae
           YDR485C VPS72 Protein of unknown function component of
           the Swr1p complex that incorporates Htz1p into chromatin
           required for vacuolar protein sorting
          Length = 721

 Score = 32.7 bits (73), Expect = 3.3
 Identities = 31/113 (27%), Positives = 47/113 (41%), Gaps = 11/113 (9%)
 Frame = +1

Query: 7   DPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLK------RKQAFKKPNDP 168
           D  E+ +     S  +DE+DE+    ELE  ERKR+ L  R K      R +  +KP  P
Sbjct: 73  DEDELFSDSGDESDGADEDDEE---HELERQERKRRKLASRKKIPVIRRRAEKEEKPKKP 129

Query: 169 NFEAIEVPQSPTKSRVKSGSQNAVKQVTRL-----ETSNANESNLSQIQKQPE 312
            +E         +SR  S   + V    ++     E     +    +IQ+Q E
Sbjct: 130 QYEQPSAESLLLRSRRTSKRSSVVANKLQVYQKLTEAEKKRKEIRERIQRQKE 182

 Score = 32.7 bits (73), Expect = 3.3
 Identities = 34/168 (20%), Positives = 73/168 (43%), Gaps = 9/168 (5%)
 Frame = +1

Query: 1162 SEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKI 1341
            +E+EE+ KK  +   ++ S         +   ++AN     +K+T+ +K +   RE  +I
Sbjct: 120  AEKEEKPKKPQYEQPSAESLLLRSRRTSKRSSVVANKLQVYQKLTEAEKKRKEIRE--RI 177

Query: 1342 MRRKESSGLEDKSDGEKQKMKQTTE--NALQTGLIQRLGFDPTHGEISKVL--KSSVPGG 1509
             R+KE  G ++ +  ++ +    TE  N L     +          ++  L  +S    G
Sbjct: 178  QRQKEKQGHQELTQEDRLRQALDTERINLLSLNKYKEQELSKKQNRMAMQLRNRSKFVPG 237

Query: 1510 ESKNNLLNGKKTV-----INDLLHYKKEKVILAPSKNEWFKKRNHREE 1638
            E   ++++ +  V     + D  H++++       K ++ KKR   +E
Sbjct: 238  ELVLSVVSAEWRVTPVMEVKDHEHWQQQLARRTKKKKKYTKKRKEPQE 285

>KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {ON}
            Anc_5.414 YDR356W
          Length = 905

 Score = 32.7 bits (73), Expect = 3.4
 Identities = 31/134 (23%), Positives = 58/134 (43%), Gaps = 1/134 (0%)
 Frame = +1

Query: 1132 NIIRDARKGLSEEEERMKKSSHNFTNSNSA-KAFFDEKFQNPDMLANLDNKRRKITDTKK 1308
            N I D +  L+E+   +     N   +N   K F  E +++ + + +  ++  ++ D KK
Sbjct: 308  NEISDLQAQLTEKLTTINNLEENLKKNNDVIKNFNTENYKHDNQVKDFISQIEELHDDKK 367

Query: 1309 SKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVL 1488
            S   + +++K    K    +E K    K   ++TTEN  +              +I K+ 
Sbjct: 368  SLTRDLQISKEKFNKYRGEMERKVFELKTSNERTTENDAE-----------QLDQIKKLY 416

Query: 1489 KSSVPGGESKNNLL 1530
            +  V   +SKNN L
Sbjct: 417  EDRVNKLQSKNNSL 430

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
            YDR507C
          Length = 1125

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 36/155 (23%), Positives = 67/155 (43%), Gaps = 19/155 (12%)
 Frame = +1

Query: 16   EILAVDPYNSVTSDEED---EQAIAKELEFMERKRQALMERLKRKQAFKKPNDPN----- 171
            EI   + Y  +  ++E+   +   AKE E  ERK++ L ER K+++  +K N+ N     
Sbjct: 555  EIFEHEKYEQIRKEKEELARKVREAKEREEAERKQKELQEREKQRERERKENETNDRQRI 614

Query: 172  -FEAIE---------VPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPI 321
              E IE           +  T+SR  S   N  +    +E         + +Q +P+  +
Sbjct: 615  MEEEIENLKKELDMMSHEGKTESRSVSEPLNKKQGGVEIEVKELLRQRNAALQTRPKSRL 674

Query: 322  NTTTYFMQKFQNAKKD-EDRQIAKFESMMDARVHT 423
            +   +    F +A+ D  +  +  FE  +D ++ T
Sbjct: 675  DPGLF----FDSAESDTRNPSLQVFEGEVDNKLKT 705

>Smik_14.236 Chr14 (432694..436392) [3699 bp, 1232 aa] {ON} YNL091W
           (REAL)
          Length = 1232

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 27/108 (25%), Positives = 50/108 (46%)
 Frame = +1

Query: 58  EEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEAIEVPQSPTKSRVKSGSQNA 237
           EE+++ + KELE  E KR+   +R K ++A +K ++     +E  Q   + + K   Q  
Sbjct: 664 EEEKERLRKELEEREMKRRE-AQRKKVEEAKRKKDEERKRRLEEQQRREEIQEKQRKQ-- 720

Query: 238 VKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNAKKDEDRQ 381
                + E     E    +I++Q  L         +K Q  K++E++Q
Sbjct: 721 -----KEEQKRKREEEKKRIREQKRLE-------QEKLQKEKEEEEKQ 756

>Skud_14.240 Chr14 (442718..446449) [3732 bp, 1243 aa] {ON} YNL091W
           (REAL)
          Length = 1243

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 27/108 (25%), Positives = 50/108 (46%)
 Frame = +1

Query: 58  EEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEAIEVPQSPTKSRVKSGSQNA 237
           EE+++ + KELE  E KR+   +R K ++A +K ++     +E  Q   + + K   Q  
Sbjct: 674 EEEKERLKKELEEREMKRRE-AQRKKVEEAKRKKDEERKRRLEEQQRREEMQEKQRKQ-- 730

Query: 238 VKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNAKKDEDRQ 381
                R E     E    +I++Q  L         +K Q  K++E+++
Sbjct: 731 -----REEQKRKREEEKKRIREQKRLQ-------QEKLQREKEEEEKK 766

>NDAI0J03020 Chr10 complement(753506..758383) [4878 bp, 1625 aa] {ON}
            Anc_4.373 YJR138W
          Length = 1625

 Score = 32.7 bits (73), Expect = 3.6
 Identities = 48/235 (20%), Positives = 81/235 (34%), Gaps = 5/235 (2%)
 Frame = +1

Query: 937  NTKTHKKCGS---PINISLHKCCDYHREVQFRGTSAKRIELNGGYAL--GAPTKVNSQPS 1101
            NTK H+   S   PI   +H+            T    I LN G  +        N+  +
Sbjct: 9    NTKKHQLSPSLNRPIPDQIHQVITTANTT----THPNTISLNAGNLIVGNNNNNNNNNNN 64

Query: 1102 LYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNK 1281
            +     EN FNII D    L           H F    S        +QN D    ++N 
Sbjct: 65   INGETNENTFNIINDNSSTLRRRAPLSSSLHHIFNKRQS--------YQNNDRTTRIENI 116

Query: 1282 RRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLIQRLGFDP 1461
                T+T  + A   +    +   ES   ED+     +++    E               
Sbjct: 117  TNTATNTNTTTATPIQYELEISYHESRISEDQILLNLEQLPDIKE--------------- 161

Query: 1462 THGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKKRN 1626
              G++ ++    +P   +  N         ND ++ KK+  ++A + N+  K+R+
Sbjct: 162  --GDLCQLKTIPIPNNNNNKN---------NDFINRKKKIYLIAKNFNQEIKRRS 205

>Ecym_1179 Chr1 complement(363479..368491) [5013 bp, 1670 aa] {ON}
            similar to Ashbya gossypii ADR046C
          Length = 1670

 Score = 32.7 bits (73), Expect = 3.6
 Identities = 25/114 (21%), Positives = 46/114 (40%), Gaps = 1/114 (0%)
 Frame = +1

Query: 1075 PTKVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNP 1254
            P   NS+ +    K EN     +  +   SE+  + +KSS +  +  S K+   EK    
Sbjct: 266  PQSNNSEKTEKSDKPENSSKSAKSQKSTKSEKSTKSEKSSKSDKSIKSEKSTKSEKSTKS 325

Query: 1255 DMLANLDNKRRKITDTKKSKALNRELAKIMRRK-ESSGLEDKSDGEKQKMKQTT 1413
            +     D   +    TK  K+   + +K   +  +SS L+  +     K  ++T
Sbjct: 326  EKSTKSDKSIKSDKSTKSDKSKKSDKSKKSEKSTKSSSLDSSTSARSTKASKST 379

>Smik_6.343 Chr6 (546746..548101) [1356 bp, 451 aa] {ON} YPL146C
            (REAL)
          Length = 451

 Score = 32.3 bits (72), Expect = 3.9
 Identities = 34/99 (34%), Positives = 46/99 (46%), Gaps = 4/99 (4%)
 Frame = +1

Query: 1072 APTKVNSQPSLYK---AKGENRFNIIRDARKGLSEEEERM-KKSSHNFTNSNSAKAFFDE 1239
            APT V  +PS YK    KG+  +    D    +SE E+ M KK  H  T+  S  A    
Sbjct: 2    APTNVTKKPSQYKQSSRKGKKAWRKNID----ISEVEQYMEKKIDHEITHGTSDMA---- 53

Query: 1240 KFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKE 1356
              QN D L  +D +  KI   KK      ++ KI++ KE
Sbjct: 54   SLQN-DALFQVDVEGDKI--LKKKLIKRNQIKKILKSKE 89

>Smik_14.204 Chr14 (372646..374061) [1416 bp, 471 aa] {ON} YNL124W
           (REAL)
          Length = 471

 Score = 32.3 bits (72), Expect = 3.9
 Identities = 29/122 (23%), Positives = 53/122 (43%), Gaps = 27/122 (22%)
 Frame = +1

Query: 52  SDEEDEQAIAKELEFMERKRQALMERLKRKQAF--------KKPNDPNFEAIEVPQSPTK 207
           S+  DE+   +E EF + +++AL +++K++Q          K+PND +   ++  + P  
Sbjct: 224 SNGYDEELPEEEQEFSDDEKEALFKKMKKQQQQQRKKRDNRKQPNDSDNVKVKKARQPKA 283

Query: 208 SRVKS-----GSQNA-----------VKQVTRLE---TSNANESNLSQIQKQPELPINTT 330
           S +       G  N             ++ T+ E   T N N S L  +  Q + P+N  
Sbjct: 284 SNLPKLVPPLGMSNGAPLQHGYKSRNARENTKHEASTTPNRNRSPLVPMVPQQQFPVNNY 343

Query: 331 TY 336
            Y
Sbjct: 344 PY 345

>ZYRO0C11748g Chr3 (918429..919901) [1473 bp, 490 aa] {ON} highly
           similar to uniprot|Q03330 Saccharomyces cerevisiae
           YGR252W GCN5 Histone acetyltransferase acetylates lysine
           14 on histone H3 catalytic subunit of the ADA and SAGA
           histone acetyltransferase complexes founding member of
           the Gcn5p-related N-acetyltransferase superfamily
          Length = 490

 Score = 32.3 bits (72), Expect = 4.0
 Identities = 41/152 (26%), Positives = 69/152 (45%), Gaps = 4/152 (2%)
 Frame = +1

Query: 145 AFKKPNDPNFEAIEVP-QSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPI 321
           A KKP +  FE   +P + P+++  K  S+   +Q T   T   +E    Q Q+QP+   
Sbjct: 48  AGKKPPEGQFE---IPTEEPSEAPDKKPSEEPQQQET---THQEDEKEQEQEQEQPQQQS 101

Query: 322 ---NTTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLW 492
              N  +  ++      +DE++ IAKFE   D   + F     K +P +  E EG     
Sbjct: 102 EQSNGNSSGVKVSDEIIEDEEKGIAKFE--FDGIEYKF-----KERPSVIEEKEG----R 150

Query: 493 VKKRYIPEDDLKRSLHEIKILRLGKLFAKVRP 588
           ++ R +  D+ K +L  + +  L  +F K  P
Sbjct: 151 IEFRVVNNDNTKENL--MVLTGLKNIFQKQLP 180

>TPHA0C03790 Chr3 complement(822142..823614) [1473 bp, 490 aa] {ON}
           Anc_2.369 YDL088C
          Length = 490

 Score = 32.3 bits (72), Expect = 4.0
 Identities = 21/87 (24%), Positives = 42/87 (48%), Gaps = 13/87 (14%)
 Frame = +1

Query: 322 NTTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANEL---------- 471
           N +  F+Q  ++  + +  Q   +  + +    ++   N K KP+ AN+L          
Sbjct: 15  NVSINFLQPSEDTSQQQGNQQKTYHQLQNNSQQSYIQLNNKNKPLFANDLQSQFDTNMKG 74

Query: 472 ---EGFSNLWVKKRYIPEDDLKRSLHE 543
              E F+N   KKR IP++ ++R+++E
Sbjct: 75  QEPEWFNN--PKKRNIPQNVIRRNVNE 99

>CAGL0L03069g Chr12 complement(354287..355885) [1599 bp, 532 aa]
           {ON} similar to uniprot|P36119 Saccharomyces cerevisiae
           YKR023w
          Length = 532

 Score = 32.3 bits (72), Expect = 4.0
 Identities = 28/98 (28%), Positives = 46/98 (46%), Gaps = 11/98 (11%)
 Frame = +1

Query: 136 RKQAFKKPNDPNFEAIEVPQSPTKSRV------KSGSQNAVKQVT----RLETSNANESN 285
           RK+    PN+P+ EA  V    ++S+       KS      K  T     +E+ +   S 
Sbjct: 75  RKETPSNPNEPSNEATPVRIKTSESKALESNIKKSQEIKPTKPATVKSKPIESGSLVSSK 134

Query: 286 LSQIQKQPELPINTTTYFMQKFQNAKK-DEDRQIAKFE 396
           L Q+  +PE  +NTT    +K Q+ ++ DE  +I + E
Sbjct: 135 LDQVVSKPEKQLNTTQKKNRKVQSLQEIDEIVKILEVE 172

>CAGL0C00407g Chr3 (40815..42467) [1653 bp, 550 aa] {ON} similar to
            uniprot|Q12418 Saccharomyces cerevisiae YLR094c GIS3
          Length = 550

 Score = 32.3 bits (72), Expect = 4.1
 Identities = 37/137 (27%), Positives = 59/137 (43%), Gaps = 7/137 (5%)
 Frame = +1

Query: 1159 LSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAK 1338
            L+EE    K +SHN  NS       D+       + N+D+    + D  K   L+  L  
Sbjct: 207  LTEEMTPDKMNSHNEDNSTDIGKIIDDNLAPKLKIINIDD--LDLNDHWKVDELSEVLPP 264

Query: 1339 IMRR-----KESSGLEDKSDGEKQKMK-QTTENALQTGL-IQRLGFDPTHGEISKVLKSS 1497
            I  R     K  S LE  +D +   +  +  EN  +  L +   G  PT G+++  +K+S
Sbjct: 265  IFHRSYGYVKPVSSLERITDNDSISISHRVQENGRRNSLDLSFTGMKPTQGQMT--IKTS 322

Query: 1498 VPGGESKNNLLNGKKTV 1548
                 S  N++ GK +V
Sbjct: 323  PYSAAS--NIIYGKDSV 337

>NCAS0G02000 Chr7 complement(360567..362222) [1656 bp, 551 aa] {ON}
           Anc_2.86 YNL167C
          Length = 551

 Score = 32.3 bits (72), Expect = 4.1
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
 Frame = +1

Query: 28  VDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAF--KKPNDPNFEAIE 186
           ++  ++   D EDEQ   K  EF+ER R A  +  KRK+ +  K  ND NF  +E
Sbjct: 355 INDNDNTNYDNEDEQD-RKRKEFLERNRVAASKFRKRKKEYIKKIENDLNFYEVE 408

>TBLA0C05670 Chr3 complement(1371536..1373419) [1884 bp, 627 aa] {ON}
            Anc_1.162 YKL179C
          Length = 627

 Score = 32.3 bits (72), Expect = 4.2
 Identities = 49/206 (23%), Positives = 82/206 (39%), Gaps = 48/206 (23%)
 Frame = +1

Query: 1096 PSLYKAKGENRFNIIR------DARKGLSEEEERMKKSSH---------------NFTNS 1212
            P L K   EN  +I        D+RK L++E +  KK S                N  +S
Sbjct: 19   PDLQKNLDENIISIKSKETESIDSRKLLAKETKSFKKKSEEEKLTSINKIIKQYQNEIDS 78

Query: 1213 NSAKAFFDEKF---------QNPDMLANLDNKRRKI-TDTKKSKALNRELAKIMRRKES- 1359
             + ++ F E           + PD L  L N    +  D  K + L  E+  +++ KES 
Sbjct: 79   LTKRSKFSESILFDIYSKVSEVPDPLPLLKNSINSLKVDNSKDQELQNEINVLLKDKESL 138

Query: 1360 ----SGLEDKSDGEKQKMKQTTE---------NALQTGLIQRLGFDPTHGEISKVLKSS- 1497
                + +++K + E  K+K   E         N LQ+   +     P    +++ L +S 
Sbjct: 139  NNQLNEIKEKQNEESTKLKNEIETLNKKLEILNKLQSDKAKDNQDSPQISLLTEELNNSI 198

Query: 1498 --VPGGESKNNLLNGKKTVINDLLHY 1569
              +   E+KNNLL    T + + L +
Sbjct: 199  SKISDLENKNNLLTKDLTKLKEDLEH 224

>Kwal_14.2258 s14 (679677..681776) [2100 bp, 699 aa] {ON} YGR145W -
            Protein required for cell viability [contig 227] FULL
          Length = 699

 Score = 32.3 bits (72), Expect = 4.3
 Identities = 29/131 (22%), Positives = 54/131 (41%), Gaps = 12/131 (9%)
 Frame = +1

Query: 1126 RFNIIRDARKGLSEEEERMK-------KSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKR 1284
            + N ++ AR+     E+R++                     F D + +  D  +  D+K+
Sbjct: 505  QLNPVKSARETEEGAEKRIRALTAAEESDEERIAMKEGRGQFSDSEDEESDSESEQDDKQ 564

Query: 1285 RKITDTKKSKALNRELAKIMRRKESSGLEDK-----SDGEKQKMKQTTENALQTGLIQRL 1449
             ++T+ K+ K L +++A   RRK+   + DK     S G   +  Q T         Q +
Sbjct: 565  DEMTE-KEKKMLAKQVAAAQRRKKDKEITDKFMNEMSVGANDRYSQET---------QEM 614

Query: 1450 GFDPTHGEISK 1482
            GFD    ++ K
Sbjct: 615  GFDKKVAQLRK 625

>TBLA0J01560 Chr10 (349382..351526) [2145 bp, 714 aa] {ON} Anc_7.191
            YFR034C
          Length = 714

 Score = 32.3 bits (72), Expect = 4.3
 Identities = 34/123 (27%), Positives = 50/123 (40%), Gaps = 5/123 (4%)
 Frame = +1

Query: 1186 KSSHNFTNSNSAKAFFDEKFQNPDMLANLDN-----KRRKITDTKKSKALNRELAKIMRR 1350
            +S++N TNS S+ A         D+  NL N      R    D   S +LNR+ +   +R
Sbjct: 247  QSNYNITNSTSSSAP-SNGLTAADLTVNLLNTPLLTNRNNNNDNSNSSSLNRKSSSSSKR 305

Query: 1351 KESSGLEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLL 1530
            K+SS     S+    +    T  A+           PT    SKV K+S     SK  + 
Sbjct: 306  KKSSTSNSNSNSNTVQFSPLTSPAI----------GPT-TTTSKVTKNSPYLQNSKRKIS 354

Query: 1531 NGK 1539
            N +
Sbjct: 355  NSE 357

>Suva_6.249 Chr6 (444869..447082) [2214 bp, 737 aa] {ON} YJL168C
            (REAL)
          Length = 737

 Score = 32.3 bits (72), Expect = 4.3
 Identities = 22/90 (24%), Positives = 44/90 (48%), Gaps = 6/90 (6%)
 Frame = +1

Query: 1159 LSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRK-----ITDTKKSKALN 1323
            LS+EE   KK        N+ +    E+ ++      L+N+R+      I +  K K + 
Sbjct: 544  LSDEEYERKKRKRLEYERNALERAKQEELESLKQKLKLENERKSVLEDIIAEANKQKEVQ 603

Query: 1324 RELA-KIMRRKESSGLEDKSDGEKQKMKQT 1410
            +E A K++  KE+  L+ K+  + Q+++ +
Sbjct: 604  KEEAKKLVEAKEAKRLKRKTASQSQRLEHS 633

>Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}
           similar to Ashbya gossypii AGL091W
          Length = 840

 Score = 32.3 bits (72), Expect = 4.4
 Identities = 19/69 (27%), Positives = 33/69 (47%)
 Frame = +1

Query: 160 NDPNFEAIEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYF 339
           N   F + E+P SPT   V+  S N    ++ + ++N   SNL+Q   Q    I+ T+  
Sbjct: 185 NSEKFASFEIPNSPTP--VQCASMNVTNSISTMFSNNKITSNLAQQLAQSPNQIDLTSSL 242

Query: 340 MQKFQNAKK 366
            +   N ++
Sbjct: 243 PKNIINLRQ 251

>NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa]
           {ON} Anc_5.591
          Length = 957

 Score = 32.3 bits (72), Expect = 4.5
 Identities = 15/50 (30%), Positives = 29/50 (58%)
 Frame = +1

Query: 445 YKPIIANELEGFSNLWVKKRYIPEDDLKRSLHEIKILRLGKLFAKVRPPK 594
           Y P++ N  +G+ + + K R + E+D KR + ++K ++L     K + PK
Sbjct: 692 YDPLVVNREKGWVDCFFKARQLIEEDEKRVVDKVKGIKLSPPAEKSKIPK 741

>CAGL0J00693g Chr10 complement(61246..66900) [5655 bp, 1884 aa] {ON}
            similar to uniprot|P08964 Saccharomyces cerevisiae
            YHR023w MYO1
          Length = 1884

 Score = 32.3 bits (72), Expect = 4.8
 Identities = 22/81 (27%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = +1

Query: 1171 EERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRR 1350
            EE +K      ++++  +A+   K    + L N D +  KI + KKSKAL R + ++  R
Sbjct: 1734 EETIKDLDQRLSDTSEKEAWL-RKIHEVETLLN-DERDMKIEEMKKSKALERTINELEAR 1791

Query: 1351 KESS-GLEDKSDGEKQKMKQT 1410
              S   + + ++G++ K ++T
Sbjct: 1792 NASQVEVIETANGDRTKFEET 1812

>Smik_8.90 Chr8 (131286..137069) [5784 bp, 1927 aa] {ON} YHR023W
            (REAL)
          Length = 1927

 Score = 32.3 bits (72), Expect = 4.8
 Identities = 35/169 (20%), Positives = 75/169 (44%), Gaps = 1/169 (0%)
 Frame = +1

Query: 1081 KVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDM 1260
            ++ S+    + K     + ++D  + L++E+E +K++ +      ++     ++F   D+
Sbjct: 879  EMESKKKFLEEKNRKTIDELKDTHELLNQEKENLKRNENLLNRIKTSSGTLQKQFN--DL 936

Query: 1261 LANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLI 1440
            ++  D              +NR+  +IM++ E S L      E  K ++TT   L     
Sbjct: 937  VSEKDE-------------INRQKLQIMQKLEESELTIHDLQETVKERETTLEKLHIKND 983

Query: 1441 QRL-GFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKV 1584
            Q +      + +ISK   S     ESK  L N  + + N +++ K+E++
Sbjct: 984  QLIKQISDLNCDISKEQSSQSLIKESKMKLENEIERLKN-IINLKEEEI 1031

>Kpol_274.4 s274 (5051..6838) [1788 bp, 595 aa] {ON} (5051..6838)
            [1788 nt, 596 aa]
          Length = 595

 Score = 32.0 bits (71), Expect = 5.5
 Identities = 23/92 (25%), Positives = 42/92 (45%)
 Frame = +1

Query: 1153 KGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNREL 1332
            K L  E+E+ KK +      +  ++  +E+ +  +  A    +RR+        AL  + 
Sbjct: 124  KRLEREKEKQKKEAQRLEEKSKRESKLEEEKRKREEKAAEVKRRRE--------ALKLQK 175

Query: 1333 AKIMRRKESSGLEDKSDGEKQKMKQTTENALQ 1428
             +  R+KE   LE K   E++K+K   E  L+
Sbjct: 176  EEEKRKKEEERLETKRKREEEKLKIEEEKRLK 207

>Kwal_23.6516 s23 complement(1621594..1622538) [945 bp, 314 aa] {ON}
           YNR054C - Protein required for cell viability [contig
           18] FULL
          Length = 314

 Score = 31.6 bits (70), Expect = 5.9
 Identities = 18/52 (34%), Positives = 27/52 (51%)
 Frame = +1

Query: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKK 156
           +D  RE       +S   D+E EQ +    E  ++ RQ  +ERLK+ +A KK
Sbjct: 53  VDTGREAGTTQEDDSKNRDQEPEQNVETSEESNQKLRQERLERLKKLRAVKK 104

>Kpol_1031.15 s1031 (38596..41385) [2790 bp, 929 aa] {ON}
            (38596..41385) [2790 nt, 930 aa]
          Length = 929

 Score = 32.0 bits (71), Expect = 5.9
 Identities = 35/183 (19%), Positives = 76/183 (41%), Gaps = 14/183 (7%)
 Frame = +1

Query: 1078 TKVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNF-TNSNSAKAFFDEKFQN- 1251
            ++++++  L++ K     N + D ++    + E MK+      TN+N   +   +K +  
Sbjct: 409  SQISNENKLFRDKISKLSNQLDDTKRERDNQVELMKRRIDEIITNNNRENSIAADKSEEI 468

Query: 1252 -PDMLANLDNKRRKITDTKKSKAL------NRELAKIMRRKE-----SSGLEDKSDGEKQ 1395
                 A+++  +RK+ DT K + L      ++  A+I++ K+     +  L+   +  K+
Sbjct: 469  REKQEAHINELQRKLNDTLKVQTLSISTVEDKFKAEILKTKKELEENAQKLQKSEELVKE 528

Query: 1396 KMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKK 1575
              +Q  EN            +    EI+ +    +      N+L    K   N+L  Y  
Sbjct: 529  LKRQVIENTTNASERNSKRLETKDKEINLLKNDIIELKNKINSLEKDSKLEDNNLREYYT 588

Query: 1576 EKV 1584
             K+
Sbjct: 589  NKI 591

>ABR035C Chr2 complement(461280..464225) [2946 bp, 981 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR336C
           (SGD1)
          Length = 981

 Score = 32.0 bits (71), Expect = 5.9
 Identities = 21/77 (27%), Positives = 41/77 (53%), Gaps = 3/77 (3%)
 Frame = +1

Query: 40  NSVTSDEEDEQAIAKELEF---MERKRQALMERLKRKQAFKKPNDPNFEAIEVPQSPTKS 210
           NS +SDE++E+   +EL+    MER R     ++K++Q  K+P     E ++  Q+  + 
Sbjct: 137 NSSSSDEQEEEEEEEELDAAQTMERLRALKAAKVKKQQRSKEPEQE--EELDAAQTMERL 194

Query: 211 RVKSGSQNAVKQVTRLE 261
           R    +++  K  ++ E
Sbjct: 195 RALKAAKSKAKHRSQEE 211

>SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar to
            uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1047

 Score = 32.0 bits (71), Expect = 6.0
 Identities = 37/163 (22%), Positives = 65/163 (39%), Gaps = 14/163 (8%)
 Frame = +1

Query: 1114 KGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKI 1293
            +GEN  + +    +   EEEE  ++           +   D++ ++ D      NK  K 
Sbjct: 726  EGENASDTVNSGEEEEEEEEEEEEEEEEEEEGEEEEEEEGDDQSEDNDYSNEDINKIDKE 785

Query: 1294 TDTKKSKALN--------------RELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQT 1431
            T +  +KALN               EL++     ES   ED+   + +KM +  +   Q 
Sbjct: 786  TTSALAKALNLPDGIINENGEVNFNELSESDDEDESEEDEDEESMDDEKMMELDDQLSQ- 844

Query: 1432 GLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDL 1560
             + QR        +IS   K  +   ES+ N++  K  V++ L
Sbjct: 845  -IFQRR--KEALSKISTGNKRKLEAKESRENVIAFKHKVVDML 884

>Kpol_1018.105 s1018 complement(274868..278014) [3147 bp, 1048 aa]
            {ON} complement(274868..278014) [3147 nt, 1049 aa]
          Length = 1048

 Score = 32.0 bits (71), Expect = 6.0
 Identities = 28/117 (23%), Positives = 51/117 (43%), Gaps = 22/117 (18%)
 Frame = +1

Query: 1123 NRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDM-------------- 1260
            N  NII   +  + E++  +        ++N  K   +E    PD+              
Sbjct: 926  NLENIIMALQNEVEEQKHTLYMKLERAQSNNLVKLIKEENKHRPDLAAAENDKLTRTEEY 985

Query: 1261 ---LANLD----NKRRKITDTKKSKALNRELAKIMRRKESSGLE-DKSDGEKQKMKQ 1407
               LA L+    NK+R I +  +  A N+  +KI++ K+ SG+E D  D +  +++Q
Sbjct: 986  EGLLAELNKLKANKKRLIREIVEKTATNKTSSKILKYKKLSGIEVDDIDSKLDEIEQ 1042

>KLTH0F13464g Chr6 complement(1104307..1108425) [4119 bp, 1372 aa]
            {ON} some similarities with uniprot|P32521 YIR006C
            Saccharomyces cerevisiae PAN1 Part of actin cytoskeleton-
            regulatory complex Pan1p-Sla1p-End3p
          Length = 1372

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 39/183 (21%), Positives = 76/183 (41%), Gaps = 18/183 (9%)
 Frame = +1

Query: 1132 NIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKS 1311
            ++I  + + L+  + ++K S      + +    F  K  + +ML +  N+RR I+++K +
Sbjct: 704  SLIPSSTQILNSVKNQLKSSPDAIKKAPTKVDGFSFKHDDDEMLPSSRNRRRTISESKNT 763

Query: 1312 KALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLI------QRLGFDPTHGE 1473
                          E  G    S    QK+ Q  E+ +Q          QRL  +    +
Sbjct: 764  --------------EKQGTSSISTAGNQKL-QVDESPVQLSTTTKNDYNQRLSGEQAIED 808

Query: 1474 ISKVLKSSVPGGESKNNLLNGKKTVIN---DLLHYKKEKVI---------LAPSKNEWFK 1617
            + + L S     +S NNLL G+   +    D L  +  +++         +A +K E ++
Sbjct: 809  LKRKLNSLPRAIDSSNNLLTGETKELKAQFDSLASRVPQILAEISDVNNQIATAKIELYR 868

Query: 1618 KRN 1626
            +RN
Sbjct: 869  QRN 871

>SAKL0E09768g Chr5 complement(813986..818332) [4347 bp, 1448 aa] {ON}
            highly similar to gnl|GLV|CAGL0J05610g Candida glabrata
            CAGL0J05610g uniprot|O93794 Candida glabrata DNA
            topoisomerase II identified start CAGL0J05610g|CAGL-
            IPF7937|CAGL-CDS0143.1 and similar to YNL088W
            uniprot|P06786 Saccharomyces cerevisiae YNL088W TOP2
            Essential type II topoisomerase catalyzes topology
            changes in DNA via transient breakage and rejoining of
            phosphodiester bonds in the DNA backbone localizes to
            axial cores in meiosis
          Length = 1448

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 18/100 (18%)
 Frame = +1

Query: 1144 DARKGLSEEEERMKKSSHNFTNSNSA----------KAFFDEKFQNPDMLAN--LDNKRR 1287
            D  +GLS    R K+ S NF N +S+          +   D++ ++   + N     K+ 
Sbjct: 1296 DGDEGLSVFSNRFKEVSSNFDNLSSSHSTSQLNQEDRVDIDQETESSKHVKNKLASAKKA 1355

Query: 1288 KITDTKKSKALNRELAKIMRRK------ESSGLEDKSDGE 1389
             ITD +   A + E+ K  +RK      +S  L D+SD E
Sbjct: 1356 SITDNENKSASDEEVIKKNKRKSTPRSRKSVALSDESDLE 1395

>ZYRO0B05786g Chr2 complement(457353..466337) [8985 bp, 2994 aa] {ON}
            similar to uniprot|P18963 Saccharomyces cerevisiae
            YBR140c IRA1 or uniprot|P19158 Saccharomyces cerevisiae
            YOL081w IRA2
          Length = 2994

 Score = 32.0 bits (71), Expect = 6.4
 Identities = 28/133 (21%), Positives = 57/133 (42%), Gaps = 20/133 (15%)
 Frame = +1

Query: 253  RLETSNANESNLSQIQKQ-----PELPINTTTYFMQKFQNAKKDEDRQIAKFES------ 399
            R  T + N + L Q +++     P+  I++   + Q ++   +   R IA F++      
Sbjct: 1890 RFLTIDENMAILGQPREELRNEIPQCIIDSKEEYPQLYEFMSRHAFRSIAVFDTTNTFVH 1949

Query: 400  ---------MMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKRYIPEDDLKRSLHEIKI 552
                     ++     +F + N + + II    + ++ +W  K Y+  D      HEI +
Sbjct: 1950 ESMSSDGLPIITLTFSSFRSKNIEIETIIYRTFQIYARIWSVKYYLVLDCTHFDEHEIDV 2009

Query: 553  LRLGKLFAKVRPP 591
            ++L  LF  + PP
Sbjct: 2010 VKLTSLFNNLVPP 2022

>Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON}
           similar to Ashbya gossypii ABR130W
          Length = 114

 Score = 30.0 bits (66), Expect = 6.5
 Identities = 17/62 (27%), Positives = 28/62 (45%)
 Frame = +1

Query: 586 PPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERY 765
           PPK   P  +      +++ K+ + FT +      F F   D + TL+ + F  KG   Y
Sbjct: 5   PPKDHIPSQSP-PKGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMY 63

Query: 766 YN 771
           Y+
Sbjct: 64  YD 65

>YDR076W Chr4 (598468..599688) [1221 bp, 406 aa] {ON}  RAD55Protein
           that stimulates strand exchange by stabilizing the
           binding of Rad51p to single-stranded DNA; involved in
           the recombinational repair of double-strand breaks in
           DNA during vegetative growth and meiosis; forms
           heterodimer with Rad57p
          Length = 406

 Score = 31.6 bits (70), Expect = 6.5
 Identities = 26/104 (25%), Positives = 49/104 (47%), Gaps = 2/104 (1%)
 Frame = +1

Query: 184 EVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNAK 363
           E+   P   +   G Q     +  ++ S  N+  +  I+   E+PIN      QKF+  +
Sbjct: 40  EIFGPPGIGKTNFGIQLVCNSLEGIQQSEINDDKILWIETFQEMPINILRERFQKFKIVE 99

Query: 364 KDEDR-QIAKFESMMDARVHTFG-TDNKKYKPIIANELEGFSNL 489
           ++  R +I KF  ++    + F  + + +YK +I   ++GFS L
Sbjct: 100 ENVKRVRITKFGQLLYFFQNLFKLSQSVRYKLVI---IDGFSQL 140

>NCAS0B00660 Chr2 complement(94734..96017) [1284 bp, 427 aa] {ON} 
          Length = 427

 Score = 31.6 bits (70), Expect = 6.6
 Identities = 29/101 (28%), Positives = 51/101 (50%), Gaps = 5/101 (4%)
 Frame = +1

Query: 49  TSDEEDEQAIAK-ELEFMERK-RQALMERLKRKQAFKKPNDPNFEA-IEVPQSPTKSRV- 216
           +S++ED +  +K E + M  + R+AL +     +  KK N  N  +  E+ +   K R  
Sbjct: 328 SSNKEDSKEDSKPEFDIMTTEGREALKKYCDELK--KKENSKNLVSRTELAKKSDKLRKI 385

Query: 217 -KSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTY 336
            K+G  N + ++    TSN  + N  + +K+ ELP N  T+
Sbjct: 386 QKTGKLNFIDELVNPFTSNKEQRNFFKSRKEMELPQNVPTW 426

>TPHA0B04680 Chr2 (1100596..1101927) [1332 bp, 443 aa] {ON} Anc_1.59
            YLR181C
          Length = 443

 Score = 31.6 bits (70), Expect = 6.7
 Identities = 46/209 (22%), Positives = 76/209 (36%), Gaps = 5/209 (2%)
 Frame = +1

Query: 880  FKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGG 1059
            F CIL +   +      I + +  +KC     I L K                 I++   
Sbjct: 125  FNCILHLWGDK------ITDKEPVRKCTKLCKIYLSKLAKGEIGASANDKLDNAIDMAPT 178

Query: 1060 YA-LGAPTKVNS----QPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAK 1224
             A +G+    NS    +    K  GE   NI+ D    +  EEE+++KS       ++ +
Sbjct: 179  QAPVGSTASKNSDHEEEHDYIKYNGEINQNIVTDLENIVDTEEEKVEKSI-----EDNNR 233

Query: 1225 AFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMK 1404
             F  + +   D+  N  N  +   +T   +A N     I R       +D       + K
Sbjct: 234  EFSTDTYVTSDVSMNKKNNHQTEPETDNKEADNMSGISIPR-------DDDIANMITEYK 286

Query: 1405 QTTENALQTGLIQRLGFDPTHGEISKVLK 1491
            + T+ A Q          PT  EI K++K
Sbjct: 287  KLTDEANQGPAGLSYQKPPTEEEIKKMIK 315

>NCAS0C05190 Chr3 complement(1056868..1058202) [1335 bp, 444 aa] {ON}
            Anc_2.636 YKL082C
          Length = 444

 Score = 31.6 bits (70), Expect = 6.7
 Identities = 33/133 (24%), Positives = 60/133 (45%), Gaps = 12/133 (9%)
 Frame = +1

Query: 1045 ELNGGYALGAPTK--VNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNS 1218
            ELNG  AL    K  VN+ P +   +   +F   +  +K  +E+EE +++         S
Sbjct: 68   ELNGS-ALDVMKKREVNAVPVVLPGE---KFKKFQQQKKNAAEKEEELEEEDEE---EES 120

Query: 1219 AKAFFDEKFQN---PDMLANLDNKRRKIT-------DTKKSKALNRELAKIMRRKESSGL 1368
             K  FD++       D ++N + +  + +       +TK+   L  E  KI ++K+   L
Sbjct: 121  IKVVFDDEGNEMPISDEISNAEEEDEEESSVDEPKLETKEKTNLEDEQEKIEKQKKLDAL 180

Query: 1369 EDKSDGEKQKMKQ 1407
             +K   + Q +KQ
Sbjct: 181  REKLQQKIQTLKQ 193

>KNAG0A06690 Chr1 (1043455..1043490,1043606..1043863) [294 bp, 97
           aa] {ON} Anc_2.504 YKL006C-A
          Length = 97

 Score = 29.6 bits (65), Expect = 6.7
 Identities = 14/51 (27%), Positives = 27/51 (52%)
 Frame = +1

Query: 280 SNLSQIQKQPELPINTTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTFGT 432
           SN SQ++   +  +N+    +  F+N  +D + Q     S++D   +TFG+
Sbjct: 4   SNYSQVESNNDERLNSLANKLATFRNINEDINEQAVNDSSLVDQISNTFGS 54

>ZYRO0E06424g Chr5 (487921..488277) [357 bp, 118 aa] {ON} similar to
            uniprot|P35727 Saccharomyces cerevisiae YKL061W
            Hypothetical ORF
          Length = 118

 Score = 30.0 bits (66), Expect = 6.8
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 3/85 (3%)
 Frame = +1

Query: 1138 IRDARKGLSEEEERMKKSSHNFTNSNSAKA---FFDEKFQNPDMLANLDNKRRKITDTKK 1308
            +RD  + L+++ ER      +F ++ SAKA   F ++  +N D L  +  K R I D  +
Sbjct: 1    MRDQERTLNQDVERCINVLQDFLDTGSAKAISVFSNKTSENEDWLEEIRVKYR-IKDNDE 59

Query: 1309 SKALNRELAKIMRRKESSGLEDKSD 1383
             +A+  ++ K  R  +   LE K D
Sbjct: 60   LQAI--KMLKQKRLDQLEALESKVD 82

>Skud_15.478 Chr15 complement(836937..837160,837194..838505) [1536 bp,
            512 aa] {ON} YOR310C (REAL)
          Length = 512

 Score = 31.6 bits (70), Expect = 7.0
 Identities = 31/124 (25%), Positives = 59/124 (47%), Gaps = 24/124 (19%)
 Frame = +1

Query: 1108 KAKGENRFN------------IIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDE---- 1239
            +AK ENR +            ++R+A+K      E  +  ++N  ++++ KA +DE    
Sbjct: 391  RAKVENRLSQLEGRDLRTTPKVVREAKK-----VEMTEGRAYN-ADADTIKAEYDEEEEK 444

Query: 1240 KFQNPDMLANLDNKRRK--------ITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQ 1395
            K +  +     DNKR++          D+KKSK   +E  +   +KE    ++K D +++
Sbjct: 445  KEKKKEKKEKKDNKRKRDDDEDSKDSKDSKKSKKDKKEKKEKKEKKEKKEKKEKKDKKEK 504

Query: 1396 KMKQ 1407
            K K+
Sbjct: 505  KEKK 508

>SAKL0H09922g Chr8 complement(849513..851180) [1668 bp, 555 aa] {ON}
            highly similar to uniprot|P12709 Saccharomyces cerevisiae
            YBR196C PGI1 Glycolytic enzyme phosphoglucose isomerase
            catalyzes the interconversion of glucose-6- phosphate and
            fructose-6-phosphate required for cell cycle progression
            and completion of the gluconeogenic events of sporulation
          Length = 555

 Score = 31.6 bits (70), Expect = 7.1
 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 4/74 (5%)
 Frame = +1

Query: 1102 LYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFD--EKFQNPDMLANLD 1275
            LY++KG++        +   +++ +R +K S  FTN + +K  FD  +   N ++L+ L 
Sbjct: 25   LYESKGKSL-----SVKDEFAKDSKRFEKYSKTFTNYDGSKILFDFSKNLINDEILSALT 79

Query: 1276 N--KRRKITDTKKS 1311
               K  K+TD + S
Sbjct: 80   ELAKEAKVTDLRDS 93

>TPHA0D00910 Chr4 (180414..182294) [1881 bp, 626 aa] {ON} Anc_8.121
            YPR018W
          Length = 626

 Score = 31.6 bits (70), Expect = 7.3
 Identities = 20/83 (24%), Positives = 40/83 (48%), Gaps = 3/83 (3%)
 Frame = +1

Query: 1141 RDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKAL 1320
            RDA+  L EE+++ K+           K   +EK +  +    +  KR ++   K+++ L
Sbjct: 149  RDAKLKLKEEDKKQKELQRKKEKLEREKRLQEEKKKREEKAEEVKRKREEVRLLKEAEKL 208

Query: 1321 NRE---LAKIMRRKESSGLEDKS 1380
             RE   LA   +R+E    ++++
Sbjct: 209  KREEERLAVKRKREEEKKAKERA 231

>TPHA0H00500 Chr8 (97469..98326) [858 bp, 285 aa] {ON} Anc_8.127
            YGL174W
          Length = 285

 Score = 31.2 bits (69), Expect = 7.4
 Identities = 36/164 (21%), Positives = 67/164 (40%), Gaps = 7/164 (4%)
 Frame = +1

Query: 1168 EEERMKKSSHNFTNSNSAKAFFD---EKFQNPDMLANLDNKRR---KITDTKKSKALNRE 1329
            +E+ M+K  +  + SN    + D    K +N D+   +D   +   ++ D +K   +N+ 
Sbjct: 118  KEKDMEKRQNISSMSNKEVIYRDLSGRKIKNIDLKLKVDENEKNNKQLLDMQKLIDMNKG 177

Query: 1330 LAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGG 1509
              ++   K+S  LE  +   KQ         LQ    Q+ GF      +     +S+ G 
Sbjct: 178  DVQLSMAKKSMTLEQLTSKSKQL------EILQEDPAQQFGFSKDQDILDTYNNTSITGY 231

Query: 1510 ESKNNLLNGKKTVINDLLHYKKEKVILAPS-KNEWFKKRNHREE 1638
            +    +    +  I     Y+ + V  +   +  WFKK+N  EE
Sbjct: 232  KLYTKIFPDNRFGIQP--GYRWDGVDRSNGFEKRWFKKKNELEE 273

>Kpol_1055.89 s1055 (228896..231154) [2259 bp, 753 aa] {ON}
            (228896..231154) [2259 nt, 753 aa]
          Length = 753

 Score = 31.6 bits (70), Expect = 7.5
 Identities = 22/60 (36%), Positives = 29/60 (48%)
 Frame = +1

Query: 1102 LYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNK 1281
            L++A  EN  N       G+    ER      N TN  +A A FDEKF  PD+L+  + K
Sbjct: 672  LFQAPIENILNWDSQKIVGI----ERWLNKLINLTNQITALASFDEKFSTPDVLSGPNAK 727

>TPHA0J01440 Chr10 (334822..337212) [2391 bp, 796 aa] {ON} Anc_5.677
            YOR073W
          Length = 796

 Score = 31.6 bits (70), Expect = 7.6
 Identities = 38/146 (26%), Positives = 63/146 (43%), Gaps = 12/146 (8%)
 Frame = +1

Query: 1168 EEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMR 1347
            EEE+  K +++  N NS       KF N +  A L  KRRK +  ++S     E   +  
Sbjct: 244  EEEKKNKKNNDNNNDNSNDDSNINKFINNENTATLPKKRRK-SSRRESFVFTDEQEFLDA 302

Query: 1348 RKESSGLEDKS---DGEKQKMKQTTEN--ALQTGLIQRLGFDP-------THGEISKVLK 1491
               ++ LE+ +   D  K+  +   EN  +L+  +I+++  +P       TH  IS   +
Sbjct: 303  ADHNNNLENNNIIEDSIKEIRQIEFENNKSLKGCVIEKINEEPELTNTTITHDLISS--E 360

Query: 1492 SSVPGGESKNNLLNGKKTVINDLLHY 1569
            S     E  NN      T  N ++ Y
Sbjct: 361  SESIEQEIDNNPPENSFTFTNSIIEY 386

>TPHA0K01940 Chr11 (408375..410996) [2622 bp, 873 aa] {ON} Anc_4.56
           YGL049C
          Length = 873

 Score = 31.6 bits (70), Expect = 7.7
 Identities = 26/127 (20%), Positives = 52/127 (40%), Gaps = 16/127 (12%)
 Frame = +1

Query: 4   DDPREILAVDPYNSVTSDEEDEQAIAKELEFMER-------KRQALMERLKRKQAFKKP- 159
           D P E  +  P  +  ++E    A+ KEL F E+       K Q   E ++++    +P 
Sbjct: 197 DKPVETESPTPVGTAPTEEAPVNAVKKELTFAEKLKLKKLQKAQEAGEDIQKETITAEPV 256

Query: 160 --------NDPNFEAIEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPEL 315
                    +P  E +  P +   + V++ S+  +          A +++ S ++K+ EL
Sbjct: 257 AEPVAEPVAEPVAEPVAAPDAAPDADVEATSEAQLAATGEQTEETATDASKSPVEKKEEL 316

Query: 316 PINTTTY 336
              T  +
Sbjct: 317 ENGTPAF 323

>NDAI0G04150 Chr7 complement(997652..998608) [957 bp, 318 aa] {ON}
           Anc_1.414 YCL005W
          Length = 318

 Score = 31.2 bits (69), Expect = 7.8
 Identities = 19/93 (20%), Positives = 40/93 (43%)
 Frame = +1

Query: 154 KPNDPNFEAIEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTT 333
           +  D  F  +  P S ++  V + + N      + +  N+N  N+S  +     P N   
Sbjct: 188 RKQDAMFTTLTSPLSSSRENVLNVATNLPSDFFQEKEKNSNSYNISMFENM-YTPSNNEN 246

Query: 334 YFMQKFQNAKKDEDRQIAKFESMMDARVHTFGT 432
           +++   Q+ ++ ++RQ +   S M   +  F T
Sbjct: 247 HYISSAQSPRQFKNRQSSSTSSSMSDLLDPFST 279

>TBLA0H00300 Chr8 complement(51145..54972) [3828 bp, 1275 aa] {ON}
            Anc_2.409 YMR128W
          Length = 1275

 Score = 31.6 bits (70), Expect = 8.0
 Identities = 26/94 (27%), Positives = 40/94 (42%)
 Frame = +1

Query: 1357 SSGLEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNG 1536
            +S L   S+ E  +     E AL+   +Q L F P   +IS++ K  +            
Sbjct: 48   TSNLPKDSNAELLEPVTAEEKALKKRKLQEL-FTPKESKISRLKKKRLDKFIEHQLKREE 106

Query: 1537 KKTVINDLLHYKKEKVILAPSKNEWFKKRNHREE 1638
            K T+I  L  YK +  IL  SK     ++  +EE
Sbjct: 107  KTTIIKKLQDYKMDTSILVSSKRLGHGRQTKKEE 140

>YDR464W Chr4 (1388872..1393179) [4308 bp, 1435 aa] {ON}
           SPP41Protein involved in negative regulation of
           expression of spliceosome components PRP4 and PRP3
          Length = 1435

 Score = 31.6 bits (70), Expect = 8.1
 Identities = 43/234 (18%), Positives = 93/234 (39%), Gaps = 6/234 (2%)
 Frame = +1

Query: 4   DDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEAI 183
           D+   +  ++    + ++EE+E+   K        + +  +  K+K+  K  N  + +  
Sbjct: 173 DENLRMAILESLQELNTNEEEEKEPEKHEHAAPNDKLSSKKSSKKKKKDKSKNRESSKDK 232

Query: 184 EVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQ-----IQKQPELPINTTTYFMQK 348
              +S + S  K  +++  K+     T+N N  +LS      I +     I+T    +  
Sbjct: 233 SSKKSKSSSHSKKHAKDRNKEKQSKPTNNENTLDLSNILENLIHENDNAAIDTAKQTVDI 292

Query: 349 FQNAKKDE-DRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKRYIPEDDL 525
             N+  D  + +  + +++++A +  F  +     P      E  S   V  R   E   
Sbjct: 293 QDNSHTDNTNNEDVEAQALVEATLKAFENELLSSAPTEEPSQEQ-SIGPVSSRKAVEPPR 351

Query: 526 KRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVK 687
           K +  +I +  L     K RPP+ +    +  +     ++KS    ++S+K  K
Sbjct: 352 KPTADDIPLAMLQAFKPKKRPPQEKKKTKSKTSKAASTANKSPASESTSKKKKK 405

>ZYRO0F16368g Chr6 complement(1342457..1343491) [1035 bp, 344 aa]
           {ON} some similarities with uniprot|P38852 Saccharomyces
           cerevisiae YHR156C LIN1 Nuclear protein that physically
           interacts with Irr1p a component of the cohesin complex
           may link together proteins involved in chromosome
           segregation mRNA splicing and DNA replication
          Length = 344

 Score = 31.2 bits (69), Expect = 8.1
 Identities = 52/261 (19%), Positives = 101/261 (38%), Gaps = 8/261 (3%)
 Frame = +1

Query: 58  EEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEAIEVPQSPTKSRVKSGSQNA 237
           E++E +   E  F  + R A  +R KRK      +  +F+     +S    + K  + N 
Sbjct: 19  EDEEDSNPGEQGFSRKDRYASRQR-KRKLNTSDYDSDSFDDNSDSESEGGKQEKKENHND 77

Query: 238 VKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNAKKDEDRQIAKFESM-MDAR 414
                 +  S+ ++    + + + E   +   Y   KF+  +  +D+Q  + ES  MD  
Sbjct: 78  -DDGDDMFASDDDQKPPKKSEPETEAVQDAFDYDDPKFEQREPLQDKQDVQLESFNMDED 136

Query: 415 VHTFGTDNKKYKPIIANELEGFSNLWVKK----RYIPED---DLKRSLHEIKILRLGKLF 573
                  N      + NE     + W+ +    R + E    D +R L ++  L+  +  
Sbjct: 137 TTQNEPSNNTDDKYLQNEDYNREDQWIDEVEDVRGVAESQRRDKERRLQKLNELKNRQRH 196

Query: 574 AKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKG 753
             V     +   + N     L +     K  S  +P ++ +  I      +DV    +KG
Sbjct: 197 YMVDEALIRLQYFINPGETVLTALGRFNKLRSRNEPSEYVVNAINFVTDLIDV--IERKG 254

Query: 754 VERYYNLRLGDIIAILNPEVL 816
           +E  Y+L+  D+  ++  E L
Sbjct: 255 IEDVYSLKRSDLSKLIEEESL 275

>ZYRO0G21318g Chr7 complement(1751145..1755509) [4365 bp, 1454 aa]
            {ON} some similarities with uniprot|P47035 Saccharomyces
            cerevisiae YJL076W NET1 Core subunit of the RENT complex
            which is a complex involved in nucleolar silencing and
            telophase exit stimulates transcription by RNA polymerase
            I and regulates nucleolar structure
          Length = 1454

 Score = 31.6 bits (70), Expect = 8.1
 Identities = 40/173 (23%), Positives = 66/173 (38%), Gaps = 9/173 (5%)
 Frame = +1

Query: 1150 RKGLSEEEERMKKSSHNFTNSN---SAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKAL 1320
            +K   EEE+R K+ S            K   D K Q  +M      +R+K  +  + +  
Sbjct: 977  KKKQEEEEKRRKEESEKKRQQELEKKRKEELDRKKQQEEM------ERKKQQEEVEKRKR 1030

Query: 1321 NRELAK------IMRRKESSGLEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISK 1482
              EL K      + RR++   LE K   E +K ++  E   Q   +Q             
Sbjct: 1031 QEELEKKKQEEELERRRQQEELEKKKQAEVKKKQEELEKKRQEEELQ------------- 1077

Query: 1483 VLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKKRNHREEV 1641
                    G+ +   L  KK  + +L   KK++ +    K +  ++R  REEV
Sbjct: 1078 --------GKRQQEELE-KKRQLEELNRKKKQEELEKKRKEKEDQERKRREEV 1121

>TBLA0B09680 Chr2 (2298522..2303129) [4608 bp, 1535 aa] {ON} Anc_2.79
            YNL176C
          Length = 1535

 Score = 31.6 bits (70), Expect = 8.1
 Identities = 20/101 (19%), Positives = 43/101 (42%)
 Frame = +1

Query: 181  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 360
            + +P++P  +++ S   N +   T  + SN   SNL+ I     + + T+ Y    ++NA
Sbjct: 885  LPLPETPI-TQIDSQELNYLTSTTSFDISNIESSNLNAIDSLQSILLGTSNYVFTDYENA 943

Query: 361  KKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFS 483
                     +  S+     +++   +     +I N +  FS
Sbjct: 944  PSTPSLGSIEITSLTPTSFNSYKASSS--ATLIGNLIPSFS 982

>SAKL0G12804g Chr7 complement(1091709..1097228) [5520 bp, 1839 aa]
            {ON} uniprot|P23466 Saccharomyces kluyveri CYR1 Adenylate
            cyclase
          Length = 1839

 Score = 31.6 bits (70), Expect = 8.2
 Identities = 21/85 (24%), Positives = 41/85 (48%)
 Frame = +1

Query: 169  NFEAIEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQK 348
            N+ A     S  K+++ S S   + ++ RLE    NE+NL+Q+   PE+   T   ++  
Sbjct: 854  NYMANMTSLSLNKAKLSSFSAELLSKLPRLEKLELNENNLTQL--PPEINKLTRLIYLSV 911

Query: 349  FQNAKKDEDRQIAKFESMMDARVHT 423
             +N  +    +I+   S+    +H+
Sbjct: 912  ARNKLESIPDEISDLRSLKSLDLHS 936

>Kthe_YGOB_CWC15 Chr7 complement(983375..984070) [696 bp, 231 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 231

 Score = 30.8 bits (68), Expect = 8.6
 Identities = 14/40 (35%), Positives = 29/40 (72%), Gaps = 2/40 (5%)
 Frame = +1

Query: 52  SDEEDEQAIAKELEFMERKR--QALMERLKRKQAFKKPND 165
           SDEED++A+ +EL  + ++R  Q L E+ +R+ + ++P++
Sbjct: 138 SDEEDQEALLRELNKIRQERMVQKLKEQRERQDSVEEPSE 177

>Suva_7.429 Chr7 (742946..744172) [1227 bp, 408 aa] {ON} YGR142W
           (REAL)
          Length = 408

 Score = 31.2 bits (69), Expect = 8.6
 Identities = 30/137 (21%), Positives = 56/137 (40%), Gaps = 16/137 (11%)
 Frame = +1

Query: 43  SVTSDEEDEQAIAKELEFMERKRQALMERL---------KRKQA-FKKPNDPNFEAIEVP 192
           S+T DE+ ++ + +E    E  RQA  E+L         K KQA  K   +   +  +  
Sbjct: 259 SLTKDEQIKRWVEEERLMQEESRQAKKEKLAKANQERQKKEKQAKLKAKKESLLKRQKAR 318

Query: 193 QSPTKSRVKSGSQNAVKQVTRLETSNA------NESNLSQIQKQPELPINTTTYFMQKFQ 354
           ++  K   +S   +  K   R  T+N       N S  S+ +   +  I + T       
Sbjct: 319 RAEQKKEQESNQSSTSKDGVRHNTNNTDVTESDNASTNSESEMDSDFSITSNTLKKHVSP 378

Query: 355 NAKKDEDRQIAKFESMM 405
             ++ ED +I ++  ++
Sbjct: 379 ILEEIEDEEIDRYNELL 395

>TBLA0B05050 Chr2 (1191456..1192997) [1542 bp, 513 aa] {ON} Anc_6.204
            YGL078C
          Length = 513

 Score = 31.2 bits (69), Expect = 9.2
 Identities = 28/122 (22%), Positives = 52/122 (42%), Gaps = 14/122 (11%)
 Frame = +1

Query: 1276 NKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLIQRLGF 1455
            +K+RK+ D    K   +       +K+    +DK D +++K K+  ++  +   +     
Sbjct: 8    DKKRKVDDNLDKKEKKKLKKDKKDKKDKKDKKDKKDKKEKKEKKEKKSENEEETVNATSN 67

Query: 1456 DP---THGEISKVLKSS---VPGGESK--------NNLLNGKKTVINDLLHYKKEKVILA 1593
            +      GEI K LK +   + GG++         N L    KT++ +L  Y K   I +
Sbjct: 68   ETPVVDAGEIEKFLKENEVIIEGGKTLNINPIINFNELTKLNKTILKELNKYPKPTPIQS 127

Query: 1594 PS 1599
             S
Sbjct: 128  AS 129

>Smik_15.491 Chr15 complement(846605..848155) [1551 bp, 516 aa] {ON}
            YOR310C (REAL)
          Length = 516

 Score = 31.2 bits (69), Expect = 9.2
 Identities = 25/118 (21%), Positives = 51/118 (43%), Gaps = 17/118 (14%)
 Frame = +1

Query: 1108 KAKGENRFN------------IIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQN 1251
            +AK ENR +            ++R+A+K    E       +     ++ + +  D   + 
Sbjct: 391  RAKVENRLSQLEGRDLRTTPKVVREAKKVEITEARAYNADADTAKAASDSDSDSDSDDEE 450

Query: 1252 PDMLANLDNKRRK-----ITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQT 1410
             +     D KR++     + D+KKSK   +E  +   +KE    +DK + + +K K++
Sbjct: 451  EEKEEKKDKKRKRDDDEEVKDSKKSKKEKKEKKEKKEKKEKKEKKDKKEKKDKKEKKS 508

>Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON}
            (118605..120158) [1554 nt, 518 aa]
          Length = 517

 Score = 31.2 bits (69), Expect = 9.2
 Identities = 29/114 (25%), Positives = 53/114 (46%), Gaps = 4/114 (3%)
 Frame = +1

Query: 1096 PSLYKAKGENRFNIIRD--ARKGLSEEEERMKK--SSHNFTNSNSAKAFFDEKFQNPDML 1263
            P+L  ++ E R   I D  ++  + E  ERM+   + HN T+ NS  +   + F+N    
Sbjct: 296  PNLKPSREEERSMKINDYVSKLDIVETGERMESMVNRHNDTDCNSKISSHGDGFRN---- 351

Query: 1264 ANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENAL 1425
               DN +   T+   S+ LN+              E+KS+ + + +++T E+ L
Sbjct: 352  ---DNIQSNSTNNGSSQKLNKNTI-------GDTSEEKSESDLKGLEETVESTL 395

>KNAG0I01990 Chr9 complement(387149..388786) [1638 bp, 545 aa] {ON}
           Anc_2.174 YNL103W
          Length = 545

 Score = 31.2 bits (69), Expect = 9.3
 Identities = 27/121 (22%), Positives = 54/121 (44%), Gaps = 16/121 (13%)
 Frame = +1

Query: 160 NDPNFEAIEVPQSPTKSRVKSGSQNAVKQVTRL-ETSNANESNL-------SQIQKQPEL 315
           +DP   ++ V     K + +   +N    ++ L E+SN   + L       S  +K+P L
Sbjct: 402 SDPLKRSVSVILGLAKEKERFAQENESTYISSLIESSNKRLNELKNKLDQQSHAKKRPLL 461

Query: 316 -PINTTTYFMQKFQNAKKDEDRQIAK-------FESMMDARVHTFGTDNKKYKPIIANEL 471
            P     + +Q+    K+ +++++ K         S +  R+HT   +NK  K ++ N +
Sbjct: 462 EPEQEDAHTVQRPPVKKRQKEKELEKSLKELNELASSLQQRIHTLELENKLLKNLVMNSV 521

Query: 472 E 474
           E
Sbjct: 522 E 522

>Kpol_413.5 s413 (13659..15365) [1707 bp, 568 aa] {ON}
           (13659..15365) [1707 nt, 569 aa]
          Length = 568

 Score = 31.2 bits (69), Expect = 9.4
 Identities = 41/192 (21%), Positives = 77/192 (40%), Gaps = 4/192 (2%)
 Frame = +1

Query: 31  DPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEAIEVPQSPTKS 210
           +P   +    +++Q +  EL+  E+K           +  K  N+ N + I   +    +
Sbjct: 216 EPQLGIYDTTKEDQRVEYELKSFEKK--------VNYRGLKDKNEKNLDKIIRKRKNEGA 267

Query: 211 RVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNAKKDEDR---- 378
           +VK GS              AN+S L+   K+P+L +      M+   N K +E +    
Sbjct: 268 QVKKGS------------IRANDSVLTNEYKKPKLELPKPGQIMENL-NVKTEEQKKRIL 314

Query: 379 QIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKRYIPEDDLKRSLHEIKILR 558
           +  K  S++ A V   G++      I+   ++       + R + +DD         I+ 
Sbjct: 315 EAQKLGSLLSADVK--GSNESVTSVIVEKPVQ-------QNRLVKKDD---------IIV 356

Query: 559 LGKLFAKVRPPK 594
           + KLFA +  PK
Sbjct: 357 ITKLFASLPKPK 368

>AGL075C Chr7 complement(568737..570521) [1785 bp, 594 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR075W
           (RCO1)
          Length = 594

 Score = 31.2 bits (69), Expect = 9.5
 Identities = 37/150 (24%), Positives = 66/150 (44%), Gaps = 5/150 (3%)
 Frame = +1

Query: 160 NDPNFEAIEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYF 339
           ND + E IE+  +P ++ +    Q A +   R        +N+S +Q+Q     N    F
Sbjct: 448 NDGDVE-IELDTTPIEAEIGKDMQCAWENGRRF-------NNISLLQEQ-----NVKLEF 494

Query: 340 MQKFQNAKKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKR--YIP 513
           + K   AK+ +     + E+++  ++H    DNK    +  +  E    LW  +    + 
Sbjct: 495 LDKVYRAKQAQRTHELREETILIEKMHAPPDDNKTKSWLYFSLPEKMRKLWDFQELCVVA 554

Query: 514 EDDLKR---SLHEIKILRLGKLFAKVRPPK 594
           + +LK    S  EIK L+L K   + +P K
Sbjct: 555 DKELKNTYISPDEIKQLQLLKRLLESKPRK 584

>KLTH0E13596g Chr5 (1204633..1206933) [2301 bp, 766 aa] {ON} weakly
           similar to uniprot|P32909 Saccharomyces cerevisiae
           YBR172C SMY2 partial suppressor of myo2-66
           Kinesin-related protein suppressing myosin defects
           (MYO2) and to uniprot|Q02875 YPL105c
          Length = 766

 Score = 31.2 bits (69), Expect = 9.9
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 7/75 (9%)
 Frame = +1

Query: 64  DEQAIAKELEFMERK---RQALMERLKRKQAFKKPND----PNFEAIEVPQSPTKSRVKS 222
           D++A+ + L++ ER+   R   +ERLK ++  K+ N+     +   IE  QS     V++
Sbjct: 342 DQEAVQRRLDYEERQKRERSLALERLKEQELLKQQNELATSLDKNNIEEAQSQEIVNVQA 401

Query: 223 GSQNAVKQVTRLETS 267
            +Q  +K+    E S
Sbjct: 402 ANQEEIKRKRAEEAS 416

>Smik_10.239 Chr10 (380101..382413) [2313 bp, 770 aa] {ON} YJL033W
            (REAL)
          Length = 770

 Score = 31.2 bits (69), Expect = 9.9
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 5/87 (5%)
 Frame = +1

Query: 1159 LSEEEERMKKSSHN-----FTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALN 1323
            L +EEE  KK         F N  SA            ++A++DN  +++   KK +   
Sbjct: 626  LEDEEEFHKKGDAEVQKTEFLNKESA------------VMADIDNIDKQVAKEKKQEKKR 673

Query: 1324 RELAKIMRRKESSGLEDKSDGEKQKMK 1404
            + L + MRR   + +ED+  GE+++ K
Sbjct: 674  KRL-EAMRRDMEAAMEDEFSGEEEEGK 699

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 165,315,868
Number of extensions: 3885715
Number of successful extensions: 13757
Number of sequences better than 10.0: 146
Number of HSP's gapped: 13598
Number of HSP's successfully gapped: 150
Length of query: 573
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 458
Effective length of database: 40,294,809
Effective search space: 18455022522
Effective search space used: 18455022522
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 35 (18.1 bits)